IMD 1.16: 7/06/2007 20:52:43 MBYE44 LBR MBYE44 LBR !MBYE44 LBR"#$%&'()*MDLB-A LBR+,-./0123456789:MDLB-A LBR;<=>?@ABCDEFGHIJMDLB-A LBRKLMNOPQRSTUVWXYZMDLB-A LBR[\]^_`abcdefghijMDLB-A LBR klmnopqrstuvwxyzMDLB-A LBR X{|}~MDLB-B LBRMDLB-B LBR;MDM8-0 LBRMDM8-0 LBRMEXIT LBRY-PUBDOM 036  MBYE44 AQMC%MBYE44 HQSD'ػMBYE44 IQFk$CvsyMBYE44.ASMg  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJoKLMNOPQRSTUVWXYZ[\]^_`abcdefR+:Ňx`g|v|gWȮnHa0DOt]Ye8p9]0/ҲjRUVqN]^:yл nq8h4=6wv70R4 l[xٶ-{p bV aCZY [ V wv7utW@x9-shTa t`Rm T֌ٶ-K;.8Xn`Ai=Jaa?8o8x}vs4!pnp8}c) r"zu嶽Ha~rHan\(=C{*Ƭ7Ú=o f<z#6Pk5C5{ Z3:xOBl,٪@GXNi2hu0 ֹ)v۵ƭcok8D|l4f/,^BDpzgƠo#( ^ Ka0mǷ?$Smy&p.H, `l%ʦ Vam.#) :3M\^/kXS( t~u+>`֋v9 W«5{\jm#UW^bKn[}0/J:Ǜַ{wnFk~:pR—?Z`s^H#84v6BXXx~H C`@AGA7`! "З? MR)_NR) %Ԛ*488VK vƪ`m{Fg!P%~c) Ԛ1%U- z2.ΊlIQՔ~ҮR)O[e{"<,>GgqO-=AI6KA)Ӗva$;ؙHÂO[zDyX$ R)jnRJ?mi}z*D/Ί苉O[{)bO[{)F )B-b'bʪO[vRi)RTcZSiKߥ<ӖwRMV~Ri ;J?mF #^6h[+giHAikj8XnVhlV*) Z{-.< l4@vH nqEUрX8%o^p}^Ьݰ^BzðрYo Zva)\U%<*x|%㗓F CQTu]$U0-0RrHa>|8r޶×'bNO[NC"kv+Eu[hi,З?B1 0R$=-´tO[\ YU_6xTm44LQ7 mޤF uE6ӸzBiZa_=iBOhi:\Wc5IN :l aU&-CaMG4M5bk4SR+) ]^6Ո2F]5H?m˟jGty:l SRi!W8ÔJa m٧Ae]؆iնÔT!7SR+u$6L3) e1ER4t)cUUj!DROF\Y]Ia $=U:')SRiQiK=AZgKLI~*\aJ0_;%/6gf^./0R߀wIn[I}t">ŔT!6l' yJ> S4OxgYaHeS~z o?_Z #PprSVߢ("|a3l[Afz*[`QVi1WR) :E;Y`C/1]ul9Xρmj; D,:׸ ֌˥c@q5VV1 h,A^/T1 x`Bcx@Anڼ룷) n\|f]?f8W8z=c` hmAۢv@9]VBE1B{ PkƔT!.<\yRDƠ;{kC}P `ռFAˠe) x Z3~ٮ{,(pk :B9u0phyV6p|% iI!¤CT=]itiqՠ4]6LS) Mi\='!.L]itiBeITu>0W]7IU0'iv$ 8F|LktEإ}ui&2mU$D$qB:&u^MZ.QEyw~PL)F'=z/$]]56lp S7=FVk AfX[) v1j^xڅ oDu h]^"XbN e]]Ja uR)CbAػ@GKL)[+5conW07vр gfl4hnFo[{R{Kap^ۼk=HU+0*cf) ²#,w;-b nBXVYZBi\!%z}cX) jnBX>vPi`^`mzoxۭ=.ZKa4 g #lGF:4R-Ϙ xP#b8ܮy۠ma#w6BzDG̶m,5'6p-6:bq@DtZ}˞^nmP) n,Uр|`=#W0R&CY/o !cdۍPZ$^WV0ϡ=Fܭ F]5pUaxۭ {8x}U,A^؆VgwYoܞKa0UB/֌ n-VCY/o (m[^xs%A: [xpPW]R~: Wxo!X=fa`ųѽ_F+5^|`.xCxyI}S-.Kq *7WR)²ҒO[+"kv7֫xaxQiKuEdpzoxI ϻTWD, ;zIž("2f`<# m76B$bv~u\C6D/ fcj?Ha00R$CSiK;2H@śmHINGeR'G\^{)ʤN~R]5"2bB)i )4$kv+E4ذs66h~zK8a#tMY/puAoZCE\Bvk^.A4) jX-ǵ]*PkF DS fuZ=W٧B e2j(zC\xX-c=63hƪ@G R؋QN)֞[+Y腃;;w% Na;%:p8x}v۠mo .`#w=n1aԚ03;|=wԚ A{t]9^ bUpA{0Pkvx㰶hnW@ jͰX[XPix)AY/o 1j͎o miKH5{󁡗 ?ݲ`-5Z3ƲLVmqxjBpAtp% F]5P p l4X?`NBom(tnMA CU f٧mҬ`(NlYA/+Y^O6p@]Ia(dDi4DY/`=c=C^m3.Z}<͆@k8V*J #A]55cBV/ rxcFC +Ԛ0d=[l I6yv(,-U&Kׯ߮f͑xԚ*Б[u7-j;F۠mql3Zb=zۯ.^Bi,h@w`~mWWW0R߿0R*sPN)<.悽FrzHO[LdPN)ػ@GRSR7~g"rND} t$CY͞O[Ad:FGj-C_SiK? ػ@GY4(?Ad:™Ha~rHa VHQW~ҎȠ@:-shR\!TW _-l۞W®0RT}ONW'J?m: ~EAtD9M! »2NI^rD-\[/(()}XZm'EusʛO[+2f_DQQݜ&EWi NFn#TWdpn :Xo+˧0R_NR) BVQ{FUK5[} unmϨ,}xwö-gc۶PuZ3ⰹ[˺;h0[0mжKapj^aު@GWbU8X5fas߂04;DZ!%{mPk>ﲸ:AT+)ygTWdpnU㶾[˺;;ⰹoJcHQWY@-]!\[ac_㶾[˺;;ⰹðlΘm:).Ӗ ٭pj^#;(xge]͝F #AF;)c~ӖӐ ٭0y~R{60Xbqv~u55ϯXj7=悽EUIRiKiHV6`qUT%AXtz*БYZ$eSiKiHVx6śmX8>JUOuԔ~== r lxq@zR{Z%x/Ez'qJ-\[a^ UQX-cqZ>`/>ﲸ:QiKuEVyy# qAKI31TWdpnYGN n[Q۶g:;wv{)SUO[NC2f†G/gַhѶ7lQD-]!\[Hᷓř~ÆGbiӖ ٭pA`#k`pgx[7Z9)ƧSF-]!\[`~@<cIѥit~u52h?pglRtMA-\[!Xk ] "zWpbw(oO[cGllhK#t`)pRe~u~g2 K >xcf^ ^ՈwK6(dPf±lalڋ4n{)1O[NC2fcw`f#PcfhlU#)2CJ?mݻ*:rw0xRa^PAG|uu^48ӖӐ ٭4G,Ҹˠe)8 ?RiK%d{R{cJ?m /}[s);Bi-[/KS~R]5%^a=[(ex)D-\[!XذsȸX,4断,l)]v{2( >̛=.ca%^ʢ&(`)ʢ̦O[Ƞ\*0o\,Kp_Ab`( /X1oyQiK{2xfc v<6X-~̛=.շR|MJ?miݞ ->p0}pP;)}|Ӗvpkn[8eW)}| )dP/6졗a~8+[s);#vR0yI)?>Apkn[8eWpY "2x*;ap6C#}xZ'J?miݞ ^ ;gr^ # <A:Bep\x!Y:HoT=O[+2H8Zs:̪|](7 [m^&)jPiKiHV ^(,kg̶m;+tM:M4{/EvӖӐ ٭5l4@Fl]yKTeR~W2(hAi؅hQ/K4IVMEA-\[Ay{|thlU#^bӖӐ ٭=`V0^:).O[+2fuh-{1뷍}e,cKDZI :QiKiHV"R K,{'55TWdpnAcfl5TaS\hY>5~u5Ckϸ #cm{ ;g IAD@g͞9:h6PAtR{Y:I$ӖӐ ٭4p^ampk=.Ƭ#[^.0R)̇/mYGN w9-hVg_FiSiKuE9^ 2Ԛqfn|%E?ה~e~nO 2Ԛqfn1mtdZ#X菱O[.?|#4~hm PF+b "J^O[.?|#4>~ NGDG 6:M)?ה~ݞ >JCe:re\pBGr)E4kJ?m鲾y'|X8` lxw|~/E>ה~eunO bJvK7joz(czM-]>]~ۓG>Ciż#ٶ-oNYpf9ݲE}L)˗w{2g(efݭ Tm[lQ{~/E\|L)ݞ >J o`=)̶m#pPkǵ۸^SiKw{2g(lۖ=QlTasKa0R_)F3>p4p*БÇ/S*m۞ꣃ^.Ho("d #қ&3d߶XU RuT!td,q+ t%nFSR6)4$|=6w v*>RqH--ԋ{%z;pK>R0+O[+2HN {YMb,G!ppH(dD l7.JP"Q1%¬,bNC)"Ӗ>g{2lU#% {YMb,GIT!9ݓAgA/qG_k4U[KuTM td3TaT HQ6Y~R]ACkf 6 ۶=Z{"^SiKiHI4֌Nc}v(8 |b|L)4$$Pk6jMx 6W>Ka0R_r)4sp13A:rxwWTuN #< 9RX8:Bgb֑-Kapgxٶutx~Ha,{=h13>@jAN CĬ#[=stkut,JaPt f{-C/1gyٹ :Fm۞b "ƻj:h^Jar*ѕF CqRgP7Ad[ᠽrpZ "^IaYA}P0R$K[j#N g@ ,h^(5=R8G3;,Y/<M6XaqZ3g0 U< ,6t"b֌ @/ց룷+ dKўD0Xj*,q M5fḂc4ҸNCKCm0pA{֌[V6E4@G+D E #t~J?m: v10;\ amDGxPARUQf~d0]e.0۶beF-UQf?Lש:8)xCq4A;̶m0RLjPiKiHG%eGJ?m2$,pXj:%UQX-_]IQƧmQiK`SR_Ue2cmR-{)ӖӐ ٭pAtD1~+qu/EtqA-]~y'oZ/ǿ_ROyPiK;2xqYGR{=2NIdGJ?m2$,pXj&i"ن =z&i2hJ1۶?%ERo8ӖA*-=ѢmqTWdpn[7ZAb z fLIJ$'Aĸ8+^"I/XWF^&SiK{2xDb%UPKhKQ_(;29_xr￯XW泌.O~u5yA4Uڣ7x=j޼5~R]5E:|)nye* w{)b(4$kv+KEuR+4՘VgP7Ad[ᠽr`oCip4@/C{DZ]YU_66R4´vDOE>O۴. xZs #j#N j') ^۠m2Ԛp13t ]6[)( ER5p }P,q DZ3b֑ e 3# %0 w;\p% gP7Ad[h<@{op]30dil/Z=cX : "^2 6Ge5㷺oR[X8nZ3),{ ; qP \v͑?vm[YoAt%2)"S(oq`^F8h1 GJ?m: \[Jn5 b=s$ESYSiKuE Mnq8h4NqRR4՘V1tdаm!0ES!3T=Nh)"&l PRǟv;)* ϔ~R]Aę .Z"Xn :N-k} 1 b=CGhq]mvY8RiKuEgv+lôCk@mt$ LlGa)64D`vexCޥ9i}R)̇/E #A j͎F lvk\o;c p^,^-UagmPm56h[8pzXDg) f=0l4 Xp&)N.XQ{[+X : R A7 6a T`[:xVWD6h[iUsZgƴ޿<Ƞ KQ }`ۿ_S[5 uDd0]q$TW 4Ƞ˦?S[5KAMBUM5~xWMi}:{/!'"j0]q$Ha[:R6Ԛ1SAdU#au8R)(I([i}x$5酟D$4ƴ>L驚 dgŘ"R0R) u85o]#,ǟv9hv0RKW')*>Q7X .ΊzrqgRPY=P NpqVY/"%U]NAD[VϯPFnB1˛ WjЇY7.IAYqCAWpό"^ ʊ0SAdU#t)RPVDdY1f{)i#A#D EW(o#dE ܚ)i%=U$NR)͚moa=ԚA{|nw%I )'"2c83Fv* thKAD4ۯvӟdЬ1g5c;,G; ^ BZgIOD/I\0Rl,o;BS]5xI$ ~faC)}|)!'"jI #yS1`=Ͷ R{ŅvV,(#2@nKJ qFU߇iCd7Z3^@/ӖӐ ٭7|oO_w;&ExQiKiHV7|I("kv+ _Ia0R$Kl;iB9] Pka٪@Ge~ul4HaP704f)[5cc`F=/A{Xl,RݽW@%zAG x)n^`֌=2^0 t4f)[hfGo7n1a 6pSVYZvz}c) i 4+5c_:l >xch±Ha, ӗb8 tbAo]Y/DR{M=Ha`e~ +)0})ƎO[NC2fBK1vP61l4`({Ӗ>>8) >xcᠽVOwWWW(mQiK;25;c0R) F{dFg9,8ӯwR)>&Ɣ~nuړA#[-ًlQ24ӖvŞ &bt)x,tݤP~(K(] ^CgA/Q7Y<%aR_{)iSiKݞ b=[z5sekx,Qc{(R6L;J?mis'b٪@GK6pqVw0})/F I #4>>(<>pa>.xDR{ᘦuӖn w~=|Å] RL pa7;J?m3v1H1 w;\xyӖ ϻ.NiݎO[2'4'2?v;\d.N #4Uǔ~4i^xٶ.xo]0Y #tSODdfұc{)(IhJ묚 PkGCaC/֌?n0끥,(#2 [p4vrѶ"M$ԚasK5z:*">QD;)(_RP(U&D{"}c2A5 :BVϯ?炦DVe6Ha0سgk[bj0끝F *VI6_I6_ j͈ KpCA^,7 eD!+,PkgЇYE8 R0R4nn(ʈ NgXz-KAE9RId8upqV .ΊB>O)Aё֌h|.Ί%")(o(#2 vxPet)RPVt4gPRsB;"Z|@k0R) ۶Pkbìv^jPFnnz# :Bi,3BvmԚxрbJ # MCR=XAbsz nyÑr"5Cً&lasOdf8+}Pet)R)jn(ʈ NgXz-KAE9RId8u$ Ye ;,](*oȶ7\Ja0HyvԚN_DQpA:uA{1z0P7Ad[j8,Ѭ]Ia $=5iddDsj8z`)EPiK=9%Ԛ1U JӖvdP閡ozĬ#u@uzY4idR)̇/')͚=zl;ܮ3nBkԚD l@;bs@ًf8hy[tC ׫.pq2Ro.VmBiAfLI^:pm"pPkpj^󀋳uzE͚~Z3f۶i*8Pq |<E^ b|0RM5w$ɋdSv~R{Q*^ b):')(MYz$2H(~EAt\aʪ#~ǔY BZgIODuWOR)IOu`NI oگlûjzNÔG)=U3hft)Pj͈ z faRPY=PJp;Q)% F3㠃HPkFNK5U&D\PYeI-Ha2#XBv<;[} fxY #e BV+:{( fZ30x)(_RPDfqACi5 '%ԚaKAe@iI z.Ha0jx킡Pgpq :Bzt4%D!+\D=Z3p^BvM$A,mPk^.+vR)掲'IAe@$28…u ; ,ȠXȈ J#[aTVTr"ag)(ohOdo6D=Z3p^BvTVJ"+5 '%Ԛqa򬠌ȠXȈ J#[aTVTr"ag)&2h+cPkF?)U#)F pcnqBCiD|֌YG#堗R)館(_̥z*'28Z3f9HA/֌2z|KAEKAe@*'28Z3f9HA/֌8=Ai_J+۶gD|*xc)K)F zҸ6Pj(Y0R) 5cV^AmTPkbìvX8DPkO?DNŬañHasGD?RP6.KAD쥠lt/eӽMM5KAD⏽M+ҽM˾l]^ &e^ &e^ &ڥ쥠l]l]^ &^ #ER}zG_lF8+>`;)I4ex&*Uܯ.%6KorUt_0R²UmPuU.U62v:ln'e]<^JAH,0R²U|l߿R BZgI/U:lnCX>v:u:Ta'e]n^ BZgI/Ha>|9Ia0D@OWq\=% E8MzH3) ON{ty>E\YIaN]^OI$Dz&ͤ0R_NR)TMw\#2胶g\1,1]q$Ŕ)l=ƳIa(;z.G*j J .VRs9qu"28i|)Bx㠗"ŞHa0x>-;,u[,^~` p(8,ZxV uVhqJ1܁X8C\Ha{) TJ #/'){06dPe(c8[Ơi#+l*?,6({ލpX ~c 61o="ZvtԞ1J1舡KaSRQ|Pz(82*o e/Z}Qa>L)(3ʤb""ݢU"dTqLYXaJ^ ; A}, MD}cضJ{'ySY=R)IOEUIR^gҴn:)(I([U'2(ZEUI qFU߇iCdh,AۢvSu.M릓HAMB٪xgT}6RPgIAqS_L NioۋTVTr"о1$U-8G"rSޕSU59)(I([= ~=; 0xvN 2"Ѫyf1zXlPe)|H(_튯{)(lrz(6DOZQTumz|UJAaCQնHZ[Ǯ D۠mq7U)MNEUW׽F BS9M$p܆=:CkX8X(8ô$%uLiΰ{X!fJc( nj`)MNxJc"n F*m{=r)ySS4&2h2 whNYpRP|ZxƼёݕF cPl>b)s9xY1ݼё(cyflvأGƠv۰>gN c\qqV/~7mtJ)cl+lh.{tM1m{qqV0i'b|K4iATvrr]G0ixY1HoΠ* U#c\Ka0$ Y3=:\poa=#6 "5#ç DZn 奂u]" ~f( \p2^_q jRxnlU#xPAWx=: pzX0z/ [D*06GYlpa=["Z8(o%>HQlvR) E cchY #EyuwMHaP/6졗BҸ/g`z0R4CQ6N #A\^"Z8,RlY-|$qxGD;)Á:3m _ÁlR{,Z}~0Rl"|lF 8Òyƺ :"Px_߱m1̃{/"4 (0Rz*i qЯ46z VXaqAtW@H5qUQ6Q]Ia0o54ZVjZ:K5cmVi[_yg) nEZbq֌Cр[ö-*{K.c~IS'2hmpqaq<).k"c*N"$ T`/x#U:lnCX>v:u:Ta'ySuDd15!"}{u%!HAHzچN *80m?vD!+pa%?vR:Kz)|Pub_u:lN *80mw;"w;\ŀ`N BZgI/URP1iu#2Yn ,uYKa $=e%۰ۡy]UmIACBTqLa# ,.7PjY oگ OdPW[xFUqpaU,ySXf5RP1eDO6Pp<_]]IAMBUX&ex"$ T`/ ^m)2+ǮYKa $=Mi\=IA>hʪף4n=&l5jz}QaXnKJ 2"^ 0xvzo1eU; }єUG"a1eU7RPR^ 2)\RPR^ **W7YtՓF BS]5Ӹz⛄Ք Be^bNbKA>Ψ0m,(#2ǗWWKxnlR:Kz"2uWOR)h,1lǽMtMq/e}KAD_M+RP6ѮvM+M+M+MRP6.vYvYv^ &ڥRP6.RP6.-RP6ѮKAD^ &^ &^ #ER %˺\A!8FBAWvXvf8 ncR8mH+-Z,Xpjgkj͎٪@GJ #>ﲪlHaWa kpax5{^iUe6ƾ2k?,Pk@Z녂Z3~;j=\7l9{dkWF-5h[X@HWaǧlHaP閡PxYiu0qAZ3~kl[:rߠPzA D|4g8,8(mqSVYZۍpx) 0xvvƪ`m{FZs Ӣ88VPix%$ T`/<⌰ɻfBav"83c_HQTiQD;"gܔU8x}v4A4jHa0(mt‍x#TNSTc* RP唅6&,a/!HAHz*)nr"dr+,XjVr)MN/KAH,ȠP #>Oqw$ɋdV϶Sv~Ha0xDc%:xV]sx{ :HAE4M'2(+-y@IAŘ%. %"VR s2_Z}˥T>$ d%MNO]WSU lcj礠"c*"D>`S z~ʳ!2Wp-[ǸM oگ)ÓTqLEU]CdWX" uDdPNS(",iIO4 )NTu( O怒8i{"'ցtӟR:Kz)rBurT l/=PNiAd0]T |/=PNiAd=>8@GR:Kz"2()D^g(:Ia $="3S_'){"}Y!ީ`a_\YwU60Xշ< u?\EYF)>RU+ez7.X cDG(lM9o#Ytto ϶ cn*}Ak/Z^ 6 aQûOWH@`lڋWRqU|D0۶mo|-|ց D‘`Fo»`gv{hg()mB͞7)=R M9oocdzZa^^bD :›m[}J  Wl5cfxX4;T졂 cq_Ia,5qU ppV ܲԞ\Ⱥj, IVIa,Qޔ1+5c#pmoyD n"RK`{)MI5w\5Ŵ abLErF fXշAtո8+vp<@iᠽBlGG4oR>z:װmo,)@ic;xvJ` EkC^-{XAz} #[6o ڳy[`=[,CZR)2(h{"d]WQ{o m-RЗ?}X*U!p"[XE><~± 8cr0RrHa_IfHaw >tbSR)?~9Ia0HPkl#phSXV6PAt*f8^3Zg^Ia`k?,WR)&7 *l#tX);⠃HHAHzӸz}єUG"+\1 :gGj;HA ŧʤ"c/C"Xe_')|H(_튯{)(lr}^ z.Gz:YA9M!:C9exH*#$="3S\"c,NDiCznr)(lr}^ z.Gz:YKa $=JuZQ1UVT%A퀫* ZHuzGETfE B-Ԛ=)=/TTe j"UQX-c=GmQ oگ/4ܶpg][u8HAE5RPPj"poj砗{)(lrΒ^ #!驜y$YN/KAUS. UW'"d[F%oVpX-;DV BZgI/TNS(t9DvzzGz&ݗ?0RUm;*8n'2YJ >B/R:Kz)>mǻ"c*"DytNm f?~:S"d Wpř0R;))'2(Z$U-MN$U-bקx$ɋdV϶Sv~(BKA>hJO BFp^/k }8xUuՍMqGH,`NwF rʉ wRPWa'"poi=ZͯG28¬#[^Bg㌊!-"о1),-0R) BV(:)>Bi\^%%zcIFnm4}eFz)Al3nl#OȠ @]:l4@9gJ #tN!i4ř.JAe@*⛄bmN *8)8m{)i%=Ja $="3I⛄"$K2Zb^xϑ±ߥ"cx"e(Bo uR)IO/eQf$_EMd,R=6V̀r~e()(EMtKAaSYٔ,!HAHzz iKAMBUD/}[s);0l=% Mp6 aJAEuΒ^ #!)F)(IhzD/}bl+-[@IACBORP1|}!!HAHzz)$7 W/_ %^ ;gr~e+)|HhZ=~< )(IhzZ_Baѥ~ccme` f怒!i)^N۾YKa $=y=5D1Ҟ(){"iψKB]R)$2R z~’ 6r֌ZG,cB_/ . EuI_(l'2fܲ&j,[{\a֑YKa $=n6?vRP1&t~CQuZ4?/ Xn .N BZgI/U:n6?vRP1&txIdux~JA uI}zj %"Ԛ V"ŞA BZgI/ ϻ;*82K!2(B{< {d)i%F0m²U|Pu؆N *80mvDiN BZgI/.,,-۰۽G^glnR)|H(_MN pLL BZgI/.,w;:lnyQ]5vRs9>O1'dH+ضշAtv1Β^ #!),,-QuUmr,N BZgI/"Lwm"c n'!HAHzچݎ:C8fuJACBj?vRPTcfR:Kz)rBupPWY8,,a/MNY8n))&,a/!HAHzچN z.G " uR)´y#$=n6?vRP1ixL8).>>d"o`=f۶JAUS.=/47X\[ JR:Kz)F b+[-V|{>@Gfh@D,,jl&2(!3UwaYeiCX>v:lnC^Cav怒"c* :8Ftߺ&R{؅Ұe/!HAHzzž RP|~ydr4 o~Ǭ7 PZ *8ʱk BV7"؅lncYKa $=e%axۡ ϻTqLeԣTqLe#AѲo^8 :+)i%F *8"¢ Z3Z=nn̑Fɻnr"eQMRX(MN$U-HaD l1E;,=4. rm[ :^Ja0ڳûekfpZƭ TmR)IOY>5RP1.|"2h>^.1/^ #E\U7 Mrz)Xj"DG5*ظ$ޕ۽H^D=ڃuDG5*ظ$_驹'IAH,0RޅnGUm#3 lnR)|H(_Mn'MNe8i&!HAHzچݎ:C]5>vRs9>O1'dH+ضշAtn VXA BZgI/U:n6?vRewwT>$4KAEY<><@{8u4`= b( J,yS%HdPl=nȘYwRP1YRRs9R^OiGdpXj@]]]IAH,0RuwwaYeiIU|Pu؆=:6$7 WUmÎ :pYxsPD> @Q *82K+Ya]ѽ<)K wp=Q1Y'"¶-|?k_BKA/%!2c0R) 5ccϸ` : x#ϰрVWأ "(}egJ ! p [{ƅ^D3Ka"c8&2xB/"c*.ODxD :_KSCdP6 o [{ƅ^D3Ka0R4ka#F02>At\!Z36(yS\cR R;/{(!Ha0omDG|mW>_h,G @-ةE8J-C{Mn断Haja[ 3HvA;u0hv` hPkbɷl:nAfx>.ZfEAt@/֌YGNwEUM޼5c]%u@{Yw8hܕF.OO!)K§F ʊ 2=o8R )(_MDBaB!_(jB "ά~w1:ZwA z~óR:Kz)Tu9R uy$2WzYaf񬴇]*(+)cW⛄2<>B ػ@G RP1E$&Ƞc #,6|RPTd݃Β^ #!i/IACBoã69M%R:Kz)tc<8X69}fT>$z!-6 66:#ZCa`ﵗ&zǡF BSc\HACB~'2赟e:XD l۞iΒ^ # 嫪&2YIAaS}|"2(ORMS.MN)F BS]5.ORP1Y^OD!+,Xj:Kz)D!,w;Tawy<¦ 5ϯXj T`[\>O1'ZcWXjd@]]]IAHOi\TeJdWhY]:8{^g)i%F BS]5xU:n6?v)"c nGd;0@mϰ _w;),G"eqz;+N *82KQ *8 #2(mǜ .,t03f۶R:Kz)F ZBSBa=.b}҅ W,w% *KKTn6?v#3 vRP1iu#2YX\P^R:Kz)wu]XVYZ(,w;Tawy{yQ8fuR^gvRPPƯA e8i7.X pLL BZgI/ *KKTn6?v#3 vRP15a3ی dFu_)L ٭?%ln_]]IAŘezIdyWEUbV϶m?Jo$2YaqR{z-G uR). ~~R{xv _(ly$28i BR)IO۰T ]\/5f{S z_()ƒ Y"j((< m\<;V\4vuַYKaU #`Ϟ;;}(oF BS1bJo&jJ2>X(j2+eyx/!HAHz*)D^gy!I!|u_~ۓAnyw`p-.ſIAaSiÝ>PAtDg۶+)i%F BSQ}RP1w=Ab\Ue2Z=۶=KAH,0R7!),,-QuUmPub_u:lN oگS hoyߤ"c ˬF BZgI/žPu؆TqLaUm#3w;)´WpqpRsByKAH,0RUm#3c6]7):Cxyʇ4 dfᘦ:{)(lr*1M3)i%F Bӻj ϻ{un'yS6S͈ 5ϯ*_)L uR)żKx0RuxGHzzWW ޅnm޿G^gw;)´y j}y+w;\\P^_ uR)IO|Pu ϻ MM>vRPPݎ BVPkFi᠃H&24YKa $=~C6?v#3TqLML6#2(<.xX z~4.2YKa!驮 *KKT~CavwRs9R^Oi$KDZhJ BZgI/2^ #v̛pO{)(Ih~̛=l{ZわAV!K1oRs9R1^ #E8m$_7{2Npj >QDGX:f/fG6S&7 e1oy֑AK1v+xvp^Ai VIaxz|UJAaP&% L r)^"nz|UJAaP&% L z.GzH2qwsGc5R&H{)K)i%F"¢⛄"2$2ɺRPT7Y<р2ɺA BZgI/TNS5TqLz̛b/!HAHz lnR)|H(_Mc\yL!+ٶ.xX pLӌȠMYei ~ճm۳Β^ # K\-[/MNi4!t t^Bi,[m)\w(XϘ Cp HAHzچ]\1NwTVJ"+gRPRw$yÑYKa $=m.N YZ$eKAYAs- uR)IO۰TVTr"{\KA]]AD1[+ :b\!RPRО mcޟ4q 8+UIdpbup\C=.Ί('2ȣ@IAH,0RaW'u,-2,ω 9vSR:Kz)mI **W9ALJΌup\C=.Ί.m uR)IO۰jѸ '2㠃HHa0R:wym{S #嫔 )2o jZIAH,0R՘!ivqu"2("R KmÎ NZfKAE4Uc\ ۶z40@G,!HAHz*OT *W=Au fSPk֌* Z&~=<m w3*K1.Z%YN$UMd0.A;vWRP1&t_a5b.2hguB~Odpb8Y1C/aS)v^ BZgI/ˑʩ"'7Z!ҷXj"7 ±F BS]5xU:n6?v0R) moAix,n(C >r alQ ` fkó8舡Pkv WR)mvWqLe#AѲG/쑥"c* uR)IODQX>v:ln=:0Oq*t9D:jϰpAtlv1[RP6Ddk_舥(oq )i%F BS]5xU:n6?v怒"c*z6D'VY 6zT AEIA݋T =AEKA݋T ]>DE(.mȠcn{,[{tp uR)ʬIOaYeiCX>v:lnC^CavRP1YwG"b+f};%u/Dd,q^Ԛ))i%F *82K!2-{dMqqʇȠXz*ذHOxGEǔq~Md?qpv:lnC^Cav怒r2+y}"2UжPkʟa6 uR)IOaYeiCX>v:lnC^CavRP1Y^OD #k:)ʬȻ#A>`{A$u/Dd_DG,O)2k"'(X8&*,{إbzm\T#'}RP|~}dꅟY oV}1dTYH *V_ bj-ySY=D~c5#⛄՟v{"2AiiʇUde.yӔUT>$8 ?~/ g4.22hC^!bq~0%nr"69 { ϳ悽$_=v{"+Qb\Ab/HaМ fr; c,)<˦&%28YT ={"JA/4a 5TVTr"‥PKAETVf6DPkƼΊTqLe AK1bu> U]NBOi\D^ y"c*z6DV8¼ΊT =f\SKAy~Od, X0R<5cBϻ=A ( SAt)=ИaR7RP1&tY\3l4IA/4aԍT ]~y'2(o?|\#+l4IA/4aԍT ]~_h0) /?| &Bi 3 :_y$2f­  ZH5{kKAŘex)=S(=#=qs=zV ZU/!\}F #Ԛqj?Ha0LIOS)ʇW"P>`pj?Ha2ZsЬ*3f۶<N.{2 eԚqX눯0R]ySyW|$2({5{)=/T] 4<zqi"2c*!iU`f?+>\aVk<+)h܆{ Fώi2faʇUWa;2Ya=. K8u48)EyS5 xठ"c*"DŚW,lKAe@j"28¬…_DRX4D%A&\T];A7AVP"8\]Iahr;QPj"69uM'")at0 7 WMRnǒ n[\kGĔT!a9@ًb""R1qRP|~UOHAiD|XlPe)!%2(#PRs9Ҙ7MHa0Rt)B<#hJCDśm0Rl1o]15SgYGdG1~+1%UXlPe)؟Ƞo RP|~PTq65dpbgx-KAETV)A -hv~H1Mz4wHz0& !X0۶EgIA>i*8H;=Cf۶R:Kz)ԥ_0R) ΋*>E+LZ #E3yuw> SR8 R쥠=A4fZIAYqC{)(+nh/]R7iy]]58K#3*KKACBODY7YKa $=]R7iGd0Z5Na`RPдzNdR`ռFuww8e<;=cBm[rJA yW|'28iz_a֑ CGRPVtz)`m$MADI:ZZ38T/ :V f%Tzqi"2=;o˩ꁦUNdpbY/"o]0ӥ\T]<|d>`^DG)F ZBS|K x,QJ_xctPAVacIa`=# cfxHQ]R=K1vd,R=GRg9=4&2xڧib8V+)rʉ cޟlQ "2ȣGxgV¶-~[8{/!HA6Ӟ o},4iIAqS Cq4`ڣTu9D!+,[{BMQDFƶȾm)`H+8VR:Kz)mcGy!i:ʇUX7۰(MNe~ N *WadÇG)(lr*K uR)IOM֙g9v{"+ 9RȶRP1&n_62.R 7EU?$K任:^xڳg9e>X!bcRP|~> Yol+H%Ajg5 KA/T]35a9@ix #;夠i}tX*xcd[(G)!2x~ F;*W;)(lrJ8?tBi[Ra (茍,")YKa $=m;)(r*o K7(T ʊr"69M%DZ,tJAH,0RG^g؆K1vRPTlÎ  K7(T Jr"i9 PKAaSlôYKa $=0})=:C8i}k_1±KAyЮN BZgI/q>PWY@Um1[0ʇg"R1lYKa.m0W_*Ha>|Ka $=M.HaPNÔU!H D,KxiGd-.ˠmy@Ai"ѥy)B)uڅ7wTV ")B ]t0[e,21DC ll4_ mIAŘP\eFd8 -;Z}NaN1FO)蹠.)#29 j⸖1}RٯG"!PX5{֌up\S7O).Kxʈ puuZ{80R) u#^B/xc+=#u6 BVߎ?bc줠rlmCdvdlX/$NV1$_7Y@d0 RPm-{%roS z.ȻW"kv+aJAqn'28ZVgRP^'w{" ",{g We?\ɠ~f(0JAan'2>.Ίr)ϲ-Ahϸl4Bk%!HQ]!{uwu`/ؽG^g(a'YN >.ΊNhDӭUc "R1Foq('u]!u]!u]!7 W6 FD Jcc bs^ *ʑJ"=\PwDVtt0mtd)+>~,nyOdpbVgŰGDRP^'D|RP%n_6dk?3Zo ֳ&nyOd= V1Z} "\KACBj_6 xvpRPP fvdX)㘦 ۶PSVR:Kz)wu`/ؽG^gxW?fGTmؽbʳl{GMBUmDIf`o vY *8Ǯ!2hm6][=8A z.G*j Bk%!HQ]!k uFMRQ A}|cS r)~"߉ 7 h> Xi)i%F S'"u¼opAtĠo#8+)rʥ*Hd,i¼j8nr)(lr OY +,[{Ӹe :Th>HAMBUxDOGՕTqLEU]#=#yW|NdGԚ#:RA+)cIO]S 3j2ݎRPTޔ1A:^a^lm-БTu9R yW|Nd,D ^¼U oگ!ul`u AۑnjekDO] z.G}Yam#,[{$—?r d aK,[{$—ˑrJ d nܶXHO')+ 2(lۢ)ij#4UGor'2X-|bd; #|?r,o"շ#+l`@N_ORs9RWMRcA&—ӽ\ԕM>*ĆGҘm۲>W)K"2:ZcgYR{CF>KAu5p12x[\xPARP]Rs9RWHdvd xZsc?@GD+t,.ac/6j8 H4='} q16f)Do^8)˟ ٶ-K&ذ0R) #pF3CSR)ن嫔 )<Ͷ 1ϏDmb=hSV?4Ƞ+ZSVRPP!2xKp+8{-_zƚ=KA]Ha芪;**V).Ί4G\PTum0RtM=Q|~UdAۑ6GYl0r0mNi(+oawGMBUy ;"շ#+l``zRs9R6yHѕ6(IhqY!Zˑ´9ͣFlmsGMBUS=1AۑTaPx킥r0mNi(+qqGMB6.'"շ#+,Z}~lQ z.G 6R)2;oگ>M BVߎXٶ-Xz#[^()>->ʤNDŚW,lأNIAqSRMMJdpbT 4c+* ;pkEX BZgI/MSX|DաP & "+@1òG)rʥ~!"i+@aŠ#YKa8˩>>z o)U]NԽA`H_]Ia"c*Hd2#Xb >xo U ꂈ ~Ha0({v hƆGhl[:reuPkgtt%A7Yok 8Xn0RLy6axg9UȠXzG²G)rʥ#25n.<*wܾʇ#Aַ{)|iy+69UI o UG2H#7$_q }v vY *8Ǯ!29ցC#KaȺj,.I(Wa0Rқ>Sub,怒!tlÎ ԼUQX-czRPP fvRP1MYJAH,0Rқ>S)*KobL/ v jmA˸m۞j; =/{DMI[.ZmVp~!PR:Kz)\vHa08+ DX84<j͸v2hY #!)$NI館(_ `PS r"d W4<nx.Ha07lX8R)(I([$ .3)㘦 )'2^JACB18 z)_ȠcҪGą&OF;*W%vV쥠=HAiDCX F BZgI/HaFSV-2X*=#isJ{)]Ϻ;oگyU5YamG))LSKaʧ&k շ#+tkG))LSKaʪ(IhYa|%=JAHaڜ^ #EWNiQ|~14&շ#+:rܶX(=#isJ{)]5!k uFMRQ *8اG"¶󢵊T!6=Β^ #!k uFAv|/ySWG"Sm;/Z*ذΒ^ #YNMt> 6  l4HAMBUӶ'G9%bd/ui#+ob&jveA> ^"/6PlmaJAIQNd,+xV a^xϑ±`_(<#A1hJ **WAĻ+8=]Ac}ԥF #EWQ|~UlmؑAj#au`bd/ui#HѕMsGMBUySD!oGVf 6 ۶or0mNi(+&)˟ 2]*,GAFS))."Z} "`Xg)z|Ia MNvRP6R);BS댚L#TQ{ƠցC-cՕVkcti#ySS#A7b`R:Kz):ޅ7m=Ahk)㘦}y"2(Z=.x=cܡg)i%F Bt~ ]SHAMBUeXLZ,BNk,8ll:)(uM1m_Ce-;opD֟fKAEǔUۆȠ{EHAMBUex"j-Z||c\0GБTqLEU]#!HAHz]xCyk /KAMBUY;*X #E6ysGHzӸz$ 5ϯpgx5s˃g9=4.\ z~>Ǯ!2^Ql6(ySQc>QlTal9{d)(Ih*2<}%ZHan #._YIAETT5Rs9RqDkp@K oWVR:Kz):ޅ7Ok(Ih*2<}%QhypJ *8Ǯ!29()1>X'2)k)i%F F sR)aڜ,jf6PkR> X"wRkY-|@1/HͶ H)m Y"ǭu},[{mж-.B)m 6RPGVsfKAYQ.Ƞ+8VsfKA]Ha0Ryz|Ut>m֘sf#KA]HaU # LS%w_o]0nN CK?Zs~ev ߿Ka`I9gnƼ#7.X #E6Kr"d^lA"ҷ`8VR y$2xbHAiYa^xϑ›m,eEG9AD.^_a Ois$ ߉ 1aqF6OwTVTr)K)Β {HaU #|rHaP7ƻ}J]_"Ka(UIdpbb)(lʈ ƅUka)(o(#2:{'% h"2xH^DJ z_R"d ()K"2HZZH #WaIQ?MEwETM$LP *ʑJ).&Hl7 W;"eTEi2]*ZpgTEHAH,0RLmCyk i Qu),>,B r)~:˛ Yk⪀c KlX/Β^ #!Iʴ6RP|~4U"c*z)iקHdm3Tz0RYw4V# :vJ{>YKa)'2`xV IA]Ha(&o;$=uM!yS%Hd,¼z;+]SHAaS?L׍T>$Z OR:Kz)T>$[*ذ^()(lrjnɩ(!HAHzj2 ujk )|H(_5eRRPTy,!HAe@ 28¼Ί M'28X3.%tRP1&nOdPy~R{: *m3Vh-u,cB 5ϯXj %=PYm^ RP|~ \\(ogԚ=wkhn'*i/Ƞ~fm pm yKAH,0RնIO)oR){"'ھ1,>[R{AX2N z_Ƞ^! q/YNqYHdpnnj`[l#8J r"=:)|H(_ FZ"Z\PYm+A KwAahѶ怒!|DVԥ~p PkFD% YKa"c*jیDB JcHa8;*WT \Pi}/pOc$YNxJc)rʥ zJc)hF')K)F04i 0RIwzcHAŘЎȠX`hѶRPBDN^Z{ўA͞9YKaqi 0Ri 5՘#qRKAŘPKA U8) mKAUS.=PJ m ;)ĥBǢ+)h܆{KAEǴ ,i/!HAHz*)D^gh1 G)>U-!HQ},"c*6D!G㢵SRR)cQw4V#vVa60R)LK-IabL( `XjhѶ/DdP<0R)LрhѶnx0RPTo8$28¬. ? j-pOɩ 0Ra7w&)jHA7]N9Af}Ak/Z -[lX/695UQ7RPTEzYKa $=5IVۆ:C]55T>$2C)(lrjΨki2(hAGpgx 7.X *86D+(<,D oگʤ.4ܶPk`o9"c*z)i%F BS댚L#:C}#YNMGYl b۶ٳTu9DO)(Ih*2<ݓA+,6`R 5Dd0 R$_I]7>A%6APRa͞pgM'7 W]SLHAvR *WT>$_"cʪmCdP荽"I&H -Ԛ7X[::B}cTR)n"c*z)i%F BSRX'2)X *W;""Na')(lr >>IAHu7=A pHcJAH,0RUtqsWu U5Aַl3"}+ui#W)F S7BafhyCgb֑-cx0RI=n;*82lȠX+Z=6iAtX(8eIA/T&m >20 :"PXD*h|:NoX(5T>$vRP}|,2l򦗂.\ anE BZgI/TW ,2l'2qfԥURPKA/T&x?IAETfI=JAH,0RI=wT *z6D1ҞTV4r"о1fT>$TvD;Ѣm0R8jیۆȠ9Ѣmh"2(RsB6G"kv+ZiʇUt\}F #LZ5ϯ t&J .VVWR$Kz* op&PuZg6 lxb u񬮤0RSU5w$ɋdбc qp WWWR)IOuWORP1MYO?k_\*YKa8i{"XWXr OyWNU pG_k)rBurT |Od,aZj;``7ࠤDIAQMWRPWA]0aARP#2I+1UU, )N3)_D2OyWbG)|H(_}%2+tijUtU)|H(_MDi(!4 <6YKa.m0R)ʤ;BS]5B *WU-[gߖQ ORPuCdpbgx`YKaU # oPX.Y:Ha,q˰g;[=V; KyK(أ "hV?JC/a0Rն]6}|"2vzz)U]N\Pio:j}@a1[hSRPTfe Pz o~JAUS.=PiR)IOMRն5tKAaSSu#MNMUͯG)i%F *82lȠTжOh"U#TqLeVm_͸m bg;0RLm#t9DR #f=09F2Jγ*Z3BU,A x׬{l=3,f9e#Ӱm ;g찶o,sCkg`ԚZ3^Fa6(up\cW0RU=vpOAhS!1館XD'VY<͸m :,%% FD J# z;+RPY=P* v KĆG.\ z_1i"2)S!uiCD0W_*HWY\IOEUIR^g(:!3tiZ7g9U'"b+Tu9RPWAj; X¶pFT>$Z A:c@IAH,0R8PNqu⛄2>$=#YQKAH,0W_*Ha "h֌/UQX-Ka/;BS9M!:C9ex⛄/bˑ( uR/Ha0`<Ez48x}v#"掐IJAMBUzΒ^ #!)8E^gҴn:))'2(Z^ AQ}|!b\Ue2"j; !HAHzJo$Nr8+{)i%_0R) :PAPԚqUT%AR)*+TTe)u.MC^gW')(r*ODŚWU')rʥ~!"58v@m=Vہ)|H(_U5A:&*Dd,|@AGR:Kz)*$N&ʾ d*a)$!HAHz*:!3tiZ7t-[* ZF69U'"dy@\J)i%F BSQ}TuHo$NQu(:PN}&lUl/dP oˠnJ/&)6i uR)`jm Pъ1۶e/=DdRP1&^ <;u1BuUO5Amٶ-{(KAŘP4k"¶-{X@IA/v$2(+cm-71)?DE8a=.mJA/T) 5GPxlܶX(TNS(cBEL &R 5ivD͚#(}<n)!HAŘP>RPWAD6<+)|H(_U5A:^7zG)(lr*SYeRP|~Ua"c*z"m[ذsR) O]1=UDItX(l9{d]-`RP1& YbV0KA/^ex!2H w 6z૫+)XDiX I *86!294÷c/Hc$cBSHd,qaWw3KA/^Z]8إb 'cBEGd,1{),:"t^kKإbKAHuX Y"C/a/0H]Ia2<ܕ #2(o?Zq4`RP1նT>$T ^JAETVf6RMSNdз#j8Y TVAѲظFRP}|"2ȣξ-ۣԥ j#)uX '2ȗ=fkv)=#aZ0Ra9wT>$T.qId,qaWw3Z}soN *86㶑ʇJaôQ1ն\^ex0RaV=wHzʷqu^ ,zˤ&򦌥 uR)|H(_U69OD!+,[{R{QqG)|H(_.m0W_*HTmi 5՘#qRKAqS۰.\ z~|HhZ=~%2xz^ *8zH&*$yS\c4ܶpg][u8HAqSztXaܫRPP 8 ?JAE4eUHdr˳UQX-cKAH,0RU'qCz'qC9 Ury{)(r*]ӇG)(]RPP fvRP1MYJAH,0R8Cz'qC9 Ur$7 WŶbx/ MG)^&lUl/&)㘪1$_(!2Hmtj;`|u%"Oxg>@/g)(I([}n/eyF4n= B$4cO$4vD|h~/pOAξ1# *ذTVR"pq)}xxgs怒p;Q,嫌Ƞ3Ԛ1[ψph/=KZ}$2(`أ⛄ $=#]w4R+)F0yIw74IA6$pO{"о11IA7DDy#x>NwRPP ̉ n[LYv͞4 ϳTqLSVRP|P*]:F_LRPP<&2c^xϑgv69ERPPj)(lrʋ>&2ȣlbڣ0RP|~2`Z BZgI/[i'2xb g YCiiʇUde.yӔUԥ mAG|uu%g)F;**W;)(oh/eEG\K\Uԥ_0R)1$+*V՘DՁ#,qAxҸ82K/"c*\ F sR)Tu7 WEݗI #Eu7IsGE5D"f 6=\cIddZ+)i%_0R) u`=[ g}1۶uPjX8ŔT  g߂(Z3<;,u 3g g0RU6ys7n=MRи IA6^ #!I$<#AnhY *Ҹ{"f#ܶR:Kz)& y:ûpD!N{)㘊.>k_,1alڋ~|T}OdPW[x±Ckr)!HAHzj!ɤ"c*HdPy~EĬ#[}Ak/Z_(!2Hwu1hJ rʉ ^kXjYGNH+Yo,=#U6D>kp@ uR);*8&o0RU6w4V#)jI F sR)EU'pO4n=eRи HAHzj!ɤ"c*Hd8:re7e)~*"Z 58 PR:Kz)TqLEU'TqL~[R)HhFKAc5R&HԥJ #o⎐R=:CbL(k"5s +)}T'"F-YKa $=k)5Axvy;;إbٶ-R EV% 5+,[{YKa $=mT mczMdp m[XDm PJA/L ٭XR=:C8)/ oy=G v9,[{tRP}?HACB)/ 8Vmek:⛄.Ó\Lo0ROYKa $=Oye̛TqL1oD!+,X88XYKa $=cwΐ?c)(rʋ>)/ȠcgyflIAMBS՗I z.G?7R:Kz)Mu,I<1AA{-=JAUS.=ДU$Krtwܶ{))&I<$_MU]'2H j#.mRs9R1H1qwT>$ YB/+#)(lrSKAMBTexLQum>Rs9R1YKa $=k)"ʇծD!+z-~'2c#GS9ho}ОKAMBՎpA43aѥB]_㌲HdX74:pXZz⛄qG"P1 });JA>(  NnqaW)㘲jD-cf۶BRP3#Ӛ# :nkPZ }LD;=7RP6DdGԚ#xV Ai̶ h@=HAiDCIAe@$28B?vV쥠bLO=:ضsǑ*rl jQq4FZc^[og^ *8,k"'(<~{ T1舥.mȠcΒ^ sR)!G,AtPkF;lz(Ǯy/4vu4IQf5wTqLeVm!2(xK1bS z~2+Ǯ!2 Gy+TVJ"+5c^[og^ *82Hdr4 PRPRО`A4"z|UX! z;+RP1&ݞ`ol9HIA Y9v AW8j8H5{kKA]Aj#)i%=]l4@5{>zqRܮyc5(Lw1eUٶHAHz]xCyk )bh܆{ B| b鸞q)mΒ^ #!iNw u)8˩kiz$+lIAETU`{b V7lX *ƄoDOan W<_ 2HZyÑ⛄)m WKl]IAE9RIdFG. %"VpA4{)(uM1m_CiA4{p "7}QӶ7R:Kz):ޅ7:myQRP3j Ybsqf N-K {-!m_]]IaȪmѸ 4d<B/aBq)#2(t^9\g#{Y{/pO{"QJu ax6⛄Շm >8aT x@IAMB#X.㠃HqqpPJ #EVm;&)(o( ʪms/7 MǝMRM?IAe@j/U]NBYmJA6^ qFtRPV^ qFtRX<)M,";*Wg ].xgM'\ JKA>(N RXIAc5$ui#!\}F #EQնqimL R)IOM?$TqLEU YGN f^S z_ȠpYKa"cz(6R)ꪨhFKAc5R&HԥF B>ﲸ:I'aSm;)h܆{q)m4n=Β^ #!iwY\(3Li\=IAE4e>(!HAHz]W')XRP1=ITF I RXIAc5$ui#!HAHzӸzbʊ}m=A (xcl»?ZN &o= l{k?8=;5bN #ŔYQD/:{X?oXaq@ga 2DQasK:rYRX'2F3_j8x>vff)K"2xڴz~ſCD8=l4_ uR/Ha0hցC֌r-vk><@GPZ3t8 R<@i\0hlU#<"P+)uLs9RYLUpˑʩ"'7ZIAHe A)ˑʤ A  *X z.G*m3n"'"uKڿqAixՕF #!iNw u).hFt )N 2)hF.m uDd0]߻F sR)0RHնCYei,:K]m: OY #㗓F CI6yvMRا]__,Ha0$"jz#"4¬R{xnlU#)×F 룷w-6a쑯0R<鎲nrN/lrzHrUNI]JAD\=U=~].WeU7{UݯۥMw.w,FYex].]JADi}{]ӼCYex]nRP6Qѭ~Ha0| #vC=)DG'%S#E;&*6PAtl/WEIa(](( j'!Ha0(ZnAtHQ]Xl˗w{"pw fƚ=р@vR)IO$E\tGDE%@4ߺb,/l[Y3:rp\HkR &*UܯvR:Kz)1oD/{뷗yUk)fM8`] Pv'e0R7lg"xXAG .^ &z\lϫRP6N BZgI/TNS(S4ex&*Uܯ.cm :pC1nm.WEUܯvRT}_;&*Uܯ.%G\VqIAH,0R۸ OwMTt_]-66:#Zw'cF BSc\HWOexl[2ַ1[Ǩ>Ļo{W\vR:Kz)R^B "HAHznN ҆ fsF8߂γA.V㶾{/((!HAHz8K bVÿ㰈46z\TVf6Dx6p 3KAHemmCdP78,y߂r2mCdP7l-Y BZgI/TWY@dPkasBuw㶾!"lٜTWTWF ҆ fsFuwRP]RP]R)K"2㶾jjYA]e_0R)̇/'):pz8, =ˀ(n``}Am^ PzcU0c`~DV:^vjjhl[:re:F BSI&EQ;Jj*† nNYp8+:'2y+=t@IA]HAH,0W_*HaI # |Jb0m>wRg||wRچ {v#v؎vj)u"X6z vw;`;j`;Y lG`;Y-З?O0160Zn|T}Q=Ha0ȸg PYGhYa Nً .x=C{إb+7 pJ #!),,-QuUmPub_u:lNʇ B/vp鎲n4Rqj?r;鎲n$<+s[j'!'"Ia $=U'q*E鎲nϗ[j'!HAHzzWW aR{uwc~Dա܆{)l[;&*Uܯ.%[8`N BZgI/tGDE>`ϗ[j'$eZm)*e*W ϗ[oV;)i%F BS댚LMRn򎲉ni +̶mqaW(h?_nY uR)IO]SHQ&u(VqM9RI]e]_z)!HAHzyQvD^ghole];&\ru "RI]7wMtY?_ne];&\rui`hM. uR)IO]SHQexzGD|*UܯvRtMǧ;&IAH,0ROwM"ihٹMp\+\0"+Y3 bY g,U<*3 %ZF0hvѥk-}a,6rKn`ì#[^Baf=].yVpoRlJ #%HAHz4Rnvw#2h4,AZ{-%"p+)i%=6l4 X8pqZŅ <;ś%z0R}(VqIa $=]b2xR:Kz)rBuwM5fሪC]ue._i=3K)(/WIQ}(Vq/e]K]᪨ʟ|N BZgI/}Rb^[ﮤlΒ^ #!驨>S uP9MEUtGDEUnN &*2 ?~/RP6e7M!K2(ˠeDv+lNymYA7ˠe)rB)鎲܆MTTe~p_.lrB|sQdP A\\8)i%F BS9I2>tGDe|چMTƧ,\JADquJjEU^AAt5 A\\8)i%F BS9ex˾(mIADe_fR &,2<( f2hY BZgI/IJtGD6줠l& ?~/RP6ez4*/ (,#6 px|ļ]IAH, Z\}F #AǶ=>`{wр~e5SͶ v"ցlD8GWGxPA8a#tMq%L# V&twv7+uAZ[?,Af) "Ûm*0l4`Ka0xWWMzۻۻ[$uy($D]5u'T ]S ?IOq^ #EӶ#$=uMC9MM_W{2د6;bpy nwv}ۻ+e=~~ߓ||NcKAyOdNie[lAGpgx.3H{)i%F BS9M!"':{8=Xg,Ǡ ^/TuGdٶpίX8pqƠ c^,l>QD;"pٳΒ^ # YcX "dV1b}ԑC\JAH,0Ri 5՘#uՕyyQdI8JAD. uR)IO4 jU<~/e]K)i%F BS9M!:CSY8R^gh1b)(( es*UܓAc( % o./6赇6x ǝΒ^ #!驜y,)3M5Uy]]5(, RP6%K)i%F BS9M!:CSY8R^gxWW jL=:CdI8JAD. uR)IO4 M5fHy]]5h1 ASO^ &*UKAH,0Ri NKADiX.D= bSoΒ^ #!驜y2l[ŽΒ^ #!驜P &\JQlmQ6%|Y1.%{+RP6%e\ڣP BZgIOD4R)IO4 jU<~Ψl$(*lK|Β^ #!驜P &K)i%F BS9M!:C]ueKADEN BZgI/TNSTcjLX &Jbu\ndzJz6쿵K)˟ z ނ5q'!HAHz*)D^gh1 G ASiG^gxWW &KMt/R BZgI/TNSTcU*~P6YRP6%K)i%F BS9M!:CSY8R^gxWW jL=:ûjTS7nR:Kz)rBupTcRP6Q  "ƻW{>xR:Kz)rBupҰX]~ݯK\v0Rz6xYxĻW{>xR:Kz)rBu8RP6QѭvDi4@zF(Pm bL쎐TTe)Uқ>ST)N:S_')( `Ka(]]#AW)( ȠZ솥,G"^b9_HAH,0RzR۸( ȠWK׷hѶopj\5{YKa $={WW aR{uwc~Dա܆:7MZgRtSU5wHd oXk,!HQMRwHd7řMT#ٳyчe!=pa癝òG5{ưAtĿ]HQMwHdC` f9 XzF>>Q#=7!pA0e!=<"Xb7p"掲 qqV.%߰nAtX()rB)p܆e!=d;c`HG^p6UP !HAHz*)D^g,?K6,G)i%F BSimhn( ^ BZgI/ o fEXg)EgSs,R<<]95wB*CQa7wYH_x(:YH_x(6wB*CMmJ0nbGB*CY! F 0fZcXzF(PmZ3mm1E;mH+) .FGpq[\8G ^BGo7R)IO۰۰e!\\p߭]GD*mlvwt/E>m uR)( Tv~"le!z-ٝF BtՓU5~R]d:Tޟq [K\շR:Kz)j0]q$HaЬ֋vq卻µ^`<+,=9h/F1zN063%z#RX㡩8HY\q ..Jl:o]`rr䧹,r{; KO槢R7FtT)H! Enq8~ן~z?86p _ ?}]OOƗEnq8 #u KP`]N/v}w9aخʧ-߮axJݐB}[Co߮n/CXH`cYmximƸx z:3KHCx~ ı"8O zO}?=#uQPF!$-g?|.G8~.ǹ,r{8V*ΉE.ϟ??&aSПHB 8y|vl>-1*kkp7wW oXU6Eo׫r& )@*Td ~aljuc͒>*TEnT$!_rB*:+5c#[} `E{@»f(,EkU:E>!>ŔT 4PWKa0yI)jzNÔ`nxJCy{`#{pRLit eS4L^_0#5"@:z/)): 0%U Yh">ZJCJ?m))wxf>8m NYKa $=UJAUw)´>Lit HboYk(q8i[giOd)V*Szs`/ۿ,0^ "o *v{%.Ίָ?Zk=A:rlEDGJAH,ȠP sR)֙h!2H(&oz tXzZ3³)c]=Q1U6yCdpbV϶SV-Tu9RvKMBYE44.HISU  !"#$%&'()*+,-./o0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTez,2~~xZak0^ݛOfٖEϲeqxƨɣr,o{Rmzr64V'2e1@TYBi "Yvzoϰc[Ps,T$!7䱧En4,SN%І7IB 6Ѕ U`SPQtI=@RO305 oL'E'ıѲ--4u9X86Ʀ!/`GU]- aH6;ql8SIYiNІb"T풰O@u$864.ָ~}߮." 1.0ptB5pqҔEn*RK.TR؊`Qs"\ -}v Ϥ0,Gr04}HC a *H40QXJuytT=W+|piD"E yTNW5K4GBPqf.߮WEŁVo %Yn.Ϋ> s"e"ޓ jn8 {!6}Z,2~^>l,ɣfOFe@dG:"j=HYȸx>>?={0A;qlltkN7'L7?aq9En[eHcҐ 8Ȫ #d<kG*ܶ@B͞f\GeX[bbԲmkG Vijň3"3i܁\ G}?E./{8~q=Njz uwfT0HcR` . -H֐G\jt<+BŁ86zI=Enq8_Ge8SrEN1H_(\.=-gah*3K.T¦!,:'XP(pNCR0a4:@F.6 j6ʑGz~}|k|YBR i@°vi [P;x;C B{L- 6.FZqQ`c  gBH`㤁EEvIkW"R@ma3B!N4Ӛb8)B ahG"R~Pı9aO"R-)G͞N:68EnZ``1HP4V0_]\$l=y$I,r )4VA/NCW_c djqlP4\ N!$'"GWFb$q=1-TzӲ- SeW=H.XY 0p(Tl]*GB*"j=HYȸx=^={8CPƏzDm lƸ4Tv}zPsT .?]~>*܀~Sə%-'( -d z31^_'95 6)ZqlX)ra!t6S k+ 5NΔEn|%Yb㤁4!ŸM•Wc +)y,r {!il MMJAiȠ߮"6V!d)E$GFK~y}s_~cJH4Зs"6=Sp%W/qN yœԚpXָgq]l}vr5f0#?}rkڑCKqxq7{<ݣUWr$[LV/ sG`y":IIqu?{~-ŵ q?E"kl"XP[>ԡ}X2gϟalq"0OoB~WD*g°1*TA5W]$!(*RK N"6V!!ڊ3K]QPFgqulZ Bl 2/#tBbOžY"P$ZM;CY=YyKa $=5IVۆ:C]55T>$2C)(lrj?@ABCDEFGHIJKLMNOPQRSTUtXzX'<J^OɏZq&0xYxmЉËq4Ca15ƎqxQb'__|}+6=V8[až :r(mݐc4sɕnzu)"8$eW>4xC\!sGaU%i(bc˒YЊc/ \Ԭ}E=kSS%~<ؿEp:G# ]u%~<{= ` u6'F"AgS+W?^"SPZi[X:tНDǒqu?? ` x} _2dz%-ڊ'tᩥНD%~ScP!ЉW`d+2N}g+9T{eB%spE8sy^j"!;I{, \{r\rT&Ejry \zTD&Q1덩57G\GxMU%a`da(t ^`F/F 5ԔL0 1\AH,ДdO0ՔX yeW덩ZɡWcN`LJ3LIZM_(d0ڑ[+Yc ā8Dxq O1xj9 /L-Ca154h5%y%%W+rHXtEЉo D ]Šfsbp^TP/Gt!6ԉ'l(4%SDp,8x1q-N̷%SDpP"jF{lD0h2 )"8=5ے0B[v{[@ڶ- \7#62WXFRV6#rIZMhř$]h ;+`_$s++@q=M#X`DW5Eh2e"YɊ:0M]h "Fk)Bͨ٤Iݢa4WOP8V6T2}aO rp F0\ᩕ!) -sm\8hY`\+F]< naFS# B^jqɽSlFm A&hےאp b\  :r.$ ː48hJ`LӇ:x/:RET5ZqV'pE0Fz4`15eF䅗z@C-lMڣ⟠."zy`n'iG u P{B'aUr%,qw}*y{_%`sh;A:aׯ`# )מ #EXp-lIQQЉǎqx}pU%&'ՠ1R_1"\n(} s4, teC`=zA'8t1Ng+y FdG>iNʄhp,8,g+`sy#_b`pE0}Kh%:r8Mu nqW%]HepExWoqI1`aA5"5fbI4+8 ^btX/Gt!=9m\_WJ*aWQpsuqf#y`.ijc1"4+>\"t襆z nEi*ш'Db aK!ye52:*;|*;|!![; ";*;#|+!>U2_;3!9x:monte0.$$$MODEL EXECUTION COMPLETED. Type RETURN:Type RETURN for Main Menu:!9DM͐)7~#fo`is#rT?n}͐?ng|g}o|ۘ! ^#Vr+sޘÕ͐!9x!Öi6! MDL COM<MDL00 OVLhMDL02 OVL/WMDL03 OVL0MDL04 OVLCMDL05 OVLKMDL06 OVL%MDL10 OVLa(MDL11 OVL(MDL20 OVL zMDL21 OVL'MDL22 OVLMDL23 OVL)MDL24 OVL)MDL30 OVL%MDLINIT MDLSMSG0 MSG! MSG1 MSGA MSG2 MSG MSG3 MSGaMSG4 MSG} MSG5 MSG MSG6 MSG MSG7 MSG MSG8 MSG MSG9 MSG4UCNF COM 9DM͐ `is#r͐͐ ښ͐)7~#fo! s#r)^?~#fo! s#r͐͐####͐D6͐)r?͐##s#r͐`i^#Vr+s!9éF!9DM*8|¿!Ü͐ ~#fo`is#r͐~#fo! s#r! w#w͐͐)r?~#foͦ! s#r͐|!Ü͐|)͐! s#r`i^#Vr+s)7~#fo! s#r͐?n&|g}o|l͐T?n}͐ `i^#Vr+ss#r͐͐)7~#fos#r͐Ü!9!9DM͐)7~#fo`is#rT?n}͐D6͐?ng|g}o|! ^#Vr+sí!9R x!!9DM! 6͐ ! s#r͐͐ Û͐)7~#fo`is#rT?n}µ͐?n}ʵ͐)^?~#fo|! 6!֛õ͐ ͐+?͐)^?~#fo! ^#Vr+s/! n&͛!9Initialization error.x!Öit!9DM*:`is#6͐*:ѯgҙ͐)7~#fo! s#r͐|c͐)^?~#fo͐)^?~#fo ͐͐#*:ѯg͐)^?~#fo`i^#Vr+s !9èx!!9DM*8#! s#r͐͐ -͐)7~#fo`is#rT?n}͐?n}͐)^0[m0jAoR ÍãåSv ØSâ!9DM>P2_;*G:p";! s#r{2:!"x8"t8*}8&@|g}o}2}8! *}8&?|g}o}2}8!!"x8"t8!! ! w#w*8|ԑ!ږ !!"D:!і*8#! s#r*8"D:*8|*8"8*8! s#r"D:>27! 6#6&*7}&>27! 6#6! 6*8!! w#w͐|t͐ J*r8s! ^#Vr+sJ! 6#6͐*8ڭ͐)7~#foD6! ^#Vr+s}*D:͐һ! w#w*D:)7~#fo! s#r*7}*D:*8! n}*D:#"D:! 6*D:͐ҳ*D:! s#r! !D:! s#r͐#|N!!і͐|a*D:#"D:í͐+|Ÿ*8͐*7}‰*8! ^#Vr+s"D:í͐++|­ûíø*7}>2:>2:!|!!і*8#! s#r*D:"D:ø`i6#6*8! s#r*8*D:##! s#r*8|3! 6#6͐*8ҩ͐#! s#r͐ "oJ͐ ! s#r>2:>2:*8|ʣ*7}£͐}2:͐*8š*8#ß͐#}2:͐͐#ͩҾ͐Ô͐#! s#r! 6#6! *8*8! !|È͐*:ѯg ?~#fo͐͐+?ͥ! ^#Vr+sü!92K>2:̌|H! ^#Vr+s!|>2:>2K*2:|>2:{28{28ό`is{?1>288* 7+" 7! 6#6! ͐Ҍ! s#r|lՌ**?،"! 6! n}‰! 6! 6! w#w! n}Վ͐ی|´**?،"͐T?n! s#6͐! s#r͐͐ތ*8}![!=`is`in&|!Ռ! n}͐،"*8}ʧ*L*,7|FՌ"!:|YՌ"*L*,7!?|~Ռ"!]|ґՌ"*L*,7"^?*,7",7͐! |А͐D6͐)r?w#w͐T?͐s*8}͐)^?*^?s#r ͐`i6#6&![! ͐+|͐! s#r͐! s#r͐n! s#6! ~#fo͐#n&s#r! ~#fo͐#n&)##s#r͐*L͐͐͐##LI͐D6͐)r?͐s#r͐^! ! ͐^! !9Program error in model(1). :f.Í40!9DM͐U!r͐##~#fon!r͐##~#fo`is#r͐͐͐~#fo1͐ʻ!r͐+?`is#r͐##~#fo|K!͐͐͐4͐##~#fo͐s#r͐~#fo͐s#r!!͐~#fo7r͐##6#6͐͐s#r!r!9 !\&!Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. ÕiÍéf.iô!9DM*K&|Ƈ*K}¹!ü!* 7̓> 2K͐>ۇ>>>J>>_> >j)^?w#w͐)?*?s#r*2:|,*Q:@*8}<*8&@**?+! s#r! ~#fo! nѯgs#r͐! ͐͐)*Ks#r*2:|ʖ͐ "2:*8}ʦ͐ }28!!C! n}͐*2:|͐! 9͐ |͐T?͐ s*Q:"2:͐،͐)?~#fo|)͐T?n})͐! Ռ!* 7͐|EH"!9]e:oi*K}¬*2:|ʤ!-TW* 7n&6n}ʚ!* 7Zß!!! TW* 7n&6n}ޑ*K}Α! ё!* 7Z!!=!9DM͐6͐͐`is#rz!V͐|;**?#"*?+`is#r͐6͐T?n}O͐6͐V!9*2:|n*Q:"2:y#Ù(!9DM͐)@?**7;s#r͐T?͐s!>͐)@?~#fos**7͐)@?~#fov"*7*!9DM! n&<* 7+" 7*9* 7!! n&!!!1! 9~#fo!!IRl!9DM͐ F! s#r͐͐~#foҽ͐`is#r͐͐~#foҽ͐)7͐+)7~#fos#r`i^#Vr+sÀ͐͐~#fo͐`is#r͐͐~#fo͐)7͐#)͆*;|G>P2_;!;!;*;?͉>U2_;!!]G*;͌É!* 7̓>2KÉ*9͏É!"9!*2:)7~#fo͒É/e:oÎ#*(RlÊ i{YVÌ!9DM! 6#6*L}C" 7* 7*Ls* 7#6*9!! ! !9~#fo!͐! 6{2:{2:!"2:}28}28*L}E>2Ló͐|ʳ*8! s#6*8! s#6!C͓͖|~!<͓!=͙͜* 7n}?ʖã {28{28f͐}28͐}28! 6#6͢͟! s! n}Xމͥ`is#r! n}DXGLXEuAߊd͐|͐ͨ}2;">2;͐|.ͫ!ͮ!.! ͱ5͢}2K͢}2L`ʹ! 65*C}o`ͫͷ|ʀ> 2.:**?+|™!ͺ5{2:{2:͐|ҵ*7"2:Ί͐|NJͫ5Ί͐"2:!"0:*2:ͨ"2:͐|ͫ5͐|*2:|͐ͨ}28**?}28!͙>2 L! !ͽ>2.:! n}GJ! n}Zш]`ш! 9x7`fôIf!9DM͐ "9>2;*9|g}o|ʣlë!xo>2E;*;}Nj*;! s#6Ћ! 6#6͐`is#r͐**?]*E;}*9|g}o| 7~#fos#r`i^#Vr+sۓ͐^#Vr+s)7͐ s#r!9R(ԟéÿ0Î#!9DM@`is#rzp!C͐|҄͐Ã*2:|ʲ*Q:)7~#fo͐²*2:#"2:͐Ã*2:|*Q:Ӕ*8}Д*8&Ӕ**?! s#r͐͐F|*:}͐ 6͐Ã͐T?n͐5͐)?~#fo|5͐Ã͐T?n}J͐Ã!>!DI*L}}L* 7n&O|}͐Ã!Ã!9Left Hand Side of expression!9DM͐|! ^#Vr+s)7~#fo`is#rT?n}͐͐͝ñ!!9LFQúòÿÊÒÊðjÜȦ9Vów5j!9DM͐s#r! s! 6#6E"7*76iE"7*76#61F"7*76F"7*7s#r! s#r*8}˖͐!͐! ͐|*L}!* 7n} * 7#" 7* 7n&6n}(͐|(|(!͐>8>k>D>k> P>ʝ>\>ʇ> h>ʲН* 7n&6n}ʘʹ  )@È* 7#" 7+n&!! 6#6Ú! s|їÚ! n}* 7!9"!|!`is#r*9`i!!͐!!!!!6!9~#fo!9!9!9DM! n}h*7#"7! ns͐|ʃ*7##"7͐s#r! n}ʝ*7#"7! ns͐ |ʸ*7##"7͐ s#r*9*2:|͠!MР!L!!!9~#foF!9DM!!͐! n&Qú!9DM* 7n} 8* 7#" 7$* 7n`is* 7#" 7* 7n&6n}y`in&6n} y|y!Á`in&Á!9îóÜVDZh52$5>éf.e!9DM*7n}֡!͍|ӡ!Éö*8}*7n}*8}5*7n}5*7n} !É*9*7~#fo!(!!+!9~#fo!É͐*8}H!Y*8}V!Y!͐*7!1F`is#r*8}ʆ͐|ړ͐|ҡ!/͓!É*7"?*L*;+*L! s#r!͐?*;͖! s#r͐ #| !!]G*;͙! s#r͐ +++|%!͓!É*L";*7*;! s#r*7͐#! s#r͐*;|e>P2_;*;|¢*;|’![;͜";â!![;͟";͐!͢*;?! s#r!;!;͐###ͥ!;!;͐ͥ>U2_;!!]G*;͐%|!! 6 #6* 7#" 7Ú! (|=!Ú*7n} T+* 7+" 7*;*7.*7!1*7"7! 6 #6Ú͐4!Ú! s! n}¶!! n&!77`is#r͐|!=:|͐7n`is#6`iw#w͐|l! n}=2! ~4o}$*8}2!=!`iw#w! n&6n}U! n}=l! n&!77`is#r͐|*7n}º*7~#fo)7~#fo͐)7~#foں!@|·!u͐|ԙ͐|!!1*7!1F!͐!! 6#6R! n&6n} I͐%|:!! 6 #6R! n&6n`is#r!|s͐|R*7n}“!@|!s*7n}½! n&*7~#foC|ʽ+)*7n}¬*7^#Vr+s*7~#fo|* 7!$"!͐| ! 6#6͐|©*7~#fo|X*9* 7+*7~#fo!!!!!L! 9~#fo!! n})ʓ*9* 7+!! n&!"!!! 9~#fo+!@|©!)*7!iE*9* 7+* 7+!*7~#fo!%!!!9~#fo!9#*9* 7+!ͨ+++|"!)͓> 2;!É*7͐"7*;";"L͐#͐! s#r͐͐͢t͐#!͐͢"7!*ͫ!É! 9í5jÛRlÜóԟ!9DM! 6͕͘`is#r͐|֤!͐T?n}ƒ͐͛͐?n&͛.͐͛͐?n&?n&͛҃*9͐?n&)@?!!͐)@?~#fo!!!J!!v!9~#fo!9!͐T?n}¥͐`is#r! 6͐|͐! ͞*7n} ݥ!͡|ݥ!͐6 #6!͐|y͐`is#r͐! n}!!ͤ! n}B͐?n͐O͐)`7~#fo!ͤͧ|s!ͪ!!!!9(*7+"7*7++"7âF!9DM͐! n&!!͟Φÿ!9DM* 7!+˦!9DM`iw#w͐n}*`i^#Vr+s! ^#Vr+sn! n}'͐0!0!9EQú!9DM* 7n} a* 7#" 7M* 7n! n}v<* 7n&6n}—?|—B!* 7n! n}¬2L{2;{2.:>28>W2K*%8|ʗ!C{2~8&"%8}2:}2:&"2:þV!9DM! n&!7͵`is#rz*7n} !N͸!͐! ͻ!!!9#ÿ!9DM͐T?6* 7+n&6n}c* 7!Cc* 7+!, q*ԟðj!9DMh`is&6n}ʮ`in}-ʮ`in}+ʮ!͟k!ğ* 7+" 7͐n!ğ!9number!9DM* 7* 7!Cͩ!! |͹!^*7~#fo|͝`is`in}<*7~#fo|(`in}f*7++++~#fo|f!Ͷ!^͹! w#w*7n}¼*7~#fo1Fn}®*7~#fo)F*7!1Fs#rù!g! s#rǨ!o! s#r͐|͐!Iͼ!^*7~#fo1F`in}!!s͹`in}! !Ϳ"͹!^*7#"7*7+"7#ns*7##"7*7++"7##~#fos#r!^!9no jumpno semi!9DM`iw#w͐|۩! n͐7n}ʩ! n͐#7n}ʩ`i^#Vr+s`i~#fo##s#rÅ!!9*Qú!9DM`is&6n}-|$!555`in&5!9DÍ4!9DM͐*7*;]G͐1FA͐)*7*;)G͐)FAíîllÿ˫=n!9DM!>͞`is#r! 6͐|͐T?n}͝! s͐|! n}ʻ! n}*.7!07!>͡`is#r͐|2! n}ʱ!>!7ͤ!ͧ|R!«! n}|**?`is#r**?T?n&!>ͪÐ͐T?**?T?ns͐)^?w#w͐)?w#w͐«͐«͐«!9ګV0Î#í!9DM͐+|!8Ϋ!#Ϋѫ*È͐|È*9!! !!9~#fo*9!!!!9~#fo!! s!" s͐;|*L}!͆* 7͉|! ͌`is*L`is{2L{2K`i6C! w#w`in&͏>C;>ʒ>RG>ʞ>DS>ʯ>K_>M>Vk>،>Mw>!>Lƒ>:>X>Fb! 6#6n! 6#6>2 Ln͒}ʺn͕! s#r͐|щ͐͘|͐͛! s#r! 6#6!͞*L}n>2E;*9!!!,!9~#fo͐!% s#r͐%**?G*E;}_{2:{2E;G͐%)7~#fo!# s#r͐#T?n}…9͐͐#)~#fo|͝! s#r͐#! s#r͐#T?n}͐|ͣ͐͐#)~#fo|͝! s#r! ~#fo s#r͐)! s#r*9͐#)@?~#fo͐#!͐!!>! 9~#fo͐|9͐#͐ 9͐͐#)~#fo|$!' w#w͐'͐͐#)~#fonѯg$*9͐'͐͐#)~#fon&)@?~#fo͐'͐͐#)~#fon&!!!!! 9~#fo͡*:}>2:J!' ^#Vr+sz!# ~#fo s#rM!% ^#Vr+s;ͤn͕! s#r͐|gͧÄ͐|vՌÄ>2 L͐B&ԫ`is**?T?!!7`in&׫s{4Z`in}LI**?T?6Z*B}W!`!`!9Äհ$5/h5Í442F!9DM*9}2[;! 6#6͐ ! s! n}ʠ! n} ܬ]mŭEÝ*K!I! 6Ý*K"K*K!JE͐ n&6n}àB*K#"K+! ^#Vr+sns{#Bà͐*KlI"KI"K*K"Kà͐ +++|®!![;o"K#|’r!*K*Ku++|ʮr*K"KI"KJ"Kà*K!Iܭ! 6Ý!!I*Kx!!l*K{àH"K*9}2[;!"K!"K![;~"K#|4r!́! 6Ý*K!I`is#r͐|y͐*KlI"K͐ |à͐ ! sÝæ!9þDZ/f.i4$5!9DM͐͐~#foڊ!͐~#fo͐ ~#foͬ#|ͯ͐~#fos#r`iw#w͐|T!!I͐ ~#foͲ++|H͵$`i^#Vr+s͐ ~#fo͸#|jͯ͐ !![;ͻs#rzŠͯ!͐͐ ~#foͬ#|«ͯ!9ïFh5/If!9DM͐ |͐T?n}͐)?~#fo|̰͐ +|ͪ͌|ʓՌ͐|Ҍ*9!!!!9~#foͭ* 7n&͏|ҌՌMnͰ͕! s#r͐|͘{2E;{2;͐|͐͛}2;!ͳn͕! s#r͐|?ͧn͌`is! w#w`in}-|͕! s#r͐|uͧn͌`is`in}@ʤ*9!!!!9~#fon͕! s#r͐|ͧn͐|׍͐! s#r͐͛!3 s#r͐͛!5 s#r͐͛!7 s#r͐3͐59*9!!!3!9~#fon͐7͐3x͐7͐5x*9!!!r!9~#fon>2 L͐7͐3َ͐3!9 s#r͐9͐5֎!7 ^#Vr+s͐9)7~#foͶ!9 ^#Vr+sÙ͐3!9 s#r͐9͐5͐7͐3)7~#foͶ!9 ^#Vr+s*9!!!4!9~#fon͹!! 6n* L}b͌}2K͌}2L! !" 6͘n!! n}͐|ʄʏ!" n}ʑÈ!ͼ|Ǐ*9!!!!9~#foͿ͌}2LͰÈ!! n}׏z͐|ܞ!# 6#6͐#**?͐#?n&|g}os!# ^#Vr+s!+ 6#6͐+**?! 6͐+)7~#fo!# s#rT?n}`͐#?ng|g}o|ʌ͐#?͐ |)*K͐)~#fo! s#r9! ~#fo##s#r͐ͷJ"K!!J*Kͺ`is#r!|mͽ͐?!J"K>2K*K*K*Kn&*Kn}#«̰*K#"K*K}ʽ̰Å! 6d#6˯!9Ff.i!9DM͐ذ͐!I*K۰͐ ް͐ذ*K͐"K8V=.!25Lé!9DM!K!K͐Iu0=.c*9*9&!@!!!9~#fol* 7n}#©o* 7|±* 7r#|±űvͱ@.7:,*ʱ:*}|2q  :qw! {w;c$57*5\!*8 !\&!Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. $KcÙ(*Î#(Ê Rl4 `07`9mYðZ:oñ×:o$540TZoZY`!9DM! 6#6͐G| *:} *%8| !C̓!"%8}2~8}2m8*:}4*:!G s#6*:g ?!= s#r͐G!; s#r! 6#6! 6#6! s#r! s#r*L} n&"8|͐#?n&|g}os*8|g}o|ܐ! 6͐#?n&|g}os&"8*8͛"8͐+ ͐#͐+*8‡! n}ʃ͐+!% s#r͐%*8ڃ͐%)7~#fo! s#r͐T?n}Vu͐?ng|g}o|u! 6!% ^#Vr+s ! n}œ*8͐+ϑ͐#?n&|g}os͐#?6͐#!Ň͐#?n&|g}os͐#**?+*8‡!+ ^#Vr+s!+ ^#Vr+s'!"8"8"8! s#r!/ s#r*F:}ʎ*F:&T?n}ʎ*F:&!Ň͐G|ʅ͐ |…*9͐=!!!9~#fo! 6#6!+ 6#6͐+**?.͐+)7~#fo!# s#rT?n!1 s#6͐1| !/ ^#Vr+s͐+͐/ ͐+͐/ȇ͐/!+ s#r͐1>>4>%>ғ>1>c͐#)^?~#fo|Œ͐#!Ň͐G|ʃ͐ |ƒ*9͐=!!!9~#fo! 6#6*8#"8*8|£*8|ʱ͐+*8ȇ*8|*8#"8*8|ϓ*8#"8 ͐#)^?~#fo|*͐#!Ň͐G|!͐ |!*9͐=!!!9~#fo! 6#6*8|<*8#"8C*8#"8*8|`͐+*8ȇ*8#"8 ͐#)?~#fo|»͐#!Ϳ* 7n&͏|ݜ!# 6#6͐#**?ݜ͐#)7͐͐#ns#6!# ^#Vr+sä͐G|͐ |B"7*z8}͝*d:|ͣ*8|͝*|8}ͣ}2:*8|1!4!}2:*v8":*:}*}8}!*7·!? s#rz˝*9*7!!!!!! 9~#fo͐?ч{2B{2BͿ͌͏|˝{2B{2B! *7*7ԇ#|*9*7!!!!!! 9~#fo{2B{2B! ! ͐ |D*9!!!A!9~#fo*:}ʭ*L}­* L}­*9*8&@|g}o!!!!9~#foׇڇ͡*:}ʧ{2:{2:{2:! !ͼ|ʽ݇!G s#r!; s#r* L}ܞ! !! n}͐|!ͼ|݇z! !A9V*L}+!k*L&@Û-to!9DM! w#w! 6#6! 6#6! 66#6!**?)͐7! 6#6͐**?͐͐)7~#fo͐s! ^#Vr+sÈ͐%|͟!!(͐7! 6#6͐**?͐)7~#fo! s#r! w#w*L} ͐T?n}<mv͐)?~#fo|ʝ͐)?~#fo|ڂ͐)?~#fo! s#r! :͐G|ʲ͐ |²*9͐=!!!9~#fo! 6#6*8|͔*8#"8*8|ߔ*8#"8*8#"8 **?+͐#Ͷ͐+)7~#foT?n&| !+ ^#Vr+s!+ ^#Vr+s×͒}>!͞*L}ݜ>2:*8|;*8|;*8)7~#fo!+ s#r͐͐+)~#fo! s#r͐|*!' w#w͐'͐nѯg*͐͐'#n! s! n&T?n}! n&?n}*8}2:*͐! nѯgn!% s#r*:ѯg͐%}2:!' ^#Vr+sØ*8#!# s#r͐#**?;͐#)7~#fo!+ s#r͐+T?n}-͐+?n}-*:͐#Ґ͐#}2:͐͐+)~#fo! s#r͐|-!' w#w͐'͐nѯg-͐͐'#n! s! n&T?n}͐! nѯgn!% s#r*:ѯg͐%}2:!' ^#Vr+sù!# ^#Vr+s6!# 6#6͐#**?}͐͐#͐#)7~#fos!# ^#Vr+sD!# 6#6͐#**?N͐##!- s#r! 6! n}@! 6͐#)7~#fo!% s#r͐%! s#r͐%! s#r͐%T?n}! ~#fo s#r͐%͐ =͐͐%)~#fo! s#rz!' w#w͐'͐nѯg͐͐'#n! s͐! nѯgn͐#!͐?n! s#6! :͐)?~#fo! s#rzj! 6! 6! ! ͐=|! n}j! n}j! n} 4! n}! 64͐ ! s#r! :4! ^#Vr+s! n! s! ! ͐=|g! 6#6͐)^?~#fo|‹͐)^?~#fo! s#r! ^#Vr+sn! s#6! ~#fo! ^#Vr+sn&+s#r͐͐*LҸ! ^#Vr+s! ^#Vr+sn! s#6! w#w͐͐ҵ͐n}͐#n! s#6͐ |k! ~#fo s#r! :͐ |ʏ! ~#fos#r! w#w! ~#fo##s#r! ^#Vr+s&͐T?n}ʢ͐`is#r! ~#fo s#r͐?n&|g}o| ͐?n! s#rz ! :! 6#6͐**?ѣ͐T?n}ã͐?n͐ã͐)?~#fo! s#r!|ã͐͐˜͐! s#r! :͐͐ã! ~#fo s#r! ^#Vr+s)! ~#fos#r! ^#Vr+s!!9ÿ!>!%4×0Î#ã!9DM! 6#6! s#r! s#r! w#w*L}Zè!*L}mè`i6#6͐͐s n&T?n}Y! n&?n&|Θ! n&T?n}Θ! n&?n! sÐ! n&?n&|͐! nѯgn͐#! n͐ Y͐ )?~#fo|Y! ! ͐ )?~#foˇ! n}Y͐ T?n}x͐%|x*9! n&)@?!!͐ )@?~#fo!!!͐|ͩ!ę!!ҙ!9~#fo!9͐G|͐ |*9͐=!!!9~#fo͐|!! 6#6͐! nѯgn͐-*9!!!W!9~#fo͐#!) s#r͐)͐-š*9͐))7~#fo)@?~#fo!!!!!! 9~#fo!) ^#Vr+sf*9!!!ۚ!9~#fo! 6#6͐-+!# s#r! n&T?n͐ T?nѯgWҁ*9͐ )@?!!! n&)@?~#fo!!!!!^!9~#fo!9! 6#6͐-+!# s#r͐#! n&Ͷ!͞*9͐ )@?!!! n&)@?~#fo!!!!!ߛ!9~#fo!9! 6!- ^#Vr+s~! n} !' ^#Vr+s;! n}(=!% ~#fo s#rè!# ^#Vr+sÆ͐ |ݜ͐|ݜ*9!!!!9~#fo ͐! s#r͐͐Ҷ! 6#6͐**?Ҩ͐͐)~#fo! s#r͐|ʚ! w#w͐ ͐nѯgҚ͐͐ #n! s! n͐͐n}Œ! w#w͐ ͐^͐͐͐ n&P^! ^#Vr+s#͐ ͐qÌ͐! ^#Vr+s͐s! ^#Vr+sݤ! ^#Vr+så! ^#Vr+sÌ͐͐ɥ͐! s#r͐! s#rÀ͐|l͐n&!! 6#6͐͐A͐͐n&!! ^#Vr+s ͐n&!* 7n&|lè! w#w͐͐ҥ͐͐n&"! ^#Vr+stè!9÷9m!9DM͐**?+F! ^#Vr+s)7~#fo"8T?n}%͐͐"*8?ng|g}o|"%Ϧ͐**?+F͐͐ʹ**?+͐ʹ**?+**?+)7~#foʹ{Èh5V!9DM͐*;! s#r͐|Ү͐|(͐! s#r!͐?*;r`is#r͐#|!!]G*;u`is#r͐+++|!x!k͐";͐*;! s#r͐ ͐]Gns͐ ͐)G~#fos#r!k!9zV!9:}2:&"2:4 !?*;nѯg4!6TInternal memory allocation error. be:o!9DM͐\_* 7n&6n}ʏ͐w#wàÙ(VN$G'!9DM`is! s͐ ͔|֋!͗͐ &6͐ n}͐ ! s#r! ^#Vr+sn}%͐ n}s! 6͐ n}%-! ^#Vr+s֋! 6! ^#Vr+sn! s{Œ! n&͚! s! n&͝|r3! n}eʈ! n}fœ`i4͐ +! nsŒ! n}.¶! ~4o}¶3! 6Œ3! n}Ҍ! 6`in}! n}֋`in}!͗! n}`in&|!͐6!͗!93*=n!9DM!!>-`is#r͐|v͐T?n}o!Ãv͐Ã!!>0!9ÛV0Î#í!9DM͐+|µ!8͏!#͏͒*B&͕`is**?T?!!7`in&͘s{`in}L **?T?6*B}!!õ!!!9BîlÐ}×0Î#V9m!9DM͐-`is#r͐|ڴ͐T?n&|ڤB" 7* 76͐)?~#fo|ª͐)^?~#fo|͐0|¾!׏͐!D36* 7n&9|!׏͐͐T?n&ʡDM͐~#fo~|ڬ*L}§!kw>2L*L}ʷÚ͐~#fo͐~#fo)~#fo|3͐~#fo͐~#fo)͐ ~#fo͐^#Vr+ss#r͐~#fo͐~#fo)~#fo6͐~#fo͐~#fo)~#fo4n`is#6͐͐~#fo͐~#fo)~#fo͐~#fos͐^#Vr+s!9é9m!9DM͐T?͐?͐)?͐)^?s#rs#rss͐T?n}“͐?n}ʓ! 6`i6#6͐**?j͐T?n}^͐͐^͐?n͐?n}^! 6j`i^#Vr+s! n}“͐?n&?n&|g}os͐?͐),?͐?͐)?͐?͐)?s#rss#rss#rs**?+͐ͦ*9͐)@?~#fo!!!!!!! 9~#fo!96!9DM͐͐3s#rz[!͐͐s#r͐##6#6͐~#foÎ@.7:,*͋:*ʰ}|2q ׫:qwҫ! {w$$57*\!* !\&!*͐0|!׏*9͐!͐T?n&7n&!:!!I! 9~#fo!;<6* 7n&9|›͐T?͐s͐)^?w#w͐)?w#wá!׏ô͐T?͐s͐|Џ**?+͐?͐׏!9fIf"["ò=.!9DM! n}C`i6#6`i6#6͐"9͐++++|v*2:#"2:+)7~#fo! s#rT?n͐v*2:**?s>2/:g0͐T?n͐ʐg*:}ʛg*9++++|͐)@?~#fo!:͐)^?~#fo|W͐)^?~#fo! s#r! ^#Vr+sn! s#6! ~#fo! ^#Vr+sn&+s#r! 6! 6͐͐ *LW! n}Sc!p! ^#Vr+sn! s! ^#Vr+sn! s#6! n} !,! 6! n&! w#w͐͐T!s͐ n&|g}o|ʅ*;͐ n&|g}o?͐ #nѯg! s#r͐+|y! n}%y!8͐ ! !9! ! !9! ! ! Â͐ 6͐ n&?|g}o?͐ #nѯg! s#r͐ n&@|g}o|*;}ے*;͐͐;! s#r-͐ n}!*Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. äKéYÑ*ÌÇf!9DM`iw#w! 6̓*L}Ƈ:͐ >և>9>>Z>>`> >ʑ> >ʦ>>ʻ>>ˈ> *>F>!6>ʔ3>2A;͆!"8}2A;3͉͌͏͒! 6C! n}p! 6P! n&";>2A;͆{2A;&"83!P!*2:͕3!C!*2:͕3!*2:͘3>2E;*;}*;! s#6! 6#6͐! s#r͐**?5*E;}5'!͐͘! ^#Vr+s{2E;{2:{2;:! 6#6͐ **?ґ͐ )7~#foT?n}ʃ!͐ ͘! ^#Vr+sO3͛|މ! 6#6͐ **?މ!C!͐ )7~#fo͕! ^#Vr+så͞|0!C͡! 6#6͐ **?0!P!͐ )7~#fo͕! ^#Vr+s3͐:!9 P A WV$R *L}h* L}j*L*,7*;*7*;ѯg**7*;g **? *;ѯg !N>2L>28>W2K{2;{2.:*%8|!CQ{2~8&"%8}2 ͐ #n&)@?~#fo! s#r-*L!v͐ ! ~#fo##s#r! ^#Vr+sú7!#! !9,*, Specdmp error:%xÙfIfòÙ(d!9DM͐ )7~#fo! s#r*:}Ý͐"9͐ )@?~#fo͊!,͍͐ T?n&7n&͍͐ ),?~#fo|%!͊͐ ),?~#fo͊͐ ?n}ͣO͐ ?n&|g}o|ͣ! s͐ )?~#fo|ͣz͐ T?s{ͣ! s͐ ?n}¥! n}¥! n}¥Õ! n}Д!͊͐ ?n&)@?~#fo͊! n}?!͊͐ )?~#fo`is#rz *;͐͐͐)@?~#fo͊!@͍͐ ?n&)@?~#fo͊͐ ?n}PÕ!,͍*;! s#r͐ )?~#fo|͐! s#rzܕ͐###͐ )?~#foɕ!*͍͐####͐###͓͊ܕ͐~#fo! s#ru͐|Õ!W͍͐ ?n&͖͐ ?n&|g}o|!!H͍͐ ?n&|g}o|B!S͍͐ ?n&|g}o|c!P͍͐ )?~#fo|ʏ!F͍͐ )?~#fo͊Õö! ͍!9,A,,P@,I,ûf!9DM͐`i͵`i͸!9v'ðÈ$!9DM!!ú͛}2K͛}2Lګ!CͶ|¨ګͭ͹|ʹ͐A+|ɞ! ̞! }2.:!"2:͐ |ͭ!"2:ú͐ |͐ "2:*2:! s#r*2:|6͐ |-͐ ! s#r6! 6#6`i6#6!M s!N s!e s!= s>2 L͐! s#r͐**?l{2:{2:!= n}ʝ!= 6͐+! s#r^*2:|ʬ͐"2:͐)7~#fo! s#r͐T?n͐A͝*2:|ͣ͐)^?~#fo|͝!f s{*%8|^͐**?+^͐W|͏*2:|͝͏*2:|͝y͕!e s! s#6*9͐T?n͐A͝͐)@?~#foÑ!e !!͐W!!! 9~#fo͘*2:|ʠ>2:!L 6! w#w*C}!"2:}2:}2:!f n}!T 6!e 6l`i6#6!O !8ͼ!< 6Ϳ!d s͛|!>™! s#r͐|^!d n}t!ř! ^#Vr+s^͐T?n͐Aʾ*9!x n&!!!!9~#fo! ^#Vr+s^͐ͤ! s#r!= 6͐! s#r͛* 7+" 7w͐T?n͐Al!f n}"* 7!șl* 7+" 7!>Ͷ+|A!d n}f* 7n}%f! ^#Vr+s* 7!jș^C" 7͛* 7+" 7͐)^?͐$͐"͐" `is#r! 6#6͐! s#r͐͐|Y͐"͐|m͐"͐! s#r͐|ґ! w#w! 6%͐! s#r͐|ҹ! 6#6! ~#fo͐s#r͐! ! `is#r͐! s#r`i^#Vr+s6.͐͐! `is#r`i^#Vr+s6f͐6͐$! ͐"͐"`is#r`i^#Vr+sn}0x͐6^͐"!9!9DM͐n}ʨ! ^#Vr+sÐ͐öá!9DM͐`is#r͐|`i^#Vr+s6-͐! s#r! ͐`iͳ͐6͐ !9Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. U#/e:o*Î#(RlY7`Ê YÙ(x!5jîlVÿKÌ=nðjË"#["!9DM!"8!i !g s#r!͐g͉!x n}CPޚÀ!W w#w!Y 6\#6![ 6w#6*!n s#r!!1 ͌! 6d#6! 6#6! 6#6! 6#6!$ 6#6!&~#fo!I s#r͐)^?*L*,7s#r*,7!G s#r*,7",7˙!C w#w!T 6!U s! s#6͐|Ԫ*L}!T 6Ԫ* 7n&͞!K s{,5:8#;+Σ- 0 00*ʢ>ÍÍ{2:{2:`iw#w!< n&!V n&!O ͐)!$ ~#fo͐Ι|‹!T 6Í͐)^?~#fo*,7|g}os͐)^?~#fo#*,7sÍ!M n}!N n}`iw#w!T 6Í!U 5!N 6Í!M n}!N n}"`iw#w!T 6Í!U 5!M 6Í*9͐)@?~#fo!!!!!_! 9~#fo͘*C}“!f n}ʆ!T 6!e 6{2:{2:Í!U 5* 7+" 7Í͐C++++|! w#w!U 6Í!< 6!U 6! ~#fo#s#r͐͐)! ~#fo* 7!ș!T 6`iw#wÍ* 7#" 7͛* 7+" 7Ϳ|K* 7!uș`iw#w!T 6Í͐C!6 ng|g}o͐+|g}o|ʐ!ř`iw#w!T 6Í!>™! s#r͐| !>!ș!љ|ҥ!T 6`iw#wÍ**?! s#r͐)^?w#w͐)?w#w**?T?n&!>ԙ*L*,7#",7+6*L*,7#",7+͐s˙* 7+" 7Í* 7n&6n}a` hk~͐C++++|Ž͐ |ʎ!ř! 6#6!( 6#6!* 6#6!, 6#6!8 6!9 s!7 s!: 6!A 6#6!E 6#6!V 6!_ 6#6Ã!W 6#6!Y 6]#6![ 6v#6*!n s#r!!1 ͌! s#r! s#r! s#r!& 6#6!* s#r!( s#r!$ s#r!9 s!8 s!7 s!E 6#6!A 6#6!V 6!_ 6#6Ãګ*L}*9͐Y! !!9~#fo*9!x n}C͝!Û!!!!!!! 9~#fo͐_͏!͏!a 6#6!c 6!"2:}2:}2:! 6#6*L}<*L!K s>2L* 76Z͐a|Q*8!p s#6*8!r s#6͐[͒͐n!x!9~#fo|ʉ!g͒å!x n}C͒͝!͒! w#w͐**?͐T?n͐A͐)^?~#fo|!e͒! ^#Vr+sí!h͒!x n}C͕͝{2:{2:͘* 7n}?4A {28{28]͐p}28͐r}28͛!K s!K n&͞!K s!a 6#6! w#w!K n}Xʓ͡! s#r͐ |ڱ͐ ͤ! s#r!K n}LӝDߝXʇEʮA Øͧ!c 6úͪ>2E;͐ |ͯ͐ !! s#r͐ |ͭ͐!] s#r͐]**?l*E;}>l^!x n&!͐])7~#foͰ!] ^#Vr+s!{2:{2E;!!a  T 6`iw#wÍ! ~#fo#s#r͐͐)! ~#foԦ* 7!ș!T 6`iw#wÍ!M n}* 7+n}-* 7+" 76-!M s!N s*;*7י* 7+" 7͐C!6 ng|g}o͐+|g}o|ʑ*;*7!O !O ڙ!O ͐gݙ|ґ* 7!ș!T 6`iw#wÍ͐C!6 ng|g}o͐+|g}o|*;*7!U:*;*7*;*7!8*;*7ڙ*L*,7#",7+*7|g}os*L*,7#",7+*7|g}os˙*7"7!U 6Í!U 5Í͐C++++|k͐ |kͿ* 7+" 7!>Ͷ! s#r*;}ب*7͐"7*7! s#r*;͐!> s#r**7! s#r;!> s#r**7͐"*7*L*,7#",7+͐?|g}o@s*L*,7#",7+͐|g}os!>͐>͌˙!U 6! ^#Vr+sÍ!C 6#6͐C͐Eڸ!@ 6͐C!0 n!K n}¤ø!@ 6!C ^#Vr+st!@ n}~* 7#n&6n} ~͐C++++|͝! s#r!L n}8!< n&!V n&!8͐)!$ ~#fo͐Ι|8`iw#w!T 6Í͐C! s#r! w#w!< 6!L 6*L*,7!K ns*,7##",7˙!U 6Í!T 6! 6͐|g}o|>2C!+ 6*C}Œ!͡*C}Œ! 6͌!& s͌|* 7+" 7! s#r! s#r>2>ͤ| ͧ! s#r͐|"͐~#fo! s#r!& n&͏>D:>m>EF>5>AR>F>K^>>Gj>ʐȑ;! s#r͐|͐~#fo! s#r͐|ʜͪ͐|2͐####͐###ͭ! s#r! ! s#r*9͐!!͐###͐##n&!!!! !9~#fo!9͐! s#r͐~#fo! s#rÜёͰ|@ё! 6! n}d͐|d!͛ё! n}͐|ʊ*%8|Š!͛ё*>}!͛ё!ͳ! n}ʾ͐###Ͷ͉*C}̎ё!C͹!Cͼ! s#r͐**7###;!CͿ**7###͐;6!>**7####͐;‡*9͐|F͐##n&I!! s#r!!!!k! 9~#fo**7;! s#r!# s#r͉! Ň|Ï͐|͐|͐! s#rÏȇ͐###͐s͐!>ͭ! s#r͐ˇ*L}o>2 L͐|)·͐s#r͐w#wU͐!! s#r͐͐s#r͐͐!~#fos#r*;! s#r͐|Ԑ! 6#6͐**? 6`iw#wÍ!e n}ʭ͐)^?͐Is#rԪ* 7#" 7!U 4n&|Ѫ`iw#w!T 6٢!T n}K!T n&|* 7!ș*2:|͝Mř! ^#Vr+s͐G",7͐)^?͐Is#r͐I|H!z͒S!{͒*L}^ګ! ^#Vr+sd{2:{2:&"2:!e n}ʑ!iřÞ͐W͕*8&|ں!!a ͳ!c n}ǫʫ!c n}׫ګÃ!t91.00001L%ISUNECONTROLPROBABILITYUÿ#!9DM!`i ͐ ͐ K* 7!!ê! n}‡͐|ʇ͐ `i|ڇ* 7!!ê*L*,7͐ )+͐ s!ê!9.99999Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. A:o*Î#G'ÿVYKc5jË7`Ù(eó6 lÍ4#Ê (0ÜrÀîl-$.!9DM*K}̓!o! 6*7&|>27C" 7* 76! 6! n}i*L}ˈ! n}c*9!! !`!9~#fo! 6͉͆*C}}!o* 7͐)?~#fo͐###Ɛ͐?͐s͐)?**7###;s#r! ^#Vr+sr**7͐"*7ё͐|!͛ё!* 6! 6#6͐**?Q͐)?~#fo͐###C!͛!* 6Q! ^#Vr+s!* n}^ё>2 L͐! s#r͐~#fo! s#r͐͐s#rё͐|¤!͛ё͐###!:‡͐##n&"r8}2 Lёȇ!+ 6!+ n}!ͳ͉>2Cá͐|g}o|ʩ`i6#6*9!͐!$!9~#fo!% n}7͉Gч!B!C‡!% 6`i6#6*C}_ú! Ň|ʑ͐|ڑ͐|ґ͐"n8ú*9!!!!!! 9~#fo !% 6`i6#6*9!͐!!9~#fo!% n}͉ч!B!C‡!% 6`i6#6*C}>*I:*n8 ;*n8 "I:é! Ň|y͐|y͐*n8 y͐"I:é*9*n8 !!!!! 9~#foǒ͐|g}o|!ͳ͉! Ň|͐|͐"p8ȇ͐|g}o|D!ͳ͉! Ň|D͐|A͐|A͐"r8}2 LDȇ͐|g}o|ʓ!ͳ*:}n!:ԇ͉!C͹*C}ʓn}?¿*8!, s#6*8!. s#6{28{28͆͐,}28͐.}28͉͌!' sވ*L!' s>2L* 76! 6! 6! w#w!' n&͏!' s&6n}&!' n}PXՉCWFZ5NOOWI_EgJoKwTSʙ*ʳH͊AB<>+!-)M1V2z8>2z8>2{8>2{8>2|8>2|8! ~#fo@|g}os#r! ~#fo|g}os#r! ~#fo|g}os#r! ~#fo |g}os#r*8&|g}o}28*8&|g}o}28>2:>2:>2:>2:!͒>2}8!' n}UQ>2}8!( 6! ~#fo|g}os#r>2}8! ~#fo|g}os#r! ~#fo|g}os#r! ~#fo|g}os#r! 6* 7n&͕|͌! s! ~#fo|g}os#r* 7+!͘! 6͌!' s! n}8!͛!% 6͐|g}o|ʊC" 7* 7! n}o! n&r!s* 7#6͞! >2 L!C!:‡͐|g}o|*9!!!!9~#fo! w#w͐|[͐)8~#fo|M*9͐)8!!͐8n&|g}o|!x !|!͐8n&!!!F!9~#fo!9! ^#Vr+sɔ!͡*C}n! w#w͌͏! s͌͏! s͌͏! s! w#w͐|Η! n͐8n}! 6>2 L! n}! n}K! n}E! n}Dȇ! n}&! n}D&! n}E&ȇ! n}KK͐)8w#w͐86Η!) 6! n}Eg! n}E¯Ͱ|rΗ!) 6*%8|ʆͰΗ!ͳ͐)8~#fo! s#r͐ Ͷú!ͳ͉*C}ŖΗ!Cͼ! s#r͐ˇ*L}o͐)8*;}*L*,7**7;s#r! n}D)! n}DD͐8n&|g}os]!) n}]͐8n&s͐͐)8~#fo!CͿ*;} **7͐"*7**7#"*7+;6ý*,7͐",7*L*,7#",7+6Η! ^#Vr+sè! n}ܗȇ*L}å*L}i͐ |g}o|R!ͳ͉! Ň|R! ^#Vr+s͐|O͐|O͐"v8Rȇ͐@|g}o|gׇ͐|g}o|ʚ*7ԇ n}ʓ͐ ! s#r! ^#Vr+sn}%͐ n}s¼! 6Ó͐ n}%ՠ! ^#Vr+s~! 6! ^#Vr+sn! s{j! n&?|۠! n&B! s! n}e0! n}fD`i4͐ +! nsj! n}.^! ~4o}^۠! 6j۠! n}z! 6`in}! n}ʐÓ~`in}£!W2K*%8|!C.{2~8&"%8}2:}2:&"2:!9;KcÎ#* Ê YfV!9DM`i6`in}ʺ!  *C}bú&#>Wv>ʵ>H‚>>LŽ>T>Zš>Z>X¦>ʋ>/²>ʛô*9! s#r! !ä)͐|͐{|͐"9,÷*9*d:|͝! s#r! !֤)͐|N͐|N͐*d:|͝"9Q,÷/÷*d:! s#r!!d:2*9*d:͐*7|ʓ!( n}ʍ*9*7!!*7|ʱ!ô!!( n}Ř!Ș!!֘! 9~#fo!( n}͉ч!( n}* 7* 7! s#r͐ ڇ|Á**7! s#r͐ n&6n}Y**7#"*7+;! ^#Vr+sns&!( 6͐**7qÍ͐;"7**7#"*7+;6Á*7|š>2}8͐|g}o|ʺ!( 6!( n}ʺ!( n}ԙ!B!͘!ͳ!( n}_͉*C}úB! s#r* 7! s#r͐ n&6n} .͐ n&6n}O! ^#Vr+s! ^#Vr+sns ͐ 6B" 7bч*B}mú* 7n}0>2F:ú!B݇}2F:!( 4*F:&|ڮ*F:&T?n}ʱò!( 6ò͐|g}o|0!ͳ͉*C}0! ! ! !!C| ȇ0͐"L͐"L͐"L!* L}@*L}F!o! n}V!o! n}f! 6+!o!09setnot set%d%d%dÔ}Ù(!9DM;`is#r͐~#fo! s#rz͐####͐###͑!>͎|͐~#fo`is#rä͐!9!9DM;`is#r͐~#fo|1͐~#fo`is#r͐8!9Ge!9DM*9*7&|g}o|l!o!*p8!!!"9÷!!f:2÷!05#|±!8÷,G!9display line widthnumber of lines to fill screenpage boundarieserrors:o!9DM*9͐͐~#fo!!!!H! 9~#fo*C}[͐u:oÎ#*Ê !9DM*9! !!͐n}ʞ!á! !!!!!!9~#fo!9iol`is`in}S͐6`in}C͐6r!9soundnot sound-ܧ:oÙ(*Î#Ê Y!9DM*L}Y*9!!!V!9~#fo*L`is}‹!* 7|ӧ!`isÕ{2L{2K`in&$>E«>,>G·>7>Væ>B>CϦ>M>Pۦ>X>O>c>M>n>H>y>L >ʄ>R>ʊ>X#>ʿ&'Ч!Ч!Ч!#Ч!\Ч!]Ч!Ч!Ч!Ч*Ч*9!j;!!*i;&!c!!!9~#fo!9Ч!}2K!}2LӧY!9!9DM*9͐!!!9~#fo!! 9~#fo*8&|g}o|ʬ!ï!Þ`is#r*z8}Ü!ǞƜ!˞! s#r*{8}ܜ!Ϟߜ!Ӟ! s#r*|8}!מ!۞! s#r*}8}͝!ߞ!! s#r*}8}͝/!2!! s#r*F:}S*F:&)@?~#foV!! s#r*9! !!͐*v8+!!!!!9~#fo!9*9! !!!:*r8!!!!˝!9~#fo!9*:}!!`is#r*:}!!! s#r*9!I:!!*n8!!!!/!9~#fo!9*9!L!!*L!!!!c!9~#fo!9*9! !!͐*L!!!!!9~#fo!9!D!9SETCLEARSETCLRSETCLRSETCLRSETCLRSETCLRSETCLR SETCLRSETCLR!9DM`i6 #6**?! s#r! 6 #6*7*,7! s#r*;*L! s#r*9`i!*;}p!s!**7!!l͐!!9~#fo!9! 9numbercharacterÿVõ{Ër!9DMC" 7* 7*9C ͐n}* 7#" 7+! ^#Vr+sns Ο* 76͐n}$!Ͷ!C!͹ͼHÙ(VG'N$Y`!9DM`is! s͐ 9|~!<͐ &6͐Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. /e:o*Î#(Y7`RlÊ ÇYÙ(K5jVyÍ4îlÌ*9m×Ð}Ѫÿ;ðj[ý-$Ñ!9DM! 6#6!"8*L};*9!#! !0!9~#fo!̓!% 6!"2:! s#r{2:{2:*L}w*L! s>2L* 76͐|*8!' s#6*8!) s#6!͉͆|¸͌|¸͏|!͆!͕͒* 7n}?ؚ {28{28Ø͐'}28͐)}28! 6#6͘! s! n&͛! s! n}X/͞!# s#r! n}LQD]XEAm ͡!% 6Mͤ͐#|ͯ|͐#ͧ!!! s#r͐#|“ͪ>2E;͐!! s#r͐**?ݛ*E;}ݛϛ!͐ͭ! ^#Vr+sä{2:{2E;!! ͰM͘}2K͘}2Lm!Cͳ|mͪMͶ|*;>2.:{2:{2:!"2:͐#|T!"2:ͪM͐#|m͐#ͧ"2:*2:|µ! w#w͐#|—ͪ! w#wMõ͐#|ڵ͐#ͧ! s#r!͒>2/:!& 6>2h;>2 L͹*L}m*h;}͐"2:>2/:{2:{2:*2 7ͼ!>! s#r͐|7!>!! 6:Ì! n&6n}b! n}+b! n}-Œ* 7+" 7*;*7! w#w*7"7!@#|¥!™Ҝͼ! s#r!|ɥ!>! s#r͐|͐T?n}!!Ϳ͐#|!>!* 7!! 6!™:͐?͐s͐)?͐|K͐U*7s#r͐?n&|g}os!͆:͘|ʚ! 6!™:ͼ!>! s#r͐|Ц͐T?n}Ц! n}!Ϳ! 6!™:͐?n&|g}os͐?͐s͐?n&|g}os!͆:! 6! n}O!™Ҝ! n}rڙ|dҜ͛͘! s! n}*w! s#r{2>ͼ|ʞ! s#r͐|!Ϳ! 6#6*>}٧! ~#fo!>ͳs#r͐™Ҝ͐?͐##ns͐)?͐###s#r*9͐?n&!!!!7! 9~#fo*9͐)?~#fo!!!!!k! 9~#foҜÍ! n}Wʍ!™Ҝ͘* 7+" 7* 7n&6n}* 7!!™Ҝ! !v* 7͐?͐s* 7#" 7n&6n}*9:|-*/:}-!͆!"2:!! ͰM**?)@?**7;s#r!̓*2:|͒͝*2:|ʵ*h;}µ*2:**?Ҝ*2:)7~#foT?n}œ*2:#"2:n*2:**?ڵ!͆M*2:! s#r>2:͕{2:{2:*2:|"*2:#"2:*2:**?*2:)7~#foT?n}*2:#"2:*2:**?">2/:>2h;*C}2M* 7! s#rͼ|X!Ϳ!™Ҝ* 7͐ ! s#r͐**?)@?~#fo͐ ř**?)@?~#fo͐6! s! s#6*2:|ɞ!& n}ʈ*:}ˆ**?)@?~#foș! s#r*2:|O͐͐)7~#fo ! 6L*:}L͐͐+)7~#foL! 6! ^#Vr+s>2/:*2:+"2:È͐|ʈ͐͐+)7~#foʂ͐**?+ˆ! 6͘|!˙|ʲ**?T?n! sý!™Ҝ3͛͘! s! n}C! 63! n}P! 63! n}L ! 63!˙|(**?T?n! s3!™Ҝ͐T?n! s! n}“*%8|ʕ**?)@?~#foș! s#r͐|ʕ͐T?n! n}•͐! s! n}Ơ! n&**?)@?~#foΙ! s#r! s͐|ڠ!™Ҝ͐|҄**7͐"*7**?#"*?+!?n&!!!!$! 9~#fo͛͘! s{F@ü! n}Hn͐?n&|g}os!͆ù! n}Pœ͐?n&|g}os!͆ù! n&6n}ʶ!™ü)! n}FʩҜ͐?n&|g}o|* 7͐)?! * 7ݙs#r* 7͐" 7*9͐)?~#fo!!!!!D! 9~#foҜ!% n}Z];!% n}jm!,9%dÿ!9DM* 7͐" 7* 7!CҬC" 7>2h;* 7n&6n}Ϫ* 7!|ڪ*y!9DMԪ`is{,! `in}!ת! !9 lÍ4K!9DM͐`is#r*;}ʈ*L*,7! s#r͐͐͐͐`i^#Vr+s6*,7͐",7̫**7;! s#r͐͐͐͐`i^#Vr+s6**7͐"*7͐ ͐s#r͐!9îl!9DM͐`is#r͐|+͐T?n}+!2͐2!9Ay*2:|Q*2:+"2:!>a*!9DM^! n&ʶ* 7+" 7*9* 7!! n&!!!! 9~#fo!!Ƭ}Ù(!9DM;`is#r͐~#fo! s#rz%͐####͐###ì s#r͐|͐͐! s#r͐|8͐͐љ͐|L! ^#Vr+s*9**?+)@?~#fo!!!!!{! 9~#foÓ͐T?n! s͐T?! ns!& 4! n͐T?n}ͣ! s{ʷ! n}g! 6#6͐**?K͐T?n}=͐)?~#fo͐=*h;}*͐!ԙ͐!ԙ>2h;! ^#Vr+sݡ*h;}g!Ϳ!™Ҝ͐T?n}͐י|!™Ҝ͐?͐)?͐)^?s#rs#rs! n}ˢ! n}Σ͐T?n}~͐?n}~!+ 6! 6#6͐**?U͐T?n}G͐͐G͐?n͐?n}G!+ 6U! ^#Vr+s!+ n}~͐?n&?n&|g}os͐?͐),?͐?͐)?͐?͐)?s#rss#rss#rs͐T?! nsڙ|Ҝ͛͘! s{Aڙ| Ҝͼ|!™Ҝ͐),?`i!>ݙs#r*9͐),?~#fo!!!!!f! 9~#fo*L}wmڙ|‚Ҝ͛͘! s! 6! 6! n}IʯP}4͐T?n}Ϥ!͆! 6:͘|! 6:͘! s&6n} :* 7+"!>|%͐~#fo`is#r֬͐,!9ԇÜr:o$òÀY`K*=.ø-Ù(#$504Î#ZfñIfò!9DM* L}2 L* L}̓|ތ*L}ͣ * L}ͣ!% s#6͐%|*>2 L>2:>28>2L*:}r*)8}H!)8͆* L}Ԉ*9!!!i!9~#fo͉*%8|ʍ!C͌!"%8}2~8}2m8{2)8{2&C!C!)8͏*9!!!9~#fo!"'8*)8&6n}Ԉ?!)8͒|H!C!)8͕"'8*'8#|+*9!)8!!!!!"! 9~#fo.?* L}<͘?H*'8#|U{2m8{2~8ތ! L4*~8}f>2 L!"%8ތ*:}„͛ތ*:}*9* L}#͝£!æ!!* L&!!!Ɖ! 9~#fo͉͞* L&* L}#͡* L}^!ͤ>W2K>2:!ތ`i6*K8}#!K8͆*9!K8!!!n!!H! 9~#fo͉*%8|o!"%8}2m8}2~8!C͌* 7ͧ! s#rz¡͐%|ʞ̓|ʘތ#áތ͐|ڱ#* 7`iͪ`i͒|̊#!`iͭ! s#rz2*9`i!!!o!!  >ʳ>X>oÎWçZç]çT|8`ç* 7+`is#r͐c|Sç!͐f! s#rzž*9͐!!!r!!! 9~#foð͐i͐lçT|`ç* 7+`is#r͐c|ܓç* 7#" 7+n&o|ܓTo|`ç* 7+! s#r͐c|$ç!͐f! s#rzL͐id͐͐r#|dç!tuç* L}}xÎT}2KT}2LД!C{|¡Дçxí*9!!!!9~#fo~*C}2Lí!95*sñÀàXÀ^`!9DM!!ܔߔ!< s&6n}B!Z!: s#r! Í!< n&|ʇ* 7+|ʇ* 7+" 7!: s#r͐:! ÍQ! n}͝¥!ܔí! n&+!= s#r*9͐:!͐=A!!!! 9~#fo! 6! ! n}!!ܔ`is`in}N! 6`in& ?! ! ! !?9*.*Å$*àÀ ^_R Ê `!9DM! 6*%8|ʯ!Ca{2~8&"%8d|½g×* 7+" 7! s#r* 7j|ܖ×͐n}͐n} ! ^#Vr+sܖ! 9~#foͰ͐ͳ*B&Ͷ|2#`i͒|A#!C`i͹! s#r͐#|Œ*9`i!!!p!!! 9~#fo#Ò#>2:!# 6#6͐#"9>28*9! s!"9ͼ!Ϳ! ‡! n&"9Ň|!Ϳ!‡ȇ|!Ϳ!!‡! Ϳ!"9ˇ! n&"9!Ϳ!! 6#6͐!|W!·!! ^#Vr+s4!Cч!! s#r!C͌|}!! 6#6*:}ʾ͐!|ڢ>2 L`i!K8ͪþ*9!f!!!9~#fo!"9͐%|Ќތ̓|یތ!'9exitrestartMDLV A E C A (:oÎ#=.ø-KÊ !9DM*9!!!I!9~#fo* 7n&`is`in}Wm!`in}S†>G2K>M2L!`in}#’`in}^£!`in}M·>M2K!`in}Oˍ>O2K!`in}Fڍ"ݍ%0!9MDLfÙ(If!9DM*;|Ý!*;`is#rzʕ͐! s#rzʕ!͐####͐###! ͐###! ͐##n&͐~#fo`is#r%!!9GG A Î fdIf!9DM!ʹ*7&|g}o|!P!C`is! 6H! 6W!n}O͐6! ^#Vr+sn} %͐n! s&6n}O! n&! s!C* 7m#|*9* 7!!!r!!! 9~#fo×*9* 7!!!!!! 9~#fo! n}͝ܗ*4:|ͣܗ*4:n}ͣ! s>2;!Cp`is#rzw͐|g}o! ss*:}!>2:w! n};͐|;w! n! ngt! n&|t! n&v! n} ·! n}·! 6! n! nѯgWҴ! v! 4Ï! n} ͝И! n} ͝! s*4:n}Y*4:|Y! n}! n}Vy*4:|! n&|)! n&@vK! n} C! n&vK!?vy*6:|f! n}f! n} t͂>2;*6:|! v!Ca͂! 9æV!sͣýa-G'í!9DM! n&ʹ|! n&ͷ|!!! n&ͺ|!!:.$?*Î#!9DM͐n&6n}V͐͐n&s! ^#Vr+s"!9DM! w#w`i6#6͐|͚! ~#fo͐n} •͚! ~#fo! ^#Vr+s! ~#fo͐ns`i^#Vr+so! ~#fo n} ! ~#fo! ^#Vr+s6.`i6 #6 6F! 6S*8&|g}o|$!A'!B! s! 6Z*z8}A!ND!_! s*{8}X!I[!E! s*|8}o!Jr!K! s*:}ʆ!<É!>! s*:}ʝ!+à!-! s! 6 #6*}8}ˏ! ^#Vr+s`i6V*}8}! ^#Vr+s`i6U*F:}! ^#Vr+s`i6Q*L|*L|*L|-! ^#Vr+s`i6Y! ^#Vr+s`i6 ! ^#Vr+s`i6`iͷ*n8ͺ*I:ͺ*p8ͺ*r8ͺ!:ʹ*v8+ͺ*}8}ʛ*7ʹ*F:}ʶ*F:&)@?~#foʹ*L|ΐ*L|ΐ*L|*Lͽ! *Lͽ! *Lͺ! 6#6! w#w͐|Ǒ͐)8~#fo|ʹ͐|?!ʹ! w#w͐8n&͐8n&|g}o|p!D! ͐)8~#fo! s#r͐n}ʱ͐n&! ^#Vr+sÍ! ! ^#Vr+s͐|ؑ! !9G*dIf!9DM͐! If!9DM͐n&6n}A! ^#Vr+sn& ! ÁKcÎ#*ٔ^YàÀ$54ñVÊ Ù(:o!9DM>2K*L}ʭC" 7* 7*Ls* 7#6*L}ʽ>2LŒ!qNTQ>Dْ>>T>>L>$>K>*>R͐|_! ~#fo͐n} '_! ~#fo! ^#Vr+s! ~#fo͐ns`i^#Vr+s! ~#fo͐6͐w!9Æ^!9DM͐n}ʰ! ^#Vr+sn&̓Î!9DM͐`is#r͐n}ܛ! ^#Vr+sě! ^#Vr+s͐ns! ^#Vr+sn}ܛ͐ !9$5!9DM͐!͐s#rzD!͐##w#w͐~#fo`Ó!9DM͐͐]s#rz!͐͐s#r͐##6#6͐~#foþf.Í4Ğ!9DMٜ͐!͐##~#fo!͐##~#fo`is#r͐͐͐~#fo͵͐?!͐+?`is#r͐##~#fo|ϝ!͐͐͐͸͐##~#fo͐s#r͐~#fo͐s#r!!͐~#foͻ͐##6#6͐͐s#r!!9 !\&!7*!>&*!N&>!, !\&!TELk77*~# z z+*&!Ü$57*͖\!*͙ʞ@.7:,*Ǟ:*}|2q [![!*8͐$[!!!ͳZ!ͶZ\[Kd=.#Û-$5h54G'-$!9DM͐|ڂ[͐!>[A[͐d! s#r͐d?! s#r͐!+n͐^!^! D[*9! s͐0! s͐!+͐#s!!͐!G[!! J[! s#r͐#|I\! !^M[͐|C\A[!ß^!!͐!͐P[! s#r͐!҈\!!>[͐S[͐!`is#r͐?! s#r͐͐!"9*9++++6\#6#*9++6##6!͐*9G[`i^#Vr+sn}\]\`i^#Vr+sn}#^͐n}# ]^͐n&V[|4]\! !^͐Y[͐͐! s#r͐͐5|{]͐|Ҍ]͐!>[\`i^#Vr+sn&V[|ʦ]Ì]`i^#Vr+sn&6n}]æ]`i^#Vr+s*9͐)~#fo|]͐!>[*9͐)͐s#r\͐͐! s#r͐|0^! 6e#6*9͐)! s#r͐ *9e^͐ *9!y^͐!>[!ß^͐ ~#fo|”^͐!>[͐ ~#foß^!9B:MSG .MSG NO ERROR MESSAGE FILE: '%s' %d^^Üd1e_ J #Z!9DM! n&6n:qw! {wS:o#ZTZoZðZ;[Ê -$G'Î#^_`7`R Y``N$`bKcY!9DM*L| T*;! ";!"G:*;"L! s#r͐*; T! ^#Vr+s6S͐|/T̓SY{29! s! 6?"9@"9! s#r! s#r`is#r*9#! s#r͐|g}o|9Y*7&@|g}o|T*9|¥T*9|ʨT͆S͐͐!Z͉S͌S͏S͐͒S|TY͕͐͐S"9͐+|T͘S*9|TY*9n}.U*9#"9n}-)U*9+"9! n})U3Y! 6! !Z*9#"9͛S͐)|g}o! s#r*9#"9n&͞S|sU\U͐͒S|U*9#"9+n}\U*9n}#UàUÁU*9#"9n&6n}¸UàU! s! sT! 6U! n}U! n}U3Y! 6! n}-Y*9#"9+n! s*:}V>2:Y! n}\ºW*9#"9+n&͡S! s{\rV#}VWʉVNʯVFʵVUʻVEVVVDVGVHVZW!\ͤSÚWͧS! 6ÚW! w#w͐|ҬV! ^#Vr+sÑVÚWͪSÚWͭSÚWͧS*4:ͰSÚWͧS*6:ͰSÚWͧS*8:ͰSÚWͧS*::ͰSÚWͳSÚW! !`is#6͐|I_>2K*9}F_*9*9|F_! ^>29_I__! n&^|_*9*9#"9+! ns*9*9*9ڈ_^>2K_^*:}ʞ__>29*9#"9^*K}_! n} _! n&^>2K*9*9_>2K^_>2K!9`1ebe*:}`!"9"9__&`_#Z `*9|5`#`=`R *9|N`*)::`!"9"9e`R J TZ*9|x`*9|x`!"9"9*9|ʿ`*d:|ʜ`!`\`ô`*:}ʬ`! _`!`\`b`*):\` Type RETURN for next page:*9#"9n&6n}``aÛ-$^!9DM͐ ! s#r*9! ^#Vr+s! ns*9! ^#Vr+s6͐~#fo|ca͐ `is#råa! n}cʍa͐ ͐~#fo)++~#fo`is#råa͐͐~#fo+n`is#6͐^#Vr+s!!*9`͐*9*9a*9`is#r͐n}b`i^#Vr+sn&a*:}bba!9*be:o!9DM`iw#w͐͐Bc! ~#fo͐)~#fo! s#r͐!vb!9~#fo|6c!!b͐ ͐)~#fo!b!!b$b*:}ʴb>2:Bc͐ ͐)~#fo|b>M2KBc͐ ͐)~#fo|c>2:!'b*:}Z*9͛S͐)))))*9+*9! s#r*9͐*9DWͳS*:}TW>2:YͶSÚW! n&6n}{W! n&ͤSÚW! ! Z*9͛S͐ͤSͶS*:}ʪW>2:Y! n}·W-YY! n}%Y! 6#6*9! ns! 6! ~4o} Y*9#"9+n&͹S! s{o)Xd)XsNXeNXfNXcuX.ʟXX! n&`i͐&͐ ͐ ͼSY! n&! ͐(͐"͐ ͼSY! n&! ͐$! n&͐ ͼSY*9! ^#Vr+s! ns! 6Y! n&6n}X*9! ^#Vr+s! ns! 6YY! n&ͤSWY! n&ͤS*:}*Y>2:YU3YTYY͐|RY͐"ͿSY͐++++|eY͏SY͐|ŒY!!:!:!h:SY͐|³Y!!:!:!r:SY͐|Y͐SY͐|Y*L&6n}YC" 7*L}2C>2CS!9MSG:lev %d, # %d:%d%d%d/Z oZJ >2:&Z)Z|HZ! ,Z>2K>2:ZZþ >28!8WZ>28uZY`!"9*9|ʤZ*9#"9*9ڜZrZáZ!éZ!!ùZ÷cd!9DM*~8}Z*8͐Z!Z!*%8|[͐|g}o| cBc>2:! 'b+c͐ ͐)~#fo'b*K}6cBc`i^#Vr+s8b!9Tce:o!9DM͐NcQc* 7n}?®c*8`is#6*8! s#6 {28{28͐Nc͐}28͐}28Qc!9cÛ-$f!9DM!!`iͺc͐!c`iͽc`ic!9%e dÛ-$f!9DM!!`id͐ !Hd`id`i d!9%dTdY`!9DM͐͐!{dNd!"9Qd MESSAGE ERROR # %d, Value: %d âdí!9DM*;*.:} ͝|g}o! s! n&6n`is`in}e`in} e! n}.e! n}e!!-e! n&͟d|e!$e!$e!9~` :e#Zbe*9*9*9`e*9|]e4e`e7ene J 1e!9DM*9|eeee*9n} ʙe*9n&he`i6#6͐*9e*9͐n&he`i^#Vr+sàe*9*9"9!"9ke>29!9!9DM*9͐!!f!9~#fofIf!9DM͐n}Gf! ^#Vr+sn&f%fXf`^gV!9DM*9|g}o|ʎf! n} ‚fLfÎf! n&Of*9|g}o|ʫf! n&Rf! n}g*9|g}o|g* 7|g! n&6n}g* 7!Dg* 7#" 7+! ns!"%8}2:}2~8}2;}2.:!)8!͹nͼn!CͿn!!poónðZӁ`Y`0#ËrzqR òhVõ{fr!9DMC" 7>2C*L}ʏoRq*%8|3p`iw#w!=o|o@o`is#r͐#|o!=o*%8| p!Co| p![qFo!)8FoIo*9*9pLo!CFoIo*~8}-pOo*B}-p!B!CRoUoLq*2:|Dq>2/:*:}]pXo|]p>2:!bq[o*:} q*:}wpC" 7 q!pq[o* 7" 7*.:&^o* 7" 7ao* 7*9+C q*.:}¿p!dop{2:{2:* 76`i6#6͐|q͐C͐!Cns`i^#Vr+spC";Xo* 76C" 7*/:}(q!"2:Dq* 7!go*:" 7UojoRq!CmojoUo!9FROM: End of line: Wait ... ÀqÜd!9DM! s#r! s! w#wC" 7*;n`is{Hr`in&}q! s! n}q! n}q* 7! s#r*;! s#r! n! s! ^#Vr+s*90r͐|%r͐";͐" 7* 76!]r* 7#" 7+*;#";+nsæq͐|Wr!]r!]r! 9C" 7* 7n&6n}‰r* 7#" 7nrÑrÜr!C͎r!9DM͐|rB`is#r͐n&6n}r`i^#Vr+s! ^#Vr+snsõr͐6!9:s"j#ZRg* 76!" 7!OUf* 7" 7(ggÜd!9DM! n} Yg*8}Lg>28g>28! "g*8}gg>28! n&"g!84*8*9ڙg*8&|g*;`is>2;! n&%g|g! "g! "g>28`in}2;!9gØ%ÀS!9DM*:}h!C! n&g#|h>2:!f!g{2;{2;{2C;{2B;:h"j7h*9*9Vh*:+":!9DM*;*;}ʡh*;&Ln&|g}o`is*;&#|g}o}2;`in&éh!&éh!9ûhR i*;|h*;͵hh*9*9͸hhR *%:hhR *':h iJ ! i$iR J hi!9DM͐`is*;|Gi*;iÐi`i~5o}\i! iGi*9|si͐*9ҍi! ^#Vr+szʊiisiÐi!i!9îijiR "j6}=!9DM*:`is#r>2C;͜i*9*9͟i*:͢iͥi*:":ͨiͫi͐":!9 jij*9| j*9+j(jÙ(*:%j* 7n&6n} Lj!>" 7* 7!?ҝj* 7* 7#" 7+ns&6n} ʓj* 7n&6n}ʓjÝj* 7#" 7Sj* 76* 7+" 7!ùjkU!9DM?"(7* 7n}-j*(7#"(7+* 7#" 7+nsj* 7n}+j* 7#" 7ͳj*  i6}Xh Ùià/hj~Ù(J oZa-Î#òh=4hh8 !9DM*9|Ys*:}Ys*9#"9*9|ڀs*9r*9Ҁsr*:":*:n}s*:r*:*,:}¾s*9*9rs*:r":s>2:! 6* :&|g}o}2 :*;}2B;! n}ʬ{*:":! s! sr! s#rs`is{'tÍt*C;}rt>2C;! w#w͐*;gt s*C;}Ytgt! ^#Vr+s2:! 6Öu:! s#r9! s#r! w#w͐|Җu`in! ^#Vr+sn}muÖuÈu`in! ^#Vr+sn}ˆuÖu! ^#Vr+sBu*:! s#r͐>±u>8v>½u>Yv>u>ʔv>u>ʾv>u>w>u>&w>u>7w>v>Jx>v>Ux> v>|x> )v>ʅx> 5v>ʴxÑy*:*:Pv*:+":Vv! 6Ñy*:n}ʋv*:#n}v*9͐*9ҋv*:#":Ñv! 6Ñy*:+! s#r*:*:ڷv! 6Ñy*:+":*:n}v! 6Ñy*:#":n}v*:+*:nsv*:*:w*:+"7n}.#k*(7#"(7+* 7#" 7+nsͳj-k*(7#"(7+6.`iw#w͐|Ҡk͐%7n* 7n}”k* 7#" 7*(7#"(7+6E* 7n}-yk* 7n}+Žk*(7#"(7+* 7#" 7+nsͳjàk`i^#Vr+s3k*(7#"(7+6!?͐Ͷj!9kG'*(7!&?k*(7#"(7+* 7#" 7+nsk|kkk* 7+" 7*(7+"(7!9DM`iw#w! ^#Vr+sn&6n}Bl`i^#Vr+sl͐Il!9Xl=.!9DM`i6#6͐**?Ңl͐)7~#fo͐–l͐ål`i^#Vr+sglUl!9ôll!9DM**?!@?͐ͱll}!9DM`iw#w͐͐ *m͐͐)~#fo͐l|m͐0m`i^#Vr+sl!0m!9!9DM`i6#6͐**?4n͐)7~#fo͐(n͐͐ m͐! s#r͐͐ m͐)7͐#)7~#fos#r! ^#Vr+sÌmn͐+! s#r͐͐ n͐#)7͐)7~#fos#r! ^#Vr+sm͐ )7͐s#r4n`i^#Vr+sHm!9Fn#Ù(!9DM**?)@?**7;s#r**?T?͐s͐**?)@?~#fo@n**7**?)@?~#foCn"*7**?#"*?+n ÿoZ$!9DMͶn͐|n*:}3o* L}n* L}2 L*:}n>2 L>2 L:6 w*:6͐ ":Ñy*:":!sÑy*:":!sÑy!As":* :&|g}o+++|Ax*:͐*9*9Ax*:*:+! s#r͐*:s! s#r͐#6͐*:! s#r͐͐w! ^#Vr+s! ^#Vr+snsøwA! s#r͐ n}x*:#":+! ^#Vr+snsw*:*:*9*9>x*:+":Ñy! 6Ñy*:":6Ñy! 6>2B;*C;}kx ss! s"sÑy*:":Ñy*:͐":͐*9*9ҪxÑy*:+":Ñy*:#! s#r͐*9*9ҋy`in&|ڋy`in&|ҋy*:#! s#r͐*:s! s#r͐+! s#r͐#6͐͐Yy! ^#Vr+s! ^#Vr+sns(y*:`ins*:*:*9*9+҈y*:#":Ñy! 6! n}ʪy! 6#6! 6͐) :~#fo! s#r͐|ʜ{! ^#Vr+sn! s{ʜ{*C;}yÜ{! n* :}͝! s{z! n}Jz! n}%z* :&s! ^#Vr+sn&s͐n}GzÜ{Ù{! n&%s|jz! n&sÙ{! n&(s>R‚z>z>OŽz>z>Lšz>z>P¦z>z>T²z>z>W¾z>4{>Az>A{>Cz>d{Ù{sÙ{*:rÙ{*:":+sÙ{.sÙ{*:#9DM͐! ÿÊ !9DM`i6! w#w!C! s#rz͐|g}o! s{r! 6#6͐{|ڦ>2;! 6#6* 7!m`is{2;! n} ·! n} ȃ4! n&|! n&|`in} * 7! ^#Vr+s! ns4* 7͐6͐'!99ón>2BB" 73* 7n&6n}f* 7#" 7K*%8|~*:}~!6ÌíÎ#Ù(!9DM͐n}͐#n}:*<;|*<;͉*<;͐n&͆̓|*9͐n&!1!!!9~#fo!!!9DM*9͐!!*!9~#fo!9DM*9͐!!Q!9~#fo!9DM*9͐!!x!9~#fo!9DM`iw#w! ~#fo͐n! ~#fo͐n}ׅ! ~#fo`i^#Vr+sn}ԅ!Ë! ~#fo͐n! ~#fo͐nѯgW!95h5!9DM͐|/͐+++|F!͐##^#Vr+szp͐^#Vr+sn&!͐͐~#fo`is#r!ڭ͐##^#Vr+s͐##͐?+s#r͐͐s#r͐^#Vr+sn&!9:won}1{*:*:*9*9+1{*:#":s.sÙ{`in&sÙ{s*:r*:r":s1s.sÙ{*:r! w#w͐*:sҙ{4s! ^#Vr+st{y! n}ʩ{7ss!9{#ZËrÊ roZ!9DM͐ ":! n}2:! w#w*9n&| |*9n&+d?! s#r! n&|g}o|s|*9|9|*:}<|*:n}<|͸{*9!j;!!*i;&͐c!!l|!9~#fo!9! n&|g}o||*:":*B}œ|ͻ{;{B`is#r͐n&6n}|*:#":+͐ns`i^#Vr+sä|*:6{*:}|{*+:}|*:*+:}|$}*,:}}*:*,:}}-}>2:! 6s|! 6 |!9?}hi!9DM*9|ʄ}*:`is#r`i^#Vr+s*:ҁ}*C;}{}Á}~}9}X}Ç}<}!9Ö}×!9DM! 6#6͐ T?n}~͐ ?n&|g}o|:~͐ !͓}`i6#6͐**?$~͐?n͐ ~͐!͓}`i^#Vr+s}͐ !͓}! w#w! w#w`i6#6͐**?~͐T?n}´~͐?n͐ ´~͐|•~͐ !͓}! 6#6͐!͓}! w#w`i^#Vr+sI~͐|~͐ !͓}͐~!9~#ZY`R i=!9D 2w&!o , . &\#1.2\fMAIN MENU\n\n\uH HELP reference manual\e\n S Minimal sequence to make a model\n A All steps to make a model\n V Variable declarations\nE Equation entry\n C Control parameters\nP Probability parameters\n O Alter the ordering of model output\n G Global formats and other options\nM Execute model\n D Read a model in display mode\nR Read a model W Write a model\n F File maintenance L Message level\n \v# Exit to system ^ Reset everything\d\n\nYour selection: \#.-1\h10Main Menu (? for menu): \#2\fFile will be displayed a line at a time. RETURN causes the displayed line to be processed. Break will end file input. Anything else will be processed \uINSTEAD\e of the displayed line.\n \#3\h10Format specification truncated, illegal use of '%%'. (Use '%%%%' to print '%%'.)\n \#4Type file to read: \#5Can't find: '%s'\nType RETURN foM* :&|g}o|>2 :* :͐|g}o}2 :* :&|g}o+++|*:n}W*:+":D*:*:n*:n}qA! s#r*:`is#r͐*:ڴ! ^#Vr+s͐ns`i^#Vr+sÄ͐6~*9###*9~!A~~*:~~~!9h!9DM`iw#w͐͐4*C;}%4(`i^#Vr+s!9C*:*:@fKc-$:oÎ#!9DM*8`is#6*9͐!!!!! 9~#fo!Z`i!V!C]͐|̀`i6#6͐}28*8&|M*9!! !!9~#fo`* 7n&c|M*9!j;!!*i;&!c! !F!9~#fo!9!9%de-$Ê W!9DM* 7n&6n}ʁā`i!Ё* 7\͐|ڻ͐|һ͐}28}28þ_ǁmb!9%dف^!9DM͐n}! ^#Vr+sn&ց V*%8|!!!!4*5jîl!9DM+6n}Q* 7+" 7>2>.*>}j!ÎÇ!>1`is#r!|҇!Î͐Î!9Ýÿ!9DM͐)@?~#fo͚͐!9DM*9͐!!͐!!! 9~#foõ{!r main menu.\n \#6End of file or user break: '%s'\nAll input is from the terminal now.\n\g \#7\h10Model not saved since last change. Type '%c' to %s or RETURN to save model: \#8\fOut of Memory Menu\n\nF File Maintenance\n S Memory Status\nW Write Model\nO Model Ordering and Deletions \nM Execute model\n^ Reset everything\n# EXIT\n\nYour selection: \#9\h10Continuing entry. '#' terminates:\n \#11\h10\uENTER EQUATION or RETURN to quit:\e\n \#10\h5\uEDIT EQUATION or '^X' RETURN to quit:\e\n \#12\h5To delete equations use Main Menu option 'O'.\n \#13Previous equation for '%s' remains.\n \#14End of equations.\n\#15Missing format field.\n \#17\h3Fatal disk error in reading equation files. Can be caused by changing disks.\n\#16Format too long.\n \#18Missing '?' prior to ':'.\n \#60E name Edit starting at 'name'\nD name Display starting with 'name'\n \#61.2A name Add before 'name'\nL Change message level\n X?? MAIN MENU option '??'\n \nYour selection: \#.-1\h10Equation entry (EDALX) ? for melear ^%c|%c; ENTER ^%c|%c; Tab left ^%c|%c right ^%c|%c; Edit previous line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## \#101A Add specifications\n \#103D name Display specifications beginning with 'name'\n E name Edit specifications beginning at 'name'\n \#104L Message level\nX?? Main Menu option '??'\n \n \#105Entry or edit aborted by empty line.\n \#106Missing specification type at '%s'.\n \#107\uModel is to large to build dependency table. Consistency check is incomplete.\e\n\g \#108\fMEMORY STATUS\n\n Character space is for variable names.\n Headers, etc. are stored with %ss.\n\n BUFFER IN USE MAXIMUM\n\nCharacters %4d %4d\n Variables %4d %4d\nConstants %4d %4d\n\g \#109\fFILE LINE TOO LONG FOR BUFFER!\nIT HAS BEEN TRUNCATED TO:\n%s\n\g \#118\fPROBABILITY VARIABLE SPECIFICATION MENU\n \n \#119\fCONTROL VARIABLE SPECIFICATION MENU\n \n \#120\h10\uENTER \#121\h5\uEDIT \#122Previous specification kept.\n \#123Specification entered.\n \#124\h28Entry formats:\nnu: \#25\fEquation Entry\nFollow each equation with '#' RETURN. Enter a blank line to quit. Message level 9 gives more information.\n \g\#26Equation Entry\n\#27Expecting %s at: '%s'\n\#28Expecting %c at: '%s'\n \#29Illegal character at:'%s'\n\#31Only one equal sign (=) allowed.\n \#32PROGRAM ERROR CASE OPNDCODE\n \#33Require %d additional parameters at:'%s'\n \#34Expecting ')' to end function call, found '%c' at:'%s'\n Expression scan continuing.\n \#36Too many function arguments at:'%s'\n \#37Brackets '%c' and '%c' don't match at '%s'.\n \#38Expecting operator and found:'%s'\n \#39Expecting an operand at: '%s'\n \#40End of expression with unmatched:%c\n \#41Error while writing parsed equations. Type 'W' save Model or RETURN to delete files: \#42.2Expression entered.\n \#43Illegal character at:'%s'\n \#44Expression scan terminated at '%s'.\n \#45\h10Continuing edit entry. '#' terminates:\n \#46Equation menu option or RETURN:\#47Missing right hand side.\n \#48Equation has too many terms.\nI, base, +/- change, limit\n %%, base, +/- per cent change, limit\nL, value 1, value 2, ... , value N\n S, string 1, string 2, ... , string N,*\n \#125\h24Entry formats:\nU, prob, begin, end\nN, prob, mean, deviation\n E, prob, base, factor\n \#126Type RETURN to quit.\n \#127Type '^X' RETURN to quit.\n \#128\h10Continuing entry for '%s'. '#' terminates:\n \#129End of CONTROL variables.\n \#130End of PROBABILITY variables.\n \#131.2Your selection: \#.-1\h10Probability option (EDALX) ? for menu: \#132.2Your selection: \#.-1\h10Control option (EDALX) ? for menu: \#133Number invalid in an 'S' specification.\n \#140\h10Specification Menu option or RETURN: \#141No PROBABILITY \#142No CONTROL \#143variables are declared. No specifications can be entered.\n \n \#150\h10Out of memory.\nSAVE MODEL ON DISK!\n Wait for consistency check and prompt for file name...\n \#161.3 \fSpecify values for %s variables. Formats are displayed at message level 7. Compound specifications are allowed. \#162Numeri\#49No disk drive '%c:'.\n \#55'%s' has not been declared.\n \#56Variable name should be followed by ',' and type code.\n \#35.3\h3Specify 'C' for a list of values, 'L' for an equation or 'P' for a probability distribution: \#.-0Specify C, P or L for variable type: \#57Expecting a unary operator at:'%s'\n \#58'%s' has been declared:%c.\n \#59Type Y to change the type:\#62Model parameters are:\n \#64\h10Out of space on drive '%c'. Type file to delete or '#' to exit:\n \#65No left matching bracket for '%c' at '%s'.\n \#67\fEQUATION ENTRY MENU\n \n \#68'%s' has been defined.\nType Y to overwrite: \#69Type 'Y' to declare it now: \#70Type Equation Menu option or RETURN: \#73Illegal occurrence of %s at: '%s'\n\#74.2\f\#75\f \#76Entry aborted by empty line.\n\#77Edit aborted by empty line.\n \#78Invalid adjacent unary operators.\n \#79Edit line truncated - too long for buffer.\n \#99\h8Move left ^%c|%c, right ^%c|%c; Delete at cursor ^%c|%c, left ^%c|%c; Block mark ^%c|%c - ^%c|%c, move ^%c|%c; Cc values can be constants or variables preceded by '*'. \#163The sum of the segment probabilities must be 1. \#177Message level 9 provides more information.\n\g \#164Too many numbers at: %s\n\#165Illegal input at: %s.\n \#166Too few parameters at: %s.\n \#167Sum of probabilities is less than 1.\n \#168CONTROL SPECIFICATION FOR '%s':\e\n \#169PROBABILITY SPECIFICATION FOR '%s':\e\n \#170Probability > 1 at:%s.\n\#171'%s' \#172\h10CONTROL variable '%s' determines when the variable(s) \#173are initialized. Its type cannot be changed.\n \#174Expecting a variable name at '%s'.\n \#175'%s' is parallel with CONTROL variable(s): \#176\nThe type of '%s' cannot be changed.\n \#102\h8Disk error or no space. Model not written.\n Use 'F' option to make space.\n\gPlease wait ...\n \#178\fThe next step in the model building sequence is \#179Type RETURN to continue the sequence or '^C' to quit: \#180declaration of variables 'V'. \#181entry of equations 'E'. \#182specification of CONTROL variables 'C'. \#1\#339\h6Drive for Monte Carlo files is %c. Change to: \#340\h6Alternate drive for overlays is %c. Change to: \#342\h10The last file read was: '%s'.\n \#344do character decoding for variable formats.\n \#345use a character buffer for line editing.\n \#343\fEmphasised Display Menu\n \nS Variable Format Decoding\n \n Screen Printer\n Begin End Begin End\n \u U E P X Underline\n\e \v V D Q F Emphasized\n \n\uYour Selection:\d\e \#337.2\fMAIN SETUP MENU\n \nI Read file at start\n S Storage allocation and editing parameters\nC Sequence to clear screen\n E Key codes for line editing\nA Alternate codes\n U Codes for underlining\nP Prefix for two character codes\n L Line editing control sequences\nF Cursor forward\n B Cursor left\nX Delete at cursor to end of line\n N Display message numbers\n M No message numbers\nT Display Monte Carlo trial\n K Change break character\nO Change stop output character\n R Use termcap for terminal description (Unix only)\n \n83specification of PROBABILITY variables 'P'. \#184setting of global formats and options 'G'. \#185checking model consistency 'O'. \#186writing model to disk 'W'. \#187executing model 'M'. \#110\h6Last completed write to '%s',\nType file to write model on: \#111\h6File '%s' exists.\nType P to purge it: \#112Cannot open '%s'.\n \#113.2\fFile Maintenance Menu:\n\nD file(s) Display Directory\n K file Delete\nR old new Rename\n T file n Type file (n sets tabs)\n L Message Level\n X?? Main Menu option ??\n\nYour selection: \#.-1\h10File Options (DKRLX) ? for menu:\#114No file '%s'.\n \#115Missing or invalid name.\n\#116Invalid rename request.\n \#117Missing variable name at '%s'.\n \#158\fLISTING OF FILE '%s':\n\n \#159\fDirectory for drive %c, files '%s':\n\n \#160\h10Type File Maintenance option or RETURN: \#199\h8Move left ^%c|%c, right ^%c|%c; Delete at cursor ^%c|%c, left ^%c|%c; Block mark ^%c|%c - ^%c|%c, move ^%c|%c; Clear ^%c|%c; ENTER ^%c|%c; Tab left ^%c|%c rYour selection: \#.-1\h10Setup option ? for menu: \#323Current %s is %d decimal. Change to: \#324\h4Drive for messages is %c. Change to: \#325\h4Octal code for %s is %o. Change to: \#326\h16Current octal sequence for %s is:\n \#327\h8Specify new octal sequence. Separate with blanks.\n \#328.2\fLINE EDITING MENU\n\n C Delete at cursor\nL Delete left\nV Block copy\nX Clear line\n F Move cursor to first character\nE Move cursor to last character\n I Insert at cursor\n. Retype current line\n B Edit previous line\n Special codes: R-122 return, O-117 output line, L-114 clear line (do R first), P-120 reposition cursor, T-124 end adjustment, W-127 Output character, A-101 Retype line, C-103 Retype at cursor \n \nYour selection:\#.-1\h4Sequence to change ? for menu: \#329\h14Sequence is: Cursor left, Cursor right, Delete cursor, Delete left, Start of segment, End of segment, Copy segment, Erase line, End edit, Move to left end of line, Move to right end of line.\n \#331read the above file wight ^%c|%c; Edit previous line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## \#303\h12Currently configured for drive(s) '%s'.\n Type new drives ('#' accepts any drive):\#304\f \#307.2\fSTORAGE ALLOCATION MENU\n \n S Stack size (Decreasing this is dangerous)\n H Store headers etc. with numbers or characters\n \n Safety factors:\nC Characters\nN Numbers\nV Variables\n \nDisk drives:\n E Messages\nM Monte Carlo files\nO Optional drive for overlays\n A Specify available drives\n \nEditing parameters:\nW Edit wait delay\n B Buffer characters\n \nYour selection: \#.-1Storage allocation ? for menu: \#308buffer as the buffer for headers etc. SET uses number's buffer and CLEAR character's. \#338\fWARNING: Options in lower level menus are primarily for use with predefined files. Incorrect entries can result in an unrecoverable error state. Save any model and \vRESET MODEL BUILDER\d before proceeding! Type '^%c' to abort or RETURN to continue: hen execution begins. \#334output the Monte Carlo trial. \#336Type 'S' to set or 'C' to clear: \#335\h16MODEL BUILDER is configured %s \#399\h8Move left ^%c|%c, right ^%c|%c; Delete at cursor ^%c|%c, left ^%c|%c; Block mark ^%c|%c - ^%c|%c, move ^%c|%c; Clear ^%c|%c; ENTER ^%c|%c; Tab left ^%c|%c right ^%c|%c; Edit previous line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## ot written as part of a model. (They CAN be set by reading a file.) To make them permanent default options generate a new SACopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. \#401End of line.\n\#402Editing illegal from a file.\n\g \#403\h4Old line too long.\nPlease wait for truncated line...\n \#404Missing name.\n \#405Error in reading parsed equation file.\n\g \#406Missing or undefined format name.\n \#457\h10Order menu option or RETURN: \#458Due to a circular reference in parallel CONTROL variables, %s is no longer declared parallel.\n \#459Moutput file '%s'.\nEXECUTION ABORTED.\n \#450\fThis section checks model consistency, moves variables thus changing the sequence of execution and deletes variables. Consistency is checked before executing or writing model. Errors abort execution. The 'R' option fixes some sequence errors.\n\g \#462.1Variable declaration entry.\n \#471.2 \fMODEL ORDER MENU\n \nC Check model consistency\n R Check consistency and correct errors\n D name Display dependencies starting with 'name' \nK v1,v2,...,vn Delete v1,v2,...,vn\n M v1-v2@v3 Move v1 through v2 to follow v3\n M v1@v2 Move v1 to follow v2\nV name Display variables starting at 'name'\n L Message level\nX?? Main Menu option '??'\n \nYour selection: \#.-1\h10Reordering option (CRDKMVLX) ? for menu: \#473Name %s missing or undefined.\n \#474Type P to continue deletions.\n \#475Missing @ specification.\n \#476First name of range after second. No move made.\n \#477Move completed.\n \#478Destination of move in its range. No move made.\n \#479onte Carlo reference '%s' is not declared 'L'.\n \#460\fVARIABLE DECLARATION MENU\n \nA name Add before 'name'\n \#461E name Edit starting at 'name'\n D name Display starting at 'name'\n \#463.2L Message level\nX?? Main menu option '??'\n \n Your selection: \#.-1\h10Variable entry (EDALX) ? for menu: \#464NO SEQUENCE ERRORS.\n\#465Variable '%s' deleted.\n \#409Scan terminated at: %s\n\#410%s declared.\n \#411Initializers legal only for type 'L'.\n \#412Initialization value:%s must be declared C.\n \#413\h4Initialization reference must be a CONTROL variable\n \#414%s is not declared CONTROL. \#415No identifier at: %s \#416.2Initialization entered.\n\#417Expecting column width at :%s\n \#418%d\#419.2Column width entered as %d.\n\#420.2Histogram output set.\n \#422.2Plotted output set.\n\#423.2Format '%s' entered.\n \#424A Only CONTROL variables can be declared Parallel.\n \#425Parallel specification entered.\n \#426\h10\uENTER DECLARATION or RETURN to exit:\e\n \#427\h4\uEDIT DECLARATION or \h6File '%s' is present. Type new name or RETURN: \#481\h4Type new output file name: \#482\h6The following depend on '%s':\#483'%s' \#484\nTo delete '%s' all must be deleted. Type 'Y' to delete all: \#485\fVARIABLE DEPENDENCY TABLE\n \#486\n\h4Variable '%s' depends on:\#487'%s' \#488\nVariable '%s' depends on no other variables. \#489No equation for 'L' variable '%s'.\n \#499\h8Move left ^%c|%c, right ^%c|%c; Delete at cursor ^%c|%c, left ^%c|%c; Block mark ^%c|%c - ^%c|%c, move ^%c|%c; Clear ^%c|%c; ENTER ^%c|%c; Tab left ^%c|%c right ^%c|%c; Edit previous line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## \#206.2\fGLOBAL FORMATTING AND OTHER OPTIONS\n \n First character SETs and second character CLeaRs. Current settings are in parentheses.\n \vPage formatting:\d \uPC\e Page at each table (%s)\n \uZ\e Width (%d)\#208.2 \uH\e Length (%d)\n \uAB\e Variables across (%s) \uNO\e Number (%s)\n \vOutput to:\d \uIE\e Printer (%s) \uJK\e Terminal (%s)\n \uVR\e Disk as printed (%s) \uUR'^X' RETURN to exit:\e\n \#429Remainder of line at '%s' ignored. \v'^P' edits error line.\d\n \#428\h28Entry Format:\nname,C,P@variable,field\nname,P,field\n name,L,I,value@variable,field\nfield is *name or explicit format\n explicit format is WnFformat or WnH? or WnP? Everything but 'name,(C,P, or L)' is optional. C,P or L may be followed by ',A,alias name'\n \#430End of variables.\n \#432\h10Declaration option or RETURN:\#431Alias entered as '%s'.\n \#433No variables to edit.\n\g \#434No values for CONTROL variable '%s'. (MAIN MENU option 'C').\n \#435No values for PROBABILITY variable '%s'. (MAIN MENU option 'P').\n \#436EXECUTION ABORTED\n \#437SEQUENCE ERROR: Variable '%s' depends on '%s'.\n \#438\h8Circular dependency involving: \#439\h4Variable '%s' moved before '%s' where first used.\n \#440\h5'Y' retains the new ordering: \#441\n\#442Variables '%s' and '%s' are different types.\n \#446Errors likely when reading this file.\n \#447\h4Type '^%c' to abort writing: \#448Can't create \e Disk (%s)\n \vEtcetera:\d \uM\e Memory \uL\e Message level \uT\e Other\n \#207.2\vHeadings and formats:\d \u*\e Headings \uG\E Named formats\n \uF\e Default format (%s) \uW\e Width (%d)\n \vMonte Carlo options:\d \uQ\e Reference (%s)\n \#209.2\uS\e Sizes (%d, %d) \#240.2\uY\e Seed (%d, %d,\#241.2 %d)\n \u<>\e Sort up (%s) \u+-\e Probabilities up (%s)\n \#210.2\u\vX??\e MAIN MENU option '??'\d\n \nYour selection(s): \#.-1\h10Global format selection(s) ? for menu: \#221Illegal option at: %s.\n \#222\fVariables are declared CONTROL, PROBABILITY or LEFT HAND SIDE (C,P,L). Formats may be specified. 'C' variables may be declared to vary together (in parallel) and 'L' variables may have initialization specified. Message level 9 gives more information.\n \g \#223Current %s is %d decimal. Change to: \#211\h10Type simulation size:\#212Number must be > 9 and < %d.\n \#213Type line width:\#214\h10Type default field width: \#215\h10Type default format:\#216\fHeadings are:\n \#217Heading code: '%c', De file\n \n W Screen width\nH Screen height\nL Message level\n Z Audible tone at page boundary\n X Audible tone at error messages\n / Main configuration menu\n \nYour Selection: \#.-1\h10Screen size etc. (WHLTZX/) ? for menu: \#266\h8This version of MODEL BUILDER does not include Monte Carlo simulation. \n\uDO NOT DECLARE ANY VARIABLES PROBABILITY (P).\e\n\g \#299\h8Move left ^%c|%c, right ^%c|%c; Delete at cursor ^%c|%c, left ^%c|%c; Block mark ^%c|%c - ^%c|%c, move ^%c|%c; Clear ^%c|%c; ENTER ^%c|%c; Tab left ^%c|%c right ^%c|%c; Edit previous line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## *j6"K*GK 7*K͞+65L'+FÎr ͖ 8{ Ăw#w#w^#V#*~#fo^#*~#fo^#V#*n^#*n^#V# ~#fo^#& ~#fo!+!#!+!#!+!+}|z{|}|z7||7zZZ)|/g}/o#|͉k|/g}/o#ɯ2qZZk:q|/g}/o#|/g}/o#:q<2qqDM!xxGyOcoding is %s.\n%s\n \#218.2\h12A or Z for initial and final headings.\n P or B for page top or bottom,\n V, M, T or X for table headings\n Add D for decoding, E to edit, K to delete: \#.-1\h10Heading code (AZPBVMTX-DKE) ? for menu: \#219\h10Enter heading:\n\#220Type page length in lines: \#231Type output file name: \#232\h10Output file is '%s'.\nType RETURN or new name: \#233\h10Type 'L' reference variable for Monte Carlo sort or '0': \#234'%s' is not declared LEFT HAND SIDE.\n \#235\h4Type n where only every nth output will be printed: \#236Number must be > 0 and < %d.\n\#237? for menu/n \#238\h12To set 48 bit random number seed type 3 integers x in the range -16385 < x < 16384:\n \#242\h3Type 'Y' for EDITING REFERENCE SECTION: \#243.2\h12Message level is %d. \#244.2\h9Message levels are:\n 3 - slow terminals, 5 - experienced users, 7 - novice users, 9 - read reference manual. Type level or RETURN: \#.-1\h4Message level or ?: \#245Output file '%s' exists.\nType 'P' to purge or RETURN:)v|͔`i|)Öxڷz/W{/_ѯzW{_=yOxGæ2qZZ͉M|}ȯ|g}o)|/g}/o#z/W{/_!9~#fo! ! ! ! ! ! !9~#A"s!`*"!"!Y">2>2>22!"!"!@"!" ʞ!F#x±~#±!b2r~# "2r+}|~#G:rx"2r+w# +6#!6#2w2x*s!>r<o&F=-` r'~h6!+`W?_!~7z?` :>ª@w#G.¶ww#?*>?w#> w#.7:77!a{   `OE!y6$ -7rBo&))T])))!y :@Š+:@ʭ@Yʥ"#" ҇ ux@LMDLINIT MDL+MSG0 MSG /012 ####~+++#(0Ϳ7@.>̀.ʞ# :@H#%p'2@`#'-p'.4͜*]#04͐8̓*m#:@=2@p'#\.#̀.;(;(ͯ':\#246\g \#247Segment probability must be a constant.\n \#248Edit one line heading:\n \#250\h4Variable '%s' is used as an initial value for: \#251 %s\#252, its type cannot be changed to 'P'.\n \#253\fNamed Formats Menu\n \nA name Add\nE name Edit\n G name Set global format to name\nD Display \n K name Delete\n \nYour selection: \#255Format '%s' is named '%s', width %d columns.\n \#256Can't add format that exists. Try edit.\n \#257No format by that name.\n \#258Type width or RETURN for %d: \#259Missing format name.\n \#260Type named format option or RETURN: \#261Can't delete a format that is in use.\n \#262Enter or edit format:\n \#263No configuration overlay 'MDL30.OVL'.\n\g \#264Model Builder is set to %s the buzzer at %s. Type 'S' to set and 'C' to clear: \#265.2\fSCREEN SIZE, BUZZER CONTROL AND CONFIGURATION\n\n Settings on this and lower level menus are not written as part of a model. (They CAN be set by reading a file.) To make them permanent default options generate a new SAVE@•#..w('$p'#:@.\.@.#̀.ͬ.¿#Ï#:@#Õ#G#͇-Õ#x.w(':@?2@$:O@>2O@*O*+4+2O@ͅ(:@($(0Ϳ7:@$:@•%:@$'-:O@Ž$͜*_$>67:@7û$*@|p$3͐8û$>67:@7>#7>67:@7û$*@"m@͜*²$>7:@7>éÛ-R 7Î#*íø-=.Ê #$-$N$@.f..UÆ$$!%g%Ø%!9DM`i6*7|`i6͡!!< !>ͤ*):ͧ!=ͧ!"*?`in}C*7|H>R2K*f:`is{28&"f:ͪ*9!K!!w!9~#fo`in&"f:ͪ!"S:*K}ʦ*K&ͭ! s >2 L*9!! !!9~#fo*9!J!!!9~#foͰͭ! s! n}X Ͱͭ! sͰ}2L>2K! !;! n&ͳ! s#rzʁ ͐)(;~#fo! s#r!|r *9͐!m !9~#fo~ ͐Ͷv ! n}Dʷ F R W G H/ ^? #O v s >2:{2m8{2~8*9!!! !9~#fo!:4!:4! Ͷ>2:v >2:!Ͷ*:} >2:! Ͷv >2K!Ͷv >2K!Ͷv * L}O !F;͹* L}Z ͼ>2:! n}2 L! Ͷv Ϳ* L}ʋ *2A;{ÏÄ!";͌áÄ!";͞!9DM! ^#Vr+sz! n͐͐n}͐#õ!0!0!0!!6í!9DM**?!T?͐3v!%Û-G'IpÎ#v'×þ!9DM!! [!!͐^! s#r! s#r͐n} ͐n} ! ^#Vr+sð͐n}-! 6#6! ^#Vr+s͐n&a|Y! ͐d͐n&`is! s! s! s! 6`iX͐g! ^#Vr+s͐n}.! ^#Vr+s͐n&a|! ͐d͐n&`is! s! s! s! 6`iX͐g! ^#Vr+s! ^#Vr+so͐n&j|! ^#Vr+s! ~#fo͐ms#r͐|M! ^#Vr+szJ! ͐d'|͐||͐||! ͐p! ^#Vr+sV͐|ʧ!!! ^! ͐s͐X͐÷!90,0,0,80,4#R !y9DM! `i`i!9/!9DM͐͐!͐8á6(Î#Ù(v'!&9DM! ^#Vr+s~#fo! s#r͐! s#r! ^#Vr+sn`is{ʒ`iK}‹ >F2KÂ!9 à/!9DM! n&|g}os *C;} ! n&! *?;} ! n&! à/*f:|6 !! A  ; > S þ !9DM*L}i M [ ! n} | ! P ! n&P Ð J *f:|ʡ !͍ é à/!ͦ ! Ï R Ê !9DM*8} *9͐!!!!"! ! 9~#foG `is{ A `in*8}; {2:{2E;!P A > ͐6!9 [ J !9DM͐|ʛ ͐n}ʛ U *C;}ʃ ! ^#Vr+sn&X l !9DM! n*8} {2:{2E;&! n*;} {2L&{2L& à/ Ý Ê ! |ʍ ! |g}o}2;*B;}) >2C;*C;}u >2L*;*;&#|g}o}2D;}o *;g!L*;s*D;}2;r Ê *;& }ʇ Ê Ø à/J !9DM!͒ `is`in} ʾ `in} ! ͕ `i s͕ `in&| `in&| `in&͕ *@;`in*@;}͝|g}o|)*?;&|g}o}2?;`in&1!9!9DM͐)7~#fo`is#r! ^#Vr+s͐ҍ͐#)7͐)7n}%|! ! s#r! 6#6! s! s͐n}-! ^#Vr+s! 4! )! s#r|! ^#Vr+s͐|! 6#6! ^#Vr+sn`is{.Q! )! s#r͐|:! 6#6! 4! ^#Vr+sn`is`in&,>Eg>ʾ>Fs>/>D>ʉ>U‹>>X—>>O£>>C¯>>S»>Nf͐|! 6#6͐|! 6#6!͐! ^#Vr+s~#fo! /! ~#fo! 2s#r!͐! ^#Vr+s~#fo! /! ! s#r! ^#Vr+sn}E{d͐5! s#r! ! s#r͐n} ®! ^#Vr+s͐n}-! ^#Vr+s6-! ^#Vr+s! ^#Vr+s! ~#fo##s#r͐|! ^#Vr+s60! ^#Vr+s! 6͐|n! n}n! ^#Vr+s! ^#Vr+sns! 5! ^#Vr+s! ^#Vr+s͐|ڣ! ^#Vr+s60! ^#Vr+s! ^#Vr+sn! ^#Vr+s6.! ^#Vr+s͐|͐|! ^#Vr+s60! ^#Vr+s! ^#Vr+s! ^#Vr+sý͐|Q! n}Q! ^#Vr+s! ^#Vr+sns! 5! ^#Vr+s! ^#Vr+s͐|چ! ^#Vr+s60! ^#Vr+s! ^#V~#fos#rU͐)7͐s#r!9ïÄ!9DM*A;&);~#fo! s#r";ͬ͐*;*;!!9~#fo`is#r*A;&"8͐ !9*éÄÉÛíx!9DM! 6#6͐";͐|¶>2A;!";>2A;!";|ʭ> 2A;!S";>!2A;!!"8>28͐͐!!9~#foó!"8!͐|>!2A;!͐|>02A;!";#|!!>2A;!!!͐|>2A;!͐|6>2A;!! !Z:͐$|ʋ>2A;͐|k>2A;!͐|ʅ͐|ˆ'!͐|©!";>2A;!͐|>#2A;`is#r>!2A;͐!͐|>$2A;`is#r>#2A;!#"8͐!>2A;͐|'!;!9!9DM* 7n! s&6n`is{X* 7#" 72`in}k* 7#" 7q! 6! n&{!9Ð&=.*8*A;&¦!*A;&0}2T;*A;&|g}o0}2U;*;!Q;͇#|*;!O;͇#|*A;}0!!Q;!%͍͊*A;&"8!CAN'T LOAD '%s'. =Ä*8}d>2A;!"8!S";:>28*96*8|v!"8~Û>r+sQ͐~#fo|! ^#Vr+s6-͐͐~#fos#r! ^#Vr+s! 6 ! 6! 6! ~#fo! n&! ^#Vr+s~#fo! &ѯgs#r! ^#Vr+s! ^#Vr+s~#fos! ^#Vr+s! n}a! 6#6! ^#Vr+s~#fo! s#r͐n}͐|! ^#Vr+s! ^#Vr+sns! ^#Vr+s! ^#Vr+s|͐6! ! s#r! n} ! ^#Vr+s!| ! ^#Vr+s6 ͐! ^#Vr+sns{2! ^#Vr+s ! n}c! ^#Vr+s!|c! ^#Vr+s6 <y! ^#Vr+s`insÏ! ^#Vr+s`insg͐6!9çá!9DM͐͐ ͐^#Vr+s͐͐0͐7s!&@͐ ͐͐ ͉͐ͤ`is͐ ͐͐ )͐ͤ`in&#&@!9O["!9DM͐͐͐LvË"!9DM͐͐͐sÝû"!9DM͚͐͐͐"!9DM͐͐͐$!#Ix!pÜ!!9DM͐͐! s#r! ^#Vr+s͐`i|?!-B! s! ^#Vr+s60! ^#Vr+s6.! w#w!8`i! s#r͡%++|ʒ&!͐##6#6͐͐s#r͐^#Vr+s! ns&&$5h54!9DM!͐&`is#rz'!>'!͐͐&|/'͐&!>'͐&!>'!9!9DM! n&0ͯr'! n&9ͯ|'G'!9DM`iw#w! 6#6͐ n! s{ ʯ'! n} ½'! ^#Vr+sÓ'! n}-'! 6#6! ^#Vr+s! ^#Vr+sn! sy'|(͐ ?! nѯg`is#r'͐͐?-(!9<(G'!9DM`iw#w͐~#fon&9(}ʉ(͐ ?͐^#Vr+snѯg`is#rJ(͐Ð(!9!9DM`iw#w! ^#Vr+sn}(`i^#Vr+sç(͐(!9!9DM! n&aͯ)! n&zͯ)R,Å,Î#,5!9DM! ^#Vr+s~#fo! s#r͐! s#r! 6! ^#Vr+sn! s{,͐n}y)! n&,! n&)|ʍ)L)! n}%)! n! )ʽ)! n&,)! ^#Vr+s ,! 6#6! 6 `i6! ^#Vr+sn! s{**`i4! ^#Vr+sn! s! n&)}X=*OF*DO*Uu*S+Cʔ++! 6u*! 6u*! )-u*! 6#6! ^#Vr+s! w#w!z͝Ž!9Ñ!9! s#r`in! nѯgW! nѯg! nѯg|!8͐ `i͐ ! ^#Vr+s͐ #| !9`i-͐ |"`i!8-! ^#Vr+s͐|d! ~#fo͐ |ͩV͐Z͐s#rz͐|z! 6#6͐|ҋ! w#w͐?! s#r͐|һ͐d9`i!8`i| !9`i! ~#fo͐ |ͩ!!s#r͐| ! ^#Vr+s͐|$ ! 6#6͐|: ! 6#6! w#w͐͐҅ ! ^#Vr+s!9`i`is! ^#Vr+sB ! ^#Vr+s6E͐|ʶ ͐ #|¶ ! ^#Vr+s6-! ^#Vr+s͐ ! s#r!0s! ^#Vr+s͐0͐  ?s! ^#Vr+s6͐ !!90!x!#þ!9DM͐͐'!!8͐*!|o!!8͐-!!&!&~!Í4!9DM!͐͐{!å!x!!9DM͐ ͐ ͟!! ~#fong! s#r! ~#fo###n͐`is#r͐| "`i6 #6͐͐! s#r! ~#fo###n͐s͐ ͢!͐0&R"!9a"/!9DM͐͐͐!^" n&! ))#|¤*! n&,! n&! ^#Vr+sn&)! s{*͐ ! nѯg?! nѯg! s#rä*! ^#Vr+s+! )͐ ~#fo! s#r! ^#Vr+sn! s{r+! n͐n}R+! ^#Vr+sr+`in}o+! ^#Vr+s! ns+`in}‘+! 4͐6! ^#Vr+sL)`in}+͐n&! ^#Vr+s~#fo)! 4! ^#Vr+sL)! n&,`in} ,! ^#Vr+s~#fo͐ ͐?s#r! 4L)! n&,!9!9DM! n&AͯN,! n&Zͯ!9DM! n} ͝ʁ,! n} ͝ʁ,! n} ͝Ë,R,!9DM͐~#fon`is͈,|ʺ,͐^#Vr+sÓ,`in&,!9,a-Î#G'!9DM! n&,! s,|-! n&s7-! n&,}2-! n&s7-!! n! n&+V-!_-! n&j-#,(!9DM! n&d-|ͣ—-! n&g-|ͣ7**:Oz³-q#ë-7*!9& 6C#6O#6M-.!w#w#*w#-:** .*!Âѷʤ!Å  , FNxg>Goyd.$7:)~:,"͐Ñ"/!9DM͐͐͐!͎"͐"/!9DM͐͐͐!;"͐"/!9DM͐͐͐!"͐!#"!9DM͐ ͐ `i#! n&|R#!Å#`in! nѯgW! nѯg! nѯg|#!Å#!Å#!9Ô#(!9DM! n&͑#|ʻ#! n&#! n&!9DM͐`is#r! ^#Vr+s! ^#Vr+sns{##͐$!9$#!9DM! ͐$3$)!9DM! ͐0$T$#,!9DM! n&Q$|{$! n& À$! n&Ì$v'!9DM͐~#fon}¨$!$͐~#fo͉$`is#r͐~#fon}$͐^#Vr+sn},$û$͐$!9$4!9DM͐%!͐~#fo$'%Æ$!9DM! $%`is#r!^%! ^#Vr+s͐s/%!9p%þ )!y9DM`ij%! `im%Ï%!9ä%45f.!9DM͐+|%! n&͛%͐++|%! n&!͞%͐+++|&! n&!͞%͐++++|9&! n} &&! !͞%! n&!͞%͐##^#Vr+szj&͐^#Vr+s! ns&!͐͐~#fos!"u*|*u.*~#£."*s*u.#"u*+"Ð..R 7*|.*"/*"/*"/|/*.!Z ##/"/"/"/:/2/!/6#+/!/ ~W!/~w# D/ze/!//w# [/=/ 5/!//?/w#x/+~g:/oŇ7*+++:G_*DM!/o&7!/:_!/og///000!0P0D010͜0/10:1/10E1/101/!0o2*!U46#!4!0*!^46#!4*V4!4:Y42d4b0!U43!U43q02Z4!U43!Z45:Y4q0!Z44+3:d4!U43!V43³0!V4_4!4!_43:Z4!c410/< 0!Z4:c4_4!V4!4:Z4!c4G0!c4(101!Z4(102U42^4!Z4(1!c4(1!U4^44P04+~51373!V43Ü0*4!e44!Z4:c4@w#> 1w!_431!V44*4!e4 4>2q4!Z4:c4G~2Ͳ3!Z4~ú232!V444!u4V4!4!y46!u43J3!Z44 3!y432>2z4!y4~43!y4>0*r4w#"r4!z45}3J33!t45!u43'32z4'32y4!e4u4!4!u43!u43e4!u44!u43*r46E#:t43/<2t46-#:t4 32t4 ×3>0w#:t40w#6!_44!4E1!t45!_4{4!4E1!t447~/w# 3ɯ# 3ɧ~w# 3ɧ~w+ 3ɧw# 4ɧ# 46# 4w# !4:Y42d4<4!V43!d4:b4w:b4!_43tB_kPk:5ffffP7*|DM**4ڼ4><4~# x°4 ><4~+ x4|}#  4 > _ 57:O*o`7,2q*&:q):`5=`5=r:qo&7:)~:,"s!"u*|ʾ5**s5! ~¾56*u*+"*"*u#"uÊ57*:w,   ber 2000-151 Version Number ODD1.1 %sCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. *K͞+65L'+FÎr ͖ 8{ Ăw#w#w^#V#*~#fo^#*~#fo^#V#*n^#*n^#V# ~#fo^#& ~#fo!+!#!+!#!+!+}|z{|}|z7||7zZZ)|/g}/o#|͉k|/g}/o#ɯ2qZZk:q|/g}/o#|/g}/o#:q<2qqDM!xxGyO҃)v|͔`i|)Öxڷz/W{/_ѯzW{_=yOxGæ2qZZ͉M|}ȯ|g}o)|/g}/o*CPLFRTCZ  Eee^;;;;;;;;;;;;;;<< <<<<E FG+-!+-*/^=|&<>:? ()[]{}<>!=AZVMTXPBMDLINIT.MDL4/5 &r!@r`=T…LUaIC[TUUL~zfHm=BǪ]fp@Zm8CWTȽ]ZefQAhLkSCtB_kPffff,y VW+Vi@@8_kdydydӉr^,BTD+@`}G rr4?@cSB   Q! ! ((((#z/W{/_!9~#fo! ! ! ! ! ! !9~#A"s!`*"!"!Y">2>2>22!"!"!@"!" ʞ!F#x±~#±!b2r~# "2r+}|~#G:rx"2r+w# +6#!6#2w2x*s!>r<o&F=-` r'~h6!+`W?_!~7z?` :>ª@w#G.¶ww#?*>?w#> w#.7:77!a{   `OE!y6$ -7rBo&))T])))!y :@Š+:@ʭ@Yʥ"#"҇ җ @LMDLINIT MDL+MSG0 MSG mnop ####~+++#(0Ϳ7@.>̀.ʞ# :@H#%p'2@`#'-p'.4͜*]#04͐8̓*m#:@=2@p'#\.#̀.;(;(ͯ':@•#..w('$p'#:@.\.@.#̀.ͬ.¿#Ï#:@#Õ#G#͇-Õ#x.w(':@?2@$:O@>2O@*O&"8͐ !9*éÄÉÛíx!9DM! 6#6͐";͐|¶>2A;!";>2A;!";|ʭ> 2A;!S";>!2A;!!"8>28͐͐!!9~#foó!"8!͐|>!2A;!͐|>02A;!";#|!!>2A;!!!͐|>2A;!͐|6>2A;!! !Z:͐$|ʋ>2A;͐|k>2A;!͐|ʅ͐|ˆ'!͐|©!";>2A;!͐|>#2A;`is#r>!2A;͐!͐|>$2A;`is#r>#2A;!#"8͐!>2A;͐|'!;!9!9DM* 7n! s&6n`is{X* 7#" 72`in}k* 7#" 7q! 6! n&{!9Ð&=.*8*A;&¦!*A;&0}2T;*A;&|g}o0}2U;*;!Q;͇#|*;!O;͇#|*A;}0!!Q;!%͍͊*A;&"8!CAN'T LOAD '%s'. =Ä*8}d>2A;!"8!S";:>28*96*8|v!"8~Û>2A;{ÏÄ!";͌áÄ!";͞!9DM! ^#Vr+sz! n͐͐n}͐#õ!0!*+4+2O@ͅ(:@($(0Ϳ7:@$:@•%:@$'-:O@Ž$͜*_$>67:@7û$*@|p$3͐8û$>67:@7>#7>67:@7û$*@"m@͜*²$>7:@7>éÛ-R 7Î#*íø-=.Ê #$-$N$@.f..UÆ$$!%g%Ø%!9DM`i6*7|`i6͡!!< !>ͤ*):ͧ!=ͧ!"*?`in}C*7|H>R2K*f:`is{28&"f:ͪ*9!K!!w!9~#fo`in&"f:ͪ!"S:*K}ʦ*K&ͭ! s >2 L*9!! !!9~#fo*9!J!!!9~#foͰͭ! s! n}X Ͱͭ! sͰ}2L>2K! !;! n&ͳ! s#rzʁ ͐)(;~#fo! s#r!|r *9͐!m !9~#fo~ ͐Ͷv ! n}Dʷ F R W G H/ ^? #O v s >2:{2m8{2~8*9!!! !9~#fo!:4!:4! Ͷ>2:v >2:!Ͷ*:} >2:! Ͷv >2K!Ͷv >2K!Ͷv * L}O !F;͹* L}Z ͼ>2:! n}2 L! Ͷv Ϳ* L}ʋ *K}‹ >F2KÂ!9 à/!9DM! n&|g}os *C;} ! n&! *0!0!!6í!9DM**?!T?͐3v!%Û-G'IpÎ#v'×þ!9DM!! [!!͐^! s#r! s#r͐n} ͐n} ! ^#Vr+sð͐n}-! 6#6! ^#Vr+s͐n&a|Y! ͐d͐n&`is! s! s! s! 6`iX͐g! ^#Vr+s͐n}.! ^#Vr+s͐n&a|! ͐d͐n&`is! s! s! s! 6`iX͐g! ^#Vr+s! ^#Vr+so͐n&j|! ^#Vr+s! ~#fo͐ms#r͐|M! ^#Vr+szJ! ͐d'|͐||͐||! ͐p! ^#Vr+sV͐|ʧ!!! ^! ͐s͐X͐÷!90,0,0,80,4#R !y9DM! `i`i!9/!9DM͐͐!͐8á6(Î#Ù(v'!&9DM! ^#Vr+s~#fo! s#r͐! s#r! ^#Vr+sn`is{ʒ`in}%|! ! s#r! 6#6! s! s͐n}-! ^#Vr+s! 4! )! s#r|! ^#Vr+s͐|! 6#6! ^?;} ! n&! à/*f:|6 !! A  ; > S þ !9DM*L}i M [ ! n} | ! P ! n&P Ð J *f:|ʡ !͍ é à/!ͦ ! Ï R Ê !9DM*8} *9͐!!!!"! ! 9~#foG `is{ A `in*8}; {2:{2E;!P A > ͐6!9 [ J !9DM͐|ʛ ͐n}ʛ U *C;}ʃ ! ^#Vr+sn&X l !9DM! n*8} {2:{2E;&! n*;} {2L&{2L& à/ Ý Ê ! |ʍ ! |g}o}2;*B;}) >2C;*C;}u >2L*;*;&#|g}o}2D;}o *;g!L*;s*D;}2;r Ê *;& }ʇ Ê Ø à/J !9DM!͒ `is`in} ʾ `in} ! ͕ `i s͕ `in&| `in&| `in&͕ *@;`in*@;}͝|g}o|)*?;&|g}o}2?;`in&1!9!9DM͐)7~#fo`is#r! ^#Vr+s͐ҍ͐#)7͐)7~#fos#rU͐)7͐s#r!9ïÄ!9DM*A;&);~#fo! s#r";ͬ͐*;*;!!9~#fo`is#r*A;#Vr+sn`is{.Q! )! s#r͐|:! 6#6! 4! ^#Vr+sn`is`in&,>Eg>ʾ>Fs>/>D>ʉ>U‹>>X—>>O£>>C¯>>S»>Nf͐|! 6#6͐|! 6#6!͐! ^#Vr+s~#fo! /! ~#fo! 2s#r!͐! ^#Vr+s~#fo! /! ! s#r! ^#Vr+sn}E{d͐5! s#r! ! s#r͐n} ®! ^#Vr+s͐n}-! ^#Vr+s6-! ^#Vr+s! ^#Vr+s! ~#fo##s#r͐|! ^#Vr+s60! ^#Vr+s! 6͐|n! n}n! ^#Vr+s! ^#Vr+sns! 5! ^#Vr+s! ^#Vr+s͐|ڣ! ^#Vr+s60! ^#Vr+s! ^#Vr+sn! ^#Vr+s6.! ^#Vr+s͐|͐|! ^#Vr+s60! ^#Vr+s! ^#Vr+s! ^#Vr+sý͐|Q! n}Q! ^#Vr+s! ^#Vr+sns! 5! ^#Vr+s! ^#Vr+s͐|چ! ^#Vr+s60! ^#Vr+s! ^#Vr+sQ͐~#fo|! ^#Vr+s6-͐͐~#fos#r! ^#Vr+s! 6 ! 6! 6! ~#fo! n&! ^#Vr+s~#͐!"͐!#"!9DM͐ ͐ `i#! n&|R#!Å#`in! nѯgW! nѯg! nѯg|#!Å#!Å#!9Ô#(!9DM! n&͑#|ʻ#! n&#! n&!9DM͐`is#r! ^#Vr+s! ^#Vr+sns{##͐$!9$#!9DM! ͐$3$)!9DM! ͐0$T$#,!9DM! n&Q$|{$! n& À$! n&Ì$v'!9DM͐~#fon}¨$!$͐~#fo͉$`is#r͐~#fon}$͐^#Vr+sn},$û$͐$!9$4!9DM͐%!͐~#fo$'%Æ$!9DM! $%`is#r!^%! ^#Vr+s͐s/%!9p%þ )!y9DM`ij%! `im%Ï%!9ä%45f.!9DM͐+|%! n&͛%͐++|%! n&!͞%͐+++|&! n&!͞%͐++++|9&! n} &&! !͞%! n&!͞%͐##^#Vr+szj&͐^#Vr+s! ns&!͐͐~#fo͡%++|ʒ&!͐##6#6͐͐s#r͐^#Vr+s! ns&&$5h54!9DM!͐&`is#rzfo! &ѯgs#r! ^#Vr+s! ^#Vr+s~#fos! ^#Vr+s! n}a! 6#6! ^#Vr+s~#fo! s#r͐n}͐|! ^#Vr+s! ^#Vr+sns! ^#Vr+s! ^#Vr+s|͐6! ! s#r! n} ! ^#Vr+s!| ! ^#Vr+s6 ͐! ^#Vr+sns{2! ^#Vr+s ! n}c! ^#Vr+s!|c! ^#Vr+s6 <y! ^#Vr+s`insÏ! ^#Vr+s`insg͐6!9çá!9DM͐͐ ͐^#Vr+s͐͐0͐7s!&@͐ ͐͐ ͉͐ͤ`is͐ ͐͐ )͐ͤ`in&#&@!9O["!9DM͐͐͐LvË"!9DM͐͐͐sÝû"!9DM͚͐͐͐"!9DM͐͐͐$!#Ix!pÜ!!9DM͐͐! s#r! ^#Vr+s͐`i|?!-B! s! ^#Vr+s60! ^#Vr+s6.! w#w!8`i! s#rz͝Ž!9Ñ!9! s#r`in! nѯgW! nѯg! nѯg|!8͐ `i͐ ! ^#Vr+s͐ #| !9`'!>'!͐͐&|/'͐&!>'͐&!>'!9!9DM! n&0ͯr'! n&9ͯ|'G'!9DM`iw#w! 6#6͐ n! s{ ʯ'! n} ½'! ^#Vr+sÓ'! n}-'! 6#6! ^#Vr+s! ^#Vr+sn! sy'|(͐ ?! nѯg`is#r'͐͐?-(!9<(G'!9DM`iw#w͐~#fon&9(}ʉ(͐ ?͐^#Vr+snѯg`is#rJ(͐Ð(!9!9DM`iw#w! ^#Vr+sn}(`i^#Vr+sç(͐(!9!9DM! n&aͯ)! n&zͯ)R,Å,Î#,5!9DM! ^#Vr+s~#fo! s#r͐! s#r! 6! ^#Vr+sn! s{,͐n}y)! n&,! n&)|ʍ)L)! n}%)! n! )ʽ)! n&,)! ^#Vr+s ,! 6#6! 6 `i6! ^#Vr+sn! s{**`i4! ^#Vr+sn! s! n&)}X=*OF*DO*Uu*S+Cʔ++! 6u*! 6u*! )-u*! 6#6! ^#Vr+s! w#w! n&! ))#|¤*! n&,! n&! ^#Vr+sn&)! s{*͐ ! nѯg?! nѯg! s#rä*! ^#Vr+si-͐ |"`i!8-! ^#Vr+s͐|d! ~#fo͐ |ͩV͐Z͐s#rz͐|z! 6#6͐|ҋ! w#w͐?! s#r͐|һ͐d9`i!8`i| !9`i! ~#fo͐ |ͩ!!s#r͐| ! ^#Vr+s͐|$ ! 6#6͐|: ! 6#6! w#w͐͐҅ ! ^#Vr+s!9`i`is! ^#Vr+sB ! ^#Vr+s6E͐|ʶ ͐ #|¶ ! ^#Vr+s6-! ^#Vr+s͐ ! s#r!0s! ^#Vr+s͐0͐  ?s! ^#Vr+s6͐ !!90!x!#þ!9DM͐͐'!!8͐*!|o!!8͐-!!&!&~!Í4!9DM!͐͐{!å!x!!9DM͐ ͐ ͟!! ~#fong! s#r! ~#fo###n͐`is#r͐| "`i6 #6͐͐! s#r! ~#fo###n͐s͐ ͢!͐0&R"!9a"/!9DM͐͐͐!^"͐Ñ"/!9DM͐͐͐!͎"͐"/!9DM͐͐͐!;"͐"/!9DM͐͐+! )͐ ~#fo! s#r! ^#Vr+sn! s{r+! n͐n}R+! ^#Vr+sr+`in}o+! ^#Vr+s! ns+`in}‘+! 4͐6! ^#Vr+sL)`in}+͐n&! ^#Vr+s~#fo)! 4! ^#Vr+sL)! n&,`in} ,! ^#Vr+s~#fo͐ ͐?s#r! 4L)! n&,!9!9DM! n&AͯN,! n&Zͯ!9DM! n} ͝ʁ,! n} ͝ʁ,! n} ͝Ë,R,!9DM͐~#fon`is͈,|ʺ,͐^#Vr+sÓ,`in&,!9,a-Î#G'!9DM! n&,! s,|-! n&s7-! n&,}2-! n&s7-!! n! n&+V-!_-! n&j-#,(!9DM! n&d-|ͣ—-! n&g-|ͣ7**:Oz³-q#ë-7*!9& 6C#6O#6M-.!w#w#*w#-:** .*!Âѷʤ!Å  , FNxg>Goyd.$7:)~:,"s!"u*|*u.*~#£."*s*u.#"u*+"Ð..R 7*|.*"/*"/*"/|/**CPLFRTCZ  Eee;;;;;;;;;;;;;;<< <<<<E FG+-!+-*/^=|&<>:? ()[]{}<>!=AZVMTXPBMDLINIT.MDLP/85 &r!@r`=T…LUaIC[TUUL~zfHm=BǪ]fp@Zm8CWTȽ]ZefQAhLkSCtB_kPffff,y VW+Vi@@8_kdydydӉr^,BTD+@`}G rr4?@cSA h@w#> 1w!_431!V44*4!e4 4>2q4!Z4:c4G~2Ͳ3!Z4~ú232!V444!u4V4!4!y46!u43J3!Z44 LSAVECPOM$<MDLB:MDL04.OVLA:EQUMDL.$$$SSDLGK_HBBEEVVXXMJAAFFPRCO 220 k<EXPLOGSINCOSTANCTANASINACOSATANRADDEGSQRTFVALPVALPMTNPMTLOG1PXABSREMAININTABlm)(__45WWARTRRPQWT T MODEL BUILDER A trademark of Mountain Math Software Copyright (c) 1983 Mountain Math Software All Rights Reserved Serial Number 2000-151 Version Number ODD1.1 3!y432>2z4!y4~43!y4>0*r4w#"r4!z45}3J33!t45!u43'32z4'32y4!e4u4!4!u43!u43e4!u44!u43*r46E#:t43/<2t46-#:t4 32t4 ×3>0w#:t40w#6!_44!4E1!t45!_4{4!4E1!t447~/w# 3ɯ# 3ɧ~w# 3ɧ~w+ 3ɧw# 4ɧ# 46# 4w# !4:Y42d4<4!V43!d4:b4w:b4!_43tB_kPk:5ffffP7*|DM**4ڼ4><4~# x°4 ><4~+ x4|}#  4 > _ 57:O*o`7,2q*&:q):`5=`5=r:qo&7:)~:,"s!"u*|ʾ5**s5! ~¾56*u*+"*"*u#"uÊ57*:w,   %sCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. ùTZoZ ónKcÎ#*דöX:o#Ù(Ê eÿÅ!9DM*9*8&@|g}o!R!!!9~#fo͉̓͆*:}*%8| ͌>2:Õ!Q͏*C}$Õ͕͒>I8>>CD>Z>SP>j>E\>~>Ah>ʨ>Ut>Ҍ>P€>*>KŒ>:>O˜>W>H¤>t>L°>ʄ>F¼>ʳ>BȈ>ɏ>XԈ>ߏ>N>>M>>T>[*9!)8!!!V!! ! 9~#fo!7*7|͝?!B!!!!K͘^!):!͛^!3͏*C}}{͕͒>S‘> >H>/>C©>q>Nµ>ʖ>V>ʻ>E͉>>Mى>">O>]>A>ʘ>W>#>B emphasisedstart print underlinestop print underlinestart print emphasizedstop print emphasizedprefix for two character screen control codesbreak characterstop output charactercharacter to halt outputdelete cursor positiondelete leftcopy stringdelete entire linemove cursor to first charactermove cursor to last characterinsert character at cursorretype current lineedit previous linecursor rightcursor leftdelete from cursor to end of linetonot to:oÎ#!9DM*9͐ !!!O!!! 9~#fo*9͐!!.!9~#fo*9!P!!J!9~#foړ* 7n}\ô* 7n&ݓ|͐ ͐s#rô* 7n&ݓ|¦͐ ͐s#rô*%8|ʱôԔðZÛ-$Ӂ^`:o*-$!9DM*9͐!!!F!!! 9~#fo͐~#fo`is#r!͹|ʆ͐|ʆ͐n}{!!! ͼ`i^#Vr+sn&!R! Ϳ! ”! Ŕ,*%8|†Ȕ**7;! s#r˔*C}£Δ6n}* 7+" 7**7#"*7+;!U* 7є* 7#" 7n&6n}ӕã**7#"*7+;6Õ >3u*;! s#r! !͐͞";x*;! s#6! *;}N!̐Q!ސ!!!4͐͘}2;x*;! s#6! !͐͞}2;x*;! s#6! !͐͞}2;x*;! s#6! !*͐͞}2;x*9*9&!D!!!9~#fo͡*C}x͕}29*9}2[;x*9*:&!S!!A!9~#fo͡*C}Sx͕}2:x*9*:&!T!!|!9~#fo͡*C}Žx͕}2:x*9*<;|ʪ*<;ñ**7;!!!/!!ϋ! 9~#fo͡* 7n}#!"<; *C} * 7**7;ͤ**7;"<;**7*<;ͧ#"*7x!;!F͞x*;! s#6! *;}R!TU!W!!!Y͐͘}2;xͪj^!Iͭ!9! !^Ͱ!i;!9ͳ^!Iͭ!:! !yͰ!j;!:ͳ^!Wͭ͡*C}'͕͒>S>_>U>ʡ>E>ʱ>V >>D,>э>P8>>XD>>QP>>F\>!*>;! s#6! *>;}~!Á!!!!X͐͘}2>;$!4:!͛$!6:!͛$!8:!ّ͛$!::!͛$!<:! ͛$!>:!"͛$**7;II͐n}-͐w#wI͐͐s#r**7#"*7+;6!9%o%oa:o-$!9DM*9͐͐~#fo!!C!!! 9~#fo[*C}§͐!* 7^%dݖðZÛ-$Ӂ^`:o*-$!9DM*9͐!!!F!! ! 9~#fo͐!! s#r! w#w!–|ʲ͐|ʲ! ^#Vr+s͐ڧ!!! Ŗ͐n}sç! ^#Vr+sn&!! Ȗ! ˖! Ζ;*%8|²і! w#w`i6`in}@Ԗ*C}ԗ@ז6n}=* 7+" 7!! ^#Vr+s!* 7ږ! ^#Vr+s͐"`i6=* 7#" 7n&6n}:"ԗþ͐|Lv! ^#Vr+s͐v!! ^#Vr+s6L!9%o%o!9DM`iw#w͐|ؘ͐! ^#Vr+sn&@s! ~#fo##s#r`i^#Vr+sÓ!9:o-$!9DM*9͐͐n&!!E!!! 9~#fo*C}0M`i!V* 7͐͐s!9%onCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. !@:!7͛$!B:!N͛$ͪҌ^! :!dͶ^!8!Ͷ*8g@}2;^!;!Ͷ*;g@}2;^!;!Ͷ^`i6`in}ʰ!H͏*C}£ð͕͒>C·>>LÎ>*>Vώ>:>Xێ>J>F>Z>E>j>I>z>. >ʊ>B>ʚê!:!ђ͛í!:!͛í!:!͛í!:!͛í!:!͛í!:!2͛í!#:!P͛í!+:!kͶí!,:!ͶíͪÈ^!%:!͛*%:" :^!':!͛*':" :^!;!͛^*7&@|g}o}27^*7&|g}o}27^*:! s#6! *:}8!͓;!Г!!!N͐͘}2:^ͪ!j;!:ͳ!i;!9ͳ*,:g@}2;*+:g@}2;!9tonot toclearing displaymaximum stack sizewith the number'swith the character'ssafety factor for characterssafety factor for numberssafety factor for variablesediting delaytonot toediting control charactersalternate editing control characterstonot tostart terminal underlinestop terminal underlinestart terminal emphasisedstop terminal<4#>Çhü7Ø%ï[h5Í4|Qf.fÁҞ!9DM*;|T*;!";!";!J ! s#r!3 w#w*F:}ʈ*F:!3 s#6! 6#6͐ **?ב͐ )7~#fo*F:&ɑ͐ !3 s#rב! ^#Vr+sÑ*8*8! s#r!6!6 !6 `is#r";! *;͐! 6*F:}1!6͐#! s! n&|R! 6! 6! w#w! n} |ʁ!% !-! !*G:͐!% !|Ҳ!-! 6! w#w͐! s#r͐͐|͐####! s#r*F:}͐3*8+! s#r͐#! s#r! w#w͐! s#r͐ ͐ҥ! ^#Vr+s͐ !*G:͐?͐!% ͐|Ғ͐ d-! 4! ^#Vr+s2! w#w͐*n8+͐! s#r͐͐͐͐?͐!# s#r͐ ͐#R!! w#w͐!|D*G:#|6!% !-!! ^#Vr+s ! ^#Vr+s!# ^#Vr+s͐ ͐#!! w#w͐!|*G:! s#r͐#|«!% !-͐!5 s*G:͐͐#?!5 n&#|!% !-!! ^#Vr+su)~#foͿ`i^#Vr+sӜ!";!!œ!9I]ã$5Ԥü!9DM͐*;|g}o|p!͐ |͐͐)͐ ͐:s#r͐ +|˝͐͐)͐ ͐=s#r͐ |͐͐)͐ ++͐@s#r͐͐)͐Cs#r͐͐)~#fo|<͐F!*;͐|g}o";!a6!9DM!͐͐^Ê>Q!9DM͐`is#r͐͐ɞ͐̈́*;͇`i^#Vr+sÜ!9؞6!9DM`iw#w͐|-͐*;|g}o|!!͐͐՞`i^#Vr+s!9<4!9DM͐͐*;|g}o|͝|g}o|}͐|}!*;͐}/o|/g|g}o";͐͐)~#fo9|Һ!!͟5h5!9DM͐|ğæ͐+++|!ǟæ͐##^#Vr+sz%͐^#Vr+sn&æ!͐͐~#foʟ`is#r!b͐##^#Vr+sæ͐##͐?+s#r͐͐s#r͐^#Vr+sn&æ!9ûf.Í40!9DM͐֠!͐##~#fo!͐##~#fo! ^#Vr+s]! ^#Vr+sȓ! ^#Vr+sí! w#w͐ ͐ځ*G:͐ ?!% ͐ #|s!1-! ^#Vr+s3! 6! w#w*n8?+! s#r͐! s#r͐ ͐! ^#Vr+s͐ !!͐!% ͐|!Z-! 4͐͐*G:͐)!% ~#fo!28! 6#6!"K*8}1f! ! s#r! ! s#r͐ )?~#fo! s#r! s#r͐|TèT! 6#6! 6! ! ͐͞S͐|.f! 6!͡S|6U!wf! n}qUʀU ʢYY ZZʕ[[_ʩde! ! s#re>28! n}V! ^#Vr+s|U! ̓̓! s#r)^?~#fo! s#r!ͤS͐|V̓̓͐?ͧSe! w#w͐++! s#r͐|GV̓͐?͐~#foͧS͐+|“V̓̓̓ͪS!8̓ͭS|ړV!ͰS!wf͐|ڟY!  w#w!8͐~#foͭS|X! ͐~#fo̓ͪS!8̓ͭS|V!V!! s_!8ͧSÍ_̓͐++~#fo͐~#foS+|͝<_!8?_!8ͧSÍ_̓͐++~#fo͐~#foS+|͝v_!8y_!8ͧSÍ_! w#wÍ_! n}ʽ_͐++̓s#r! ~#fos#r_! ^#Vr+se! ^#Vr+s̓! s#r)`7~#fo`is#r͐! !͉͐`!wf͐>,`>a>8`>*a>D`>Aa>P`>Xa>\`>oa>h`>ʆa>t`>ʝa> €`>ʴa> Œ`>a> ˜`>a> ¤`>a> °`>b>¼`>_b>`>ʞb>`>b>`>c>`>[c>`>rc>a>ʉc>a>d_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓S_d!9͐~#fo̓ͪS_d!9͐~#fo̓ͪS_d!8͐~#foͭS|Cb̓!8ͧS\b!9͐~#fo̓S_d͐~#fo͐++~#fo͐++++~#fo͐~#fo̓S_d͐~#fo͐++~#fo͐++++~#fo͐~#fo̓S_d͐~#fo͐++~#fo͐++++~#fo͐#r̓̓̓ͳS̓̓̓ͳS̓̓ͭS|^W!aW!!  s#r̓̓̓ ͧS̓̓ͶS̓̓ͶS̓̓ ̓!?ͶS̓!?̓ͭS|W!X!!  s#r͐|oX! ̓̓ ̓!?ͪS̓!?̓ͭS|oX! 6#6! ̓̓ ̓ͪS̓̓ͭS!  s#r̓̓͐)^?~#foͧS̓̓͐~#foͧS̓ |bY͐|3Y͐|3Y̓̓̓͹S_Y̓̓̓ͼS! ̓ͿSßY͐~#fo̓ͧS! w#w! 6͐! s#r! 6#6! 6e͐̓)^?~#fos#r͐~#fo|Y!wf! ^#Vr+se͐*;̓s#r! ^#Vr+se̓>Z>#Z> Z>dZýZ͐++~#fo!8̓ͳS͐++̓s#r! ~#fos#rýZ̓͐++~#fo###n&|g}o|ʎZ!8ÑZ!8ͧS͐++̓s#r! ~#fos#rýZe͐̓#! s#r! 6! ! ͐͞S!8͐++~#fo~#fo̓S_d͐~#fo͐++~#fo͐++++~#fo͐~#fo̓S_d͐~#fo̓S_d͐~#fo̓ͶS_d͐~#fo͐++~#fo̓S!9̓ͿS!9̓S! ̓S͐̓S͐~#fo̓ͿS͐++~#fo̓S_d!9͐~#fo̓ͪS!9̓S! ̓S͐̓S_d! ~#fo͐+)s#r͐̓s#r! ~#fos#r! ^#Vr+se̓)^?~#fo! s#rz$e*,7*7*;*L*;ѯgd!ͰS!wf̓)^?*L*,7s#r! s#r*,7",7͐++! s#r̓͐~#foͧS! w#w>28!% n}ʱe͐ ̓ڱe͐ ̓+ڱe!"͡S|ʓe!wf͐ !) ^#Vr+s̓T!% n}e̓#̓'͐̓!??̓ͧS! ^#Vr+s! n}+f! ^#Vr+s! n! s! ! ͐͞SUèT*K|Uf!ͰS! 6*:}Uf!wf! ^#Vr+sbT!% n}qfT!wf!91.e-70.050.5Ûf0h5Ôg!9DM͐*;! s#r͐|f͐|Hg͐! s#r!͐?*;͒f`is#rS|҆[! n}_[̓!8ͧS! ^#Vr+s̓s#r! ~#fos#r! ^#Vr+s͐! s#r! 6! ! ͐͞S! ^#Vr+se͐̓! s#r! 6! ! ͐͞Se! ^#Vr+s! 6̓>[>ʉ\>[>ʬ\>\>ʬ\>\>\>\>\>&\>]>2\>8]>>\>ʎ]> J\>]> V\>^>b\>V^>n\>ʴ^>z\>_>†\>H_Â_͐++~#fo͐~#fo̓ͼSÍ_͐~#fo͐++~#fo̓ͳSÍ_͐++~#fo͐~#fo̓ͪSÍ_͐~#fo͐++~#fo̓SÍ_͐~#fo͐++~#fo̓SÍ_͐++~#fo###n͐~#fo###nѯgW|g}o|g}o! s̓! n}ʂ]!8Å]!8ͧSÍ_͐++~#fo###n͐~#fo###nѯgW|g}o|g}o! s̓! n}]!8]!8ͧSÍ_̓͐~#fo͐++~#foͭS|ͩ^!8^!8ͧSÍ_̓͐++~#fo͐~#foͭS|ͩJ^!8M^!8ͧSÍ_̓͐~#fo͐++~#foͭS|ͩڢ^͐++~#fo͐~#foS|ͣʨ^!8ë^!8ͧSÍ_̓͐~#fo͐++~#foͭS|ͯ^͐++~#fo͐~#foS|ͣ_!8#|!g!!]G*;͕f`is#r͐+++|;g!͘f!Ëg͐";͐*;! s#r͐ ͐]Gns͐ ͐)G~#fos#r!Ëg!9ÝgéÄ!9DM*8`is#r͐";>"2A;͗g͐}2A;͚g!9g"$!p#×!9DM͐͐`ig͐! g͐! g! ! g`i`ig!8`ig|Mh!~h! `ig!9`ig|xh!~h~h!~h!9Óh 0jR !9DM͊h*:}ʻh!͍h!h͐h!! Execution aborted by user BREAK. h"×I!9DM`i! s#r! ! s#r͐͐͐ h͐͐͐ h͐ ͐ h͐͐ h͐ ͐͐h!9Ëiþ !C͈ißiÔg=.!9DM͐n&|g}o|i*;͐n&|g}o͐#nѯg͐n&@|g}o|j!8͐n}#j͐#n&)^?~#fo!͙i͜i9jæjn!9DM͐)8~#fo`is#r͐|`jÝj*}8&@|g}o}2}8͐8n&͐3j6j*}8&?|g}o}2}8!9jG'-$[mN$nèmmÊ !9DM! ~#fo`is#r! n&|g}o|l!:4͐n&6n}q! ^#Vr+s͐ ͐ Jnѯg;s! q! ^#Vr+sst!t!Hq>2HH`is#r:! s#r͐)qJ~#fo|ʉs͐)qJ~#fo! s#rsI! s#r͐ Jn! s#6͐! s#r*>;}Et͐n}Et! ^#Vr+sn}\Bt! ^#Vr+s! ^#Vr+sn! s{\t! ^#Vr+s! n&q|Bt͐n&q|Bt! ^#Vr+s! ^#Vr+stùs͐ H6͐͐͐q͐͐͐q!Hq! s#r͐ ͐ Ұt͐ H͐ Hq͐ H6*>;&͐qt!9%stq[m!9DM͐ ?n}tv͐ )r?~#fon}S(u͐ ͐ ͐tv͐ )r?~#fo! s#r͐ Dn&+)##`is#r͐͐n&?|g}o?͐͐#nѯg`is#r*;}ʟu*;͐çu͐;! s#r`iw#w͐͐  Jnѯgv͐n}u! ^#Vr+sn&tu! t`i^#Vr+sõu!9v$-$!9DM͐T!Iv`iv͐V!Pv`iv!P9%12.0f%dtvp0jzÙ(W|#Ò|$nÔg!9DM*t8|ڞv*7&|g}o|ʞvVv!Yv*7}ʶv͐#ûv*:&\v!Yv`i6#6! s#r! s! s#6*:! s#6͐*:ѯgl͐n}\l`i^#Vr+sn&ͩj|ʒk! !m͐ͬj͐! s*}8&@|g}o}2}8! n&ͯj*}8&?|g}o}2}8`i^#Vr+sn&ͩj|ʌkrkjÿl*}8&@|g}o}2}8͐n&Ͳj>n¼k>l>fk>"l>wk>-l>uk>Sl>ek>fl>vk>yl>dl>ʌl>\l>ʟlêl*:}l͵jíl! ͯjíl! w#w͐|Pl! ^#Vr+s5líl*4:͸j*<:ͻjíl*6:͸j*>:ͻjíl*8:͸j*@:ͻjíl*::͸j*B:ͻjíl!\ͯjíl;j*}8&?|g}o}2}8l͐n&ͯj`i^#Vr+sj!:5͐n} m͐n} m͐n&ͯj`i^#Vr+sl!9%d mÛ !9DM*{8}Vm͐|g}o!!!!mmgmmJ 5n!9DM! n&^m*|8}ʚm! n} ʚm! n&am! n&dmîmJ !9DM*|8}m͐|m͐n}m! ^#Vr+sn&ͫmmm5nm!9DM͐|3n͐n}3n͐n&m! ^#Vr+sn&mn>nØ%Ôg!9DM*}8&|g}o|n*}8&|g}o|ʧn*}8&@|g}o|§n*7! n&|g}o8n#|§n!;nïn[m!9DM*|8`is>2|8! ͬn`in}2|8!9n[ménp*t8#"t8*?;}n! n*Җx͐*:ѯg#! s#r͐)7~#fo! s#rbv! s#r_v! s#r! s#r͐?n! s#r!|sx! 6͐ |ڐw! 6>|2H> 2H͐|ڭw͐  J͐s͐  Jn͐ #! nѯgw͐  J͐ #! nѯgs! ~#fo͐  Jnѯgs#r͐*p8x! 6Öx͐ )qJ͐)?~#fos#r͐! n&Hev͐  Jn&͐! nѯghvÈx͐  J! s#rs! ^#Vr+sv*7}x> 2 J!z"sJ!z!Hkv! ! hv* J! s#6! n}Wz͐~#fo#! s#r͐͐Wz`i^#Vr+s͐)7~#fo! s#rbv_v! s#r! s#r͐?n! s#r!|0z͐ |ny͐~#fo J͐ s͐~#fo Jn͐ ##ҡy͐~#fo J͐ ##s͐~#fo)qJ͐)?~#fos#r! ~#fo͐~#fo Jnѯgs#r͐*p8y! 6Wz͐bv!z!Hkv͐~#fo Jn&͐##hv>z͐~#fo J6͐^#Vr+s! ^#Vr+sxnv! n}‚z͐͐s#r!Yv!&z͐|ҧz͐}28!qv!&z͐͐+s#r!Yv!&z!9%8.4fProbability| %szÙ(W|nÍqt[m!9t8*:o*:} o! n#on*t8*:*:ѯg?onMoæjon!9DM*t8͐goo͐)8~#fo`is#r*}8&@|g}o}2}8͐|o͐8n&͐Do*t8+|ºoGoýoJoo*t8+|oGo*}8&?|g}o}2}8!9o$ÍqénJ R Åi*}8&@|g}o}2}8*z8}1p*x8!p!Ho!Ho*z8}Ap*8|Npo*t8#"t8fp*|8}fp*d:|fp*t8#"t8*|8}•p*d:|ʂp!oÊp!poo*):o*}8&?|g}o}2}8 PAGE %d Type RETURN to continue:p[mAo!9DM*}8&@|g}o}2}8*8`is#r*:8|ͩq*:q!! s#r͐|Pq*t8#"t8͐Bq! p$q͐!p! p!"t8*x8#"x8!!p*}8&?|g}o}2}8!9Óqæj!9DM!͐͐q!9DM͐͐q͐6 ! ^#Vr+sóqq v[m#G'$Ù(ëqæj!9DM͐?n}rt͐?n&|g}o|>s! ͐q͐ ͐ Jnѯg_r͐ Jn! s#6! 6*͐)qJ~#fo|ʋr͐)qJ~#fon! s͐?n&|g}o|ʪr! ñr! n&! s! 6#6͐ ͐ r! n&q! ^#Vr+sr͐ |s! n&DM! w#w! 6#6͐͐ 8|͐)7~#fo`is#r͐?n}*|͐zz! s#r͐)?~#fo"qJ͐)?~#fo|ʌ{͐?n&Ï{*r8}2 J! ~#fo! ~#fo* J&#s#rs#r͐*p8{z͐! s#r͐zz͐!͐)^?~#foz! z*8&|g}o|*|z! w#w! ^#Vr+s{*8&|g}o|N|z!9!9DM͐),?~#fo|ʁ|͐),?~#foÎ|͐)@?~#foÛ|ëqÍq!9DM!J͐H͕|͐Hs{2J!H͘||#!9DM*:}|͐͐|͐͐|}["\Ip×þ!9DM͐!U:! }͐! `i͐}͐͐}͐͐}`i͐}!8͐}! 9æ}["\Ipþ!9DM͐!U:͐͗}͐͐`i! ͚}! ͐͐͗}͐`i͝}`i͐͠}!8͐ͣ}! 93~["\p×þ!9DM͐!U:͐$~͐͐! `i'~͐! ͐$~͐͐*~`i͐-~!8͐0~! 9~["û""p×̄Â!9DM͐!U:`iͳ~`i͐! Ͷ~͐!  6`i`i͠!8`i͐ ͣ!8͐ ͦ! n&|g}o! nѯg|g}o|a!8͐ ͩ!9|$!]þx!9DM͐ `im! s!9`i`ip! s! n&|g}os! n}ׇ! n}!9`is! n}! n} ! n&|g}os! n}#! n}3`i͐ v@`i͐ y! n}X!8͐ s!9s$!]þx!9DM͐ `id! s!9`i`ig! s! n&|g}os! n}Έ! n}ڈ!9`ij! n}! n}! n&|g}os! n}! n}*`i͐ m7`i͐ p! n}O!8͐ j!9|$!#ڎȌpþ̄ILx!!9DM͐`i[! s!8`i^|ڽ͐!tak!9`i͐d!9͐g!8`ij!8`i^|)`i! m!9! p! `is5`i!8v`i͐p! n}]!9͐yk!9͐j! 9ASIN or ACOSÐ$!Xpþ!9DM͐ `ḯ! s`i͐ ͇! n}ӊ!9͐ ͊!9͐ ͍!9$!#ڎIȌp͹~͐! ͼ~! ͐Ϳ~͐͐~`i! ~! ͐Ϳ~! 9hê"×!9DM͐ ͐͐_͐!8͐b͐͐eüË"̄ILû"!9DM͐!8͐ͭ͐͐Ͱ͐͐ͳ͐͐Ͷ͐!8͐͹$UP!9DM͐`i!͐G!9Vá!9DM͐`is#r͐|ҍ`i^#Vr+s6-͐! s#r! ͐`iS͐6͐ì!9Ӏ#7x!I×̄pL!9DM!8͐͸|͐!Hͻ?! ͐;! w#w! ͐;! w#w! !8͸|k!9! ! ~#fos#r1! !9͸|ҡ!9! Ā! ~#fods#rk! !:͸|ׁ!:! Ā! ~#fo s#rá! ! ǀ! ! ͐! ʀ!U:! ! ! ! ! ̀! ͐Ѐ!9PWRyË#7"êÛ-x!û" vI×p!9DM͐'O! s#r!9͐'R|ڽ͐%!ȄU!ÿ͐'!9!8`iXR|͐%[!ÿ!!`i^!9DM͐ `i!8`i|:͐ !}t`i`i!;9`i͐ !8͐ ͐ ͐ !9ATANÔ#Ë"̄x!Ȍ!9DM!8͐ ͅ|Ƌ!8͐ ͅ|!8͐ `i͈`i͐ ͋`i͐ ͎!8`i͐ ͑!9"!9DM͐͐͐@ê!9DM͐!h:͐=*K#"K **** Floating point error in %s. !9DM͐###n&|g}oðx!!9DM͐!8ͭԌêpI!9DM͐ n`is#6`i^#Vr+s͐ˌ͐?#! s#r͐|T͐ ͐͐Ό͐ ͐ь! ~#fos#r !9oû"I v"!9DM͐͐ `i`!9`ic! `if͐`ii͐`ic`i͐ ͐ l͐׍!9#7["Ȍp×!9DM!9͐ |!͐ !lc͐ ͐ `i!8`i͐ !8͐ ͐ ͐ !9TAN or CTANÇ["ȌpI!9DM͐ ͐ `i{!8`i͐ ~!8͐ ́͐ ͐ ̈́!9ê!9DM͐! ݎ͐͐|"͐'!8! X1! ͐'a!9! ! d! ! g͐|ڍ͐! j!9! m! ! p! ! g͐|ǃ͐! j! ! p`i!8a͐%!8a! w#w! ͐%R|P! ͐%a! ^#Vr+s͐! j! `im! `is`i͐%v! ^#Vr+s!|v!9͐%mP! ^#Vr+s!|ڜ!9͐%mv͐|ʹ͐%!8͐%d!ÿ!!9EXP#7û"x!×Ȍpþ!9DM! s#r! s#r!8͐τ|.͐!T҄!K!8͐τ|ͩ`is{a͐!8! Մp! ͐؄!9! τ|ڣ!9! ۄ! ^#Vr+sp!9! τ|ͯ! s{Ӆ!9! ۄ!8! ބ!8! ͐! ^#Vr+sz!8͐! n}/!9͐`in}E!8͐!K! 9LOGa"Ñ!9DM!9͐ `i[`i͐ ^!9ì$!]#IȌpþ!9DM! 6͐ `i͔!9`i`i͗! s!9`i͚|!9`i͝!*K#"K Magnitude of argument to '%s' > 1. 6@.7:,*3:*X}|2q ʉ:qwz! {w7**DM:!**:Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. Ê R +J Åi=.$!9DM͐>3>~>?>ʌ>K>ʟ>W>ʵ>c>>o>>{>*E!G E!h!E!! E!! *8&@ !*E!6!Q!~!!*8&)@?~#fo!E!*7>2}8EDisk error on parsed equations. Function has the same sign at both ends of root finding interval. Out of memory. Please wait for promt to write model to disk. ** Floating point error(s). Type RETURN to continue, or '^' to abort:Internal error in getadr. All printing parallel control variables and onv!Î͐j#͐p?͐t'|:͐j͐p?͐t!n s#r!!l s#r*G:͐v6#|`i6#6W͐n͐l?!t s#r*G:*G:͐l?͐a!r s#r{͐ ͐ ͐a!i n&*G:͐e͐ *D:3!9|{!Î!a ^#Vr+sݒ*:}ʙ!Ȟ*:}͐j#͐p?͐t*G:͐v6#|`i6#6W͐v9#|`i6#6W*8*8! s#r*:}t!<`is#r*;|D*;|D!![;?";*;#|e!B͐|e`i6M#6͐|qW*G:!' s#r! w#w͐͐͐'͐͐e??!_ s#r! |̙!Î*I!͐e͐_E! ^#Vr+sÇ͐e!Q K!Q !9!V N*8! s#r! 6#6!" w#w*:}B!*:}}!͐~?!v s#r͐v#|t`i6#6W! 6#6͐*8G͐! s#r͐ ! s#r! *8*8! Q|ٚ*:}Ӛ͐v!Î! w#w! |*:}͐v!Î͐#!L K!Q !L !L N!V !L !L **:}[!L !8!L *H" J!L !* JT* J&H6e Left Hand Side variable must fit in one output line. Line width is to small for the format of: ''. Disk error, on file output. File output turned off. Type RETURN:* L}>{28{2L>W2KuCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. oU["#ҤR J Çh"Í4Öi#Ë""Ÿ̄ØSf.4$5Ôg|û"Sv$Íq0h5qn0jݢ!r9DM{2L! s#6! s#r`is#r*8! s#r!!) !!B !) !) !. *n8!e s#r*8*8!g s#r͐g?!p s#r!c 6X#6!a w#w͐a͐gV!c ~#fo͐e?s#rzHV!a ^#Vr+s*F:}g͐c|o>2:t>2:!! !~ s#r ͐~*:s*:}ʮ͐~ !v s#r͐v#|»W!t w#w!r 6#6*7!i s!a w#w͐a͐e҉*:}ʃ!͐ad!$ s!0͐a!$ n&d? !% s!0͐a!$ n&d?!% n& ?0! * JW͐"! s#r͐"oJ͐#! s#r͐ ͐͐ )7~#fo! s#r*:}ʞ͐ *8+! s#r*F:}!!x *G:͐)͐!x s#r͐x͐??!z s#r͐x͐?͐?!| s#r!z ~#fo͐|s#r͐z͐! s#r͐|͐|ͯȜ͐˜!!x s#r͐|͐|͐x|Y!͐z! s#r͐vZ#|-͐v`i6#6W!*G:͐v]!x ~#fos#r! |}*:}w͐v!Î͐*oJ*G:͐x`! |*:}ʼ͐v!Î͐*oJ͐'͐͐e?͐?`! ^#Vr+s*oJ#"oJ! ^#Vr+sèc͐f! s#r!|͐!" s#r!i}*D:+"D:! 6#6*:}h͐v͐|‡͐|ڇ͐l͐Î!932768.0-2.X:monte0.$$$ Monte Carlo trial: 0. Monte Carlo sort. %8.4f 4.["Ë"û"!9DM!%`is#r͐͐ (͐ ͐ ͐ +!%`is#r͐*8#!c s#r͐c*8! |“*:}ʼ͐v!Î!) !3 ͐c)7~#fo)^?~#fo![ s#r͐[!_ s#r͐_n! s#6! ~#fo!_ ^#Vr+sn&+s#r!_ ^#Vr+sn!& s!_ ^#Vr+sn! s#6!_ ^#Vr+s!Ş!G !!8 ͐_!!_ ~#fo͐)s#r!3 !8 $|E͐͐_*L#E!!G !8 !_ ^#Vr+sn!& s!_ ^#Vr+sn! s#6͐_!!8 !8 '!_ ~#fo͐)s#rå!_ ~#fo͐)s#r!] s#r͐]####!_ s#r͐]n}UʑNEi!) !3 ͐_!͐_##!!8 *!3 !8 !8 !8 ͐_!͐['!) != -͐|+͐_##!!= != ͐|R͐_!!= != '!͐[!= !) !3 !3 !8 0!8 !8!8 *͐|Ė!8 ͐_##!!8 ͐|͐_!!8 !8 '!͐[!8 !c ^#Vr+sÏ*:}=͐a͐r!j s#r͐ ͐ !!i n&*G:͐j+͐p?͐t!͐ *D:3!9|Ž! (͐ ! ͐ .͐ ͐ ͐ 1!9x!."["Ë""̄û"L!9DM*L}͐*L&}2L&>ş! !8ş! !8ş!ȟ! s#r>2L*L&|ڠ͐*L&>! s#r˟͐͐`iΟ! `i! џ͐|g}o|ʸ͐!8͐ԟ͐! s#r*L&}2LB! w#w͐|͐`i˟`i! ! Ο! ^#Vr+s! ! ן! !9! Ο! !8! Ο! ! ! ڟ! ! ן! !9! Ο! ! ݟ>2L*L&|ݡ! *L&>*L&>Ο*L&}2Là>2L͐*L&>ş!9!9DM͐|&! ^#Vr+sԢ͐*n8+ - Sort ordering (< smallest first, > largest first.)\n +- - Probability printing (+ increasing, - decreasing.)\n\g\## evious line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## \#604 \f CONTROL VARIABLE SPECIFICATION REFERENCE SECTION\n \n There are three ways of specifying values of a CONTROL variable:\n Listing the values out (L),\n Giving an initial value, percentage change,\n and a bound (%%),\n Giving an initial value, an increment, and\n a bound (I).\n Several of these methods can be used together. Here is an example.\n L,1,2,4,3.4,7,\%,6,10,8,I,6,2,12#\n The values taken on by the variable will be:\n 1,2,4,3.4,7,6,6.6,7.26,7.9- Mark beginning of line segment\n ^%c|%c - Mark end of line segment\n (When a segment is marked it is displayed and the original line is displayed underneath to allow further editing)\n ^%c|%c - Copy marked segment to cursor position\n (This works across lines and Menu sections.)\n ^%c|%c - Delete entire line\n ^%c|%c - Stop editing\n ^%c|%c - Move to far left end of line\n ^%c|%c - Move to far right end of line\n \n EDITING PREVIOUS LINE, RESTORING CURRENT LINE\n \n ^%c - retrieves the previous line. It can also retrieve last used file name. Responses to error conditions are not retrieved.\n ^%c - rewrites the current line on the line below. (This can be used to make more space if part of the current line is a prompt.) It will also display the editing reference card if the message level is 7 or higher.\n \n BREAK AND STOP CHARACTERS\n \n ^%c - Break. Discards output and interrupts current processing.\n ^%c - Stop output. Stops output until some other character is typed86,6,8,10,12\n The values specified may be given by constants or by variables. In the latter case the variable name must be preceded by an '*'. A CONTROL variable can range over a list of labels or names. Rows and table segments can thus be labeled. Usually this is done by specifying the string variable to be parallel with another CONTROL variable. Here is an example:\n S,Mary,Sue,Jane,*,L,1,2,3#\n In this example '*' terminates the list of strings. The variable itself will be printed out as:\n Mary,Sue,Jane,1,2,3\n and the values it will take if used in an expression are: 0,0,0,1,2,3.\n \g \#605 \f PROBABILITY VARIABLE SPECIFICATION REFERENCE SECTION\n \n Probability values can be take from uniform (U) normal (N) and exponential (E) distributions.\n U,.7,100:1000,U,.3,1000:2000000#\n Indicates that there is a .7 or 70%% probability that the parameter lies in the range 100 to 1000 and a 30%% probability that it lies between 1000 and two million. The formats for specifying the other two .\n (Typing anything but '^O' resumes output.)\n \n MULTILINE EDITING\n \n Editing multiline entries is supported. A multiline edit is terminated with '#' or a blank line. The blank line aborts the edit and restores the previous entry. There is a limit of about 350 characters for multiline edits. Longer lines will be truncated and an error message displayed.\n \g\##\## obCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED.  \#702 \f EQUATIONS REFERENCE SECTION\n \n Equations are written in algebraic notation with '+-*\^' representing addition subtraction multiplication division and exponentiation ('a^b' is 'a' raised to the 'b'th power). Subexpressions can be grouped using the three bracket pairs '()', '[]' and '{}'. A bracket from any pair can only match the other bracket from the same pair.\n \n CONDITIONAL EXPRESSIONS\nConditional expressions are written as:\n x1 ? x2 : x3\n The variable 'x1' is true if it is gdistributions are:\n N,p,mean,deviation - Normal distribution and\n E,p,a,b - Exponential distribution with probability(x)=b*exp((x-a)/b).\n Values can be specified as constants or variable names preceded by an '*'. The 'p' value specifies the probability of each segment of a compound distribution. It must be a constant. The sum of all 'p' values must be 1.\n\g \#611\f EDITING REFERENCE SECTION\n \n Except during model execution all input is done with full line editing capabilities. The key codes for editing can be changed to resemble those of most editors or word processors. Two different codes can be provided for each function and thus for example the codes for both CP/M and a word processor can be supported simultaneously. The initial settings for control codes are shown below. The character '|' separates optional codes for the same function.\n\n ^%c|%c - Non destructive move left\n ^%c|%c - Non destructive move right\n ^%c|%c - Delete cursor position\n ^%c|%c - Delete left\n ^%c|%c reater than 0 and false otherwise. If x1 is true the value of the subexpression will be x2 and x3 otherwise. If the ': x3' part is left out x3 is assumed to be 0.\n \n The relational operators supported are:\n \n < less than > greater than\n <= less than or equal >= greater than or equal\n == logical equality != logical inequality\n \n (a and b are "equal" if ABS(a-b)/(ABS(a)+ABS(b))<.5e-7)\n \n Logical operators supported are:\n \n & and\n| or\n! logical negation\n \n FUNCTIONS\n ABS absolute value\n SQRT square root\n EXP exponential base e\n LOG natural logarithm\n LOG1PX natural logarithm of 1 plus x (more accurate if x is slightly larger than 1)\n INT integer portion of a value\n REMAIN(A,B) remainder of A divided by B. A and B need not be integers but if they are this is the Modulo function.\n Trigonometric functions: SIN COS TAN CTAN\n Inverse trigonometric functions: ASIN ACOS ATAN\n The above compute in radians. To convert radians to degrees and degrees se an arithmetic fault. The equation states that the future value of the loan is 0 at the end of 360 payments.\n The answer is r=11.16 %%.\n \n EQUATION SIZE\n Multi line equations are permitted. Each equation can have no more then approximately 85 tokens where a token is a variable, operator, or function name. If an expression is too long an error message will be displayed.\n\g\##\## g (+ increasing, - decreasing.)\n\g\## evious line ^%c; Retype ^%c; Break ^%c; Stop ^%c.\n\##\## \#803 \f VARIABLE DECLARATION REFERENCE SECTION\n \n The value of variables can be given explicitly (CONTROL), specified by an equation (LEFT HAND SIDE) or taken from a probability distribution (PROBABILITY). Variables need not be declared explicitly. Certain options require that declarations be explicitly entered or edited. These include initialization, parallel CONTROL variables, output formats for individual variables, and plotted output.\n \nFORMAT SPECIFICATIONS\n Model Builder supports the 'to radians the functions 'DEG' and 'RAD' are provided.\n Pi can be written as RAD(180). Financial functions include:\n FVAL(n,i,pv,pmt) Future value\n PVAL(n,i,pmt,fv) Present value\n PMT(n,i,pv,fv) Payment\n NPMT(i,pv,pmt,fv) Number of payments\n In the above four functions 'i' is the interest rate per PAYMENT PERIOD. If payments are made and compounded monthly it would be the loan interest rate divided by 12. 'pv' is the face value of the original loan or investment. 'pmt' is the periodic payment. To compute the effect of compound interest on a fixed investment 'pmt' should be set to 0. For a simple loan 'pmt' should be negative, i. e. subtracted from the current balance. 'fv' is the future value at the end of the 'n' time periods. For a fully amortized loan 'fv' is 0. For other loans 'fv' is the "balloon payment" due at the end of the loan.\n Example: compute the balloon payment ('bp') due at the end of a $40,000 loan with 15%% annual rate for 7 years with monthly payments of $450.e' and 'f' formats of the 'C' language and allows one to print alphabetic labels with output values. The printed reference manual contains a discussion of general formats and a number of examples in addition to the ones given here. The default format is '%%15.4f' which prints four decimal places. You can avoid learning about formats altogether if the file of named formats provided is adequate. You may also define your own named formats. These can be made part of a SAVE file. Format examples:\n Printing dollar amounts under 10,000,000\n loan,c,w12f%%12.2f\n Prints as: 8956.22\n payment,l,w13f$%%12.2f\n Prints as:$ 8956.22\n \n Printing integer values under 10,000,000\n count,l,w12%%12.0f\n Prints as: 8956.\n \n Specifying a width of 255 ('w255') causes a variable not to be printed.\n \n INITIALIZERS\n The sum of the values that a particular variable takes on may be computed. This and more general calculations of this type can be performed using initializers.\n For example:\n \n bp=FVAL(7*12,15/12,40000,-450)#\n \n EQUATION SOLVER\n The next capability can be used to solve for interest and in general to solve algebraic equations, that is to find the value of 'x' such that\n 'exp1(x)=exp2(x)' where 'exp1' and 'exp2' are expressions containing 'x'. A numerical root finder is used. The general form for using this capability is:\n ?x[begin:end]exp1(x)=exp2(x)#\n 'x' is the variable to be solved for. 'exp1' and 'exp2' are expressions containing 'x'. 'begin' and 'end' represent endpoints of an interval such that\n 'exp1(x) - exp2(x)' has opposite algebraic signs at\n 'x=begin' and 'x=end'. 'begin' and 'end' must be constants.\n Example: Assume the payments on a fully amortized 30 year loan for $140,000 are $1350 per month. What is the interest rate 'r'?\n \n ?rmonth[.000001:10]0=FVAL(30*12,rmonth,140000,-1350)#\n r=rmonth*12#\n \n The bounds for the root finding are .000001 percent per month and 10 percent per month. We cannot use 0 as a bound because this would cau sum_of_payments,l,i 0.0 @loan_amount\n declares that the variable 'sum_of_payments' is to be set to 0 whenever the CONTROL variable loan_amount is changed. If the model included the equation:\n sum_of_payments=sum_of_payments+payment#\n Then 'sum_of_payments' would be the sum of values 'payments' took on since 'loan_amount' was changed. The value initialized to can be a variable or constant. Initializers occur after the type specification and before the format specification.\n \n PARALLEL CONTROL VARIABLES\n If two or more CONTROL variables are declared then the equations will be evaluated at all possible combinations of all CONTROL variable values. However, if CONTROL variable 'b' is declared to be parallel with 'a' then the values of 'b' will be changed in parallel with those of 'a'. Assume 'a' is specified as taking on the values: 1,2,3 and 'b' the values 12, 13. In the absence of a parallel declaration the values (a,b) will take on are (1,12),(1,13),(2,12),(2,13),(3,12),(3,13). With ' HELP! GET ME OUT OF HERE\n If you are confused type:\n '^X RETURN'\n '^X' clears the current line. Entering a blank line does not change anything. Entering it repeatedly will get back to the Main Menu.\n \n MODEL BUILDER PROMPT\n When Model Builder is ready to accept input it terminates a line with the prompt character ':'. If you start typing before the prompt the buzzer may be sounded. In editing the prompt will be followed by a summary of the editing key codes (if the messages level is 7 or higher) and by the line to be edited.\n \n PAGES\n Various messages have page boundaries. At these 'Type RETURN for next page:' or 'Type RETURN to continue:' is printed.\n Model Builder can be configured to sound the buzzer instead of typing. When RETURN is typed the screen is cleared for the next page.\n \n BREAK CHARACTER\n While reading a file, executing a model or in the middle of a long message you can abort by typing: '^C'. You may have to do this several times before it takes effect.\n \n a' declared parallel with 'b' the values of (a,b) will be: (1,12), (2,13).\n \n GENERAL VARIABLE ENTRY FORMS ARE:\n name,C,P@variable,FIELD\n name,P,FIELD\n name,L,I,value@variable,FIELD\n Everything but 'name,(C,P, or L)' is optional. C,P or L may be followed by ',A,alias_name'. The 'alias_name' will be used for model execution output only. Variables can be up to 30 characters long. They must begin with an alphabetic character including '_'. The remaining characters can be alphabetic or numeric.\n FIELD is *name where 'name' is a named format. An explicit format may be given instead. It is of the form 'WnFformat or WnH? or WnP?'. The 'P@' option specifies a parallel CONTROL variable. The 'I,value@variable' option specifys that a LEFT HAND SIDE variable is to be initialized to 'value' whenever CONTROL variable 'variable' is changed. 'value' can be a variable or a constant. A variable can be plotted as a bar chart or scatter plot. 'WnH?' specifys a bar chart or histogram plot and 'WnP?' speciMESSAGE LEVELS\n The message level can be set in most menus.\n LEVEL 9 is used to read the reference manual for a section from within that section. LEVEL 7 provides an explanation prior to major menus and also provides on-line reference cards. This is the best level for novice users.\n LEVEL 5 is best for use with display terminals.\n LEVEL 3 is suitable for hard copy or very slow terminals.\n \n One way to get started is read the reference manuals by using the menu options in this section. Don't try to memorize or even understand everything, but get a general idea of what's available. Then do an example using the Main Menu 'S' option. A series of tutorial examples of increasing complexity are included in the printed reference manual.\n\g \#902\fMODEL BUILDER REFERENCE MANUAL\n \n H - HELP for NEW USERS and General Introduction\n V - Variable Declaration\n E - Equations\n C - Control Variable Specification\n P - Probability Variable Specification\n G - Global Formats and Options\n fys a scatter plot. 'n' is a positive integer less than 255. '?' is the character to use for plotting.\n For example:\ninterest_rate,c,w200hf+\n specifies that variable 'interest_rate' is to be plotted in a 200 character wide field using the character '+'.\n\g\##\## oken is a variable, operator, or function name. If an expression is too long an error message will be displayeCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. \#901 \f WELCOME TO MODEL BUILDER!\n \n THINGS TO BE AWARE OF AS YOU START\n \n CONTROL CHARACTERS\n In all documentation '^?' stands for holding the Control key down and typing the character '?', where '?' is a single character.\n \n UPPER AND LOWER CASE CHARACTERS\n Commands can be in upper or lower case. For variables and labels upper and lower case are different. Thus the variable 'cost' is different from 'COST'.\n \n ENTERING INPUT\n Input will not be processed until RETURN is typed.\n \nO - Output Ordering and Consistency Checking\n M - Model Execution\n R - Editing\n L - Change message level\n X?? Do MAIN MENU option '??'\n \n Your selection: \#910 \f MODEL EXECUTION REFERENCE SECTION\n \n During model execution data output is formated by different and simpler code then that which controls terminal output elsewhere. Error messages are short and not formated to page width or height. This is necessary because of memory limitations. Model execution can be aborted by typing the break character '^C'. It may be necessary to do this more than once before the abort occurs. Monte Carlo simulations with a reference variable and all large Monte Carlo simulations use disk storage. If sufficient disk space is not available execution may be aborted half way through. The Monte Carlo trial currently being computed is shown. This aids in estimating execution time. If an arithmetic fault occurs you may optionally continue execution. Be aware that not all arithmetic faults are detec A1 MDLA1X1 MDL A1X2 MDLA1X3 MDL A1X4 MDLA1X6X1 MDL-A1X6X2 MDLA2X1 MDL"A2X2 MDL'A2X4 MDL4ADDS CNFADM3A CNFAPPLE CNFB1X6X1 MDL8B1X6X2 MDLCNFG COMDIAB630 CNFEPSMX CNFFORMAT MDLHAZEL CNFKAYPRO CNFOSBORNE CNFPRNTR CNFREAD ME =hTERMNL CNF V A x,L b,L c,L E A x=1.25# b=x*x# c=x*x*x# G CHWFSBZNEJ>- 20 2 52 15 %15.4f 24 ted. If you run out of disk space in writing output to a disk file you can continue execution but disk output will be turned off until turned on in the GLOBAL FORMAT section.\n\g\##\## to be plotted in a 200 character wide field using the character Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. G ZH 80 55 T W 52 H 24 X C / I C S H S E B M B O B A # W 800 B C C 32 E 23 4 7 37 2 5 26 30 15 1 6 0 A 23 14 13 10 2 5 26 30 12 1 6 0 U S C U 33 154 E 33 155 V 33 51 D 33 50 P 33 137 1 X 33 137 200 Q 33 64 F 33 65 P 33 L C 33 127 L 10 33 127 V 101 X 122 33 124 F 122 E 122 120 I 33 121 127 124 . 22 B 20 F 14 B 10 X 33 124 K 3 O 17 33 50 P 33 137 1 XCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. S a volume=height*RAD(180)*diameter*diameter/4# gallons=volume*12*12*12/272.42# fill_cost=volume*1.25/100# wcc=gallons*[30/(8*16)]*(3*3.5)/10000.# a L,3,5,8,12,16# l,6,10,20# d b:swim.mdl ږ͐)7~#fo! s#r)ACopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. GG A dollar $%9.2f 10 A per_cent %6.1f %% 8 A integer %6.0f 6 V A INTEREST_RATE,C,*per_cent YEARS_OF_LOAN,C,*integer PER_CENT_PRINCIPAL_REDUCTION,C,*per_cent LOAN,C,*dollar MONTHS,L,*integer FINAL_PAYMENT,L,*dollar PAYMENT,L,*dollar E A MONTHS=YEARS_OF_LOAN*12.# FINAL_PAYMENT=LOAN-LOAN*PER_CENT_PRINCIPAL_REDUCTION/ 100.# PAYMENT= -PMT(MONTHS,INTEREST_RATE/12,LOAN, FINAL_PAYMENT)# C A INTEREST_RATE:I, 12., 1., 16.# YEARS_OF_LOAN:I, 10., 5., 30.# PER_CENT_PRINCIPAL_REDUCTION:I, 0., 25., 100.# LOAN:I, 20000., 10000., 70000.# G CHWFSBZNEJ>- 20 2 52 15 %15.4f 24 * T ****************************************************  16.# YEARS_OF_LOAN:I, 10., 5., 30.# PER_CENT_Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. V A value,C interest,C,W10F%9.1f%% years,C,W4F%4.0f yearly,L daily,L E A yearly=value*(1.+interest/100.)^years# daily=value*(1.+interest/(100.*365))^(years* 365)# C A value:I, 1000., 1000., 5000.# interest:L, 10., 14., 18.# years:L, 1., 2., 5., 10., 50.# G CHWFSBZNEJ>- 20 2 52 15 $%12.2f 24 * X **************************************** 00.*365))^(years* 365)# C A value:I, 1000., 1000., 5000.# interest:L, 10., 14., 18.#Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. .0f profit,L,W12F $%10.2f E A new_sold=number>new_demand?new_demand:number# day_old=number-new_sold# old_sold=day_old>old_demand?old_demand:day_old# profit=new_sold*.2+old_sold*.1-number*.1+100# C A number:L, 5500.# P A new_demand:N, 1., 5000., 500.# old_demand:N, 1., 1000., 100.# G CHWFSBZNEJ>- 20 2 52 15 %15.4f 24 >old_demand?old_demand:day_old# profit=new_sold*.2+old_sold*.1-number*.1+100# C A number:L, 5500.# P A new_Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. GG A no_print %f 255 V A dum,C,*no_print x,C,*no_print an,C,P@x,*no_print xsum,L,I, 0.@dum,*no_print xsqsum,L,I, 0.@dum,*no_print n,L,I, 0.@dum,*no_print xmean,L S,L,*no_print sigma,L E A xsum=xsum+x# xsqsum=xsqsum+x*x# n=n+1# xmean=xsum/n# S=n>1?SQRT([xsqsum-2*xmean*xsum+xsum*xmean] /n)# sigma=S*{an<=10?an:1+.75/(n-1)}# C A dum:L, 1.# GG A no_print %f 255 V A dum,C,*no_print x,C,*no_print base,L,I, 1000000000.@dum xsum,L,I, 0.@dum,*no_print n,L,I, 0.@dum,*no_print mean,L,I, 0.@dum,*no_print scale,L E A base=base- 20 2 52 15 %15.4f 24  E A base=base- 100 5 52 15 %15.4f 24 .5, 95.5, 94.# G CHWFSBZNEJ>- 100 5 52 15 %15.4f 24 Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. V A wear_life,P catastrophe,P life,L,W8F%6.1f plot,L,W50H xwear_life,L cat,L E A life=wear_life>catastrophe?catastrophe:wear_life# plot=life/3# xwear_life=wear_life# cat=catastrophe# P A wear_life:N, 1., 100., 20.# catastrophe:E, 1., 0., 500.# G PHWFSBZNEJ>- 20 2 62 15 %15e 56 * P ++++Part Failure Model++++ he?cataCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED.  nt mean,L,I, 0.@dum,*no_print scale,L E A base=base- 20 2 52 12 $%9.2f 24 , 0.25, 3., 4.,U, 0.5, 4., Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. V A number,C,W6F%7.0f new_demand,P,W9F%8.0f old_demand,P,W9F%8.0f new_sold,L,W9F%8.0f day_old,L,W9F%8.0f old_sold,L,W9F%8V A dum,C,W255 x,P,W255 xsum,L,I, 0.@dum,W255 xsqsum,L,I, 0.@dum,W255 n,L,I, 0.@dum,W255 xmean,L S,L,W255 sigma,L E A xsum=xsum+x# xsqsum=xsqsum+x*x# n=n+1# xmean=xsum/n# S=n>1?SQRT([xsqsum-2*xmean*xsum+xsum*xmean] /n)# sigma=n>=11?S*{1+.75/(n-1)}# C A dum:L, 1.# P A x:N, 1., 100., 10.# G CHWFSBZNEJ<-Q 100 10 52 15 %15.4f 24 n ., 223., 123., 233., 33., 2332., 434., 122., 34., 56., 223., 23., 66., 234., 45.# an:L, 0., 1Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED.  Copyright 1985, All Rights Reserved Mountain Math Software P. O. Box 2124 Saratoga, CA 95070 WHAT IS MODEL BUILDER? MODEL BUILDER is a powerful tool for generating spread sheet tab CONFIGURING MODEL BUILDER FOR YOUR COMPUTER The version of Model Builder you have may be already config- ured for your computer. If not or if you wish to change some of the configuration options you can do so with the program CNFG.COM. This program allows you to define the control codes for editing, to input the screen control codes for your computer and set various other options. It is menu driven and self explanatory. It allows you to immediately test the control codes after you enter them. CNFG.COM may be supplied on a separate disk from the Model Builder files. If so make sure you put the disk with UCNF.COM in drive A and the disk with CNFG.COM in drive B. You start the confi- guration process by executing CNFG.COM. (Type 'B:CNFG'.) If your computer and/or printer are not among those in the menu select the les. It allow you to evaluate a set of equations over combina- tions of variable values. It is easier to construct such models with Model Builder than with conventional spread sheets. It is equally simple to evaluate a set of equations with variables taken from probability distributions. If a large number of trials are performed (100 to 1000) you can accurately estimate the probability of any likely outcome. As an example of how this facility can be used you can compute the probability of a given real return on investment based on assumptions about what inflation is likely to be. This technique of estimating the probability of an outcome by making many trials is known as Monte Carlo simulation. WHAT DOES THE DEMONSTRATION VERSION OF MODEL BUILDER DO? The demonstration version of Model Builder contained on this disk (or di 'None of the above' option. In this case you must consult the user's manual for your printer or computer to determine what the screen control or printer control codes are. When you have entered all the information required a file called MDLINIT.MDL will be created on drive A. The program CNFG.COM will then execute the program UCNF.COM. This latter program will read the file MDLINIT.MDL to initialize its tables as you requested. As part of this process it will warn you that it is being configured and you should type RETURN to get past this warn- ing. When it has finished reading MDLINIT.MDL it will tell you so and you must type RETURN to get pass this point. The Main Menu should then appear and the current code in memory will be properly configured. To make a permanent copy of this code do the following: 1. Exit sks) illustrates all of Model Builder's capabilities. The only differences between this version and the complete Model Builder program are the size of the largest model and the number of trials for Monte Carlo simulation. This version only supports models of 8 variables. (Full Model Builder supports 98 variables.) This version only allows Monte Carlo simulations of 20 trials. (Full Model Builder supports 1000 trials.) With all versions of Model Builder there is no limit on the number of values each CON- TROL variable can take on. You will find the demonstration version useful for many prob- lems. A number of examples are included with the demonstration ver- sion. Twenty trials is sufficient to demonstrate how Monte Carlo simulation works. However, 20 trials is not sufficient to get accu- rate probability estimates. using the '#' option. (Type '#'.) 2. Delete MDL.COM from drive A. (Type 'ERA MDL.COM'.) 3. Save the memory image. (Type 'SAVE 63 MDL.COM'.) Each of the above typed entries is terminated by the RETURN key. Now to execute the configured version of Model Builder type: 'MDL'. USING MODEL BUILDER All you need to do to use Model Builder is to enter equations and request that they be evaluated. To execute Model Builder put the disk containing MDL.COM in drive A. If a second disk is sup- plied put that disk in drive B. The on-line reference manual pro- vides a complete description of most of Model Builders capabili- ties. You may want to begin by selecting the 'E' option in the main menu and entering some equations. As long as all of the variables have values assigned by equations (occur on the lation, Headers A1X4.MDL Interest compounding Probability distributions A1X6X1.MDL Normal distribution A1X6X2.MDL Exponential distribution MONTE CARLO MODELS A2X1.MDL Uniform distribution, Inflation model Monte Carlo simulation A2X2.MDL Cookie Company profit A2X4.MDL Scientific notation Part failure COPYRIGHT AND COPY PROTECTION Model Builder is not copy protected. ALL VERSIONS OF MODEL BUILDER ARE COPYRIGHTED AND FULLY PROTECTED UNDER UNITED STATES AND INTERNATIONAL COPYRIGHT LAWS. The CP/M version of Model Builder was generated eft hand side of equations) before they are used (in the right hand side of other equations) this is all you need do. Select the Main Menu option 'M' and your model will be evaluated and a table of variable values displayed. If you wish to evaluate your model for many values of one or more variables you can do so by using CONTROL variables. This is most easily done by using a variable in the right hand side of an equation that is not defined with another equation. When you do this Model Builder will ask what type you want this variable to be. Respond with 'C' for CONTROL. After you have finished entering equations you must define the values of the CONTROL variables. This is done with Main Menu option 'C'. You can list out the values you want the variable to assume or use one of the other options as described in the on-liusing the BDS 'C' compiler. The copyright for the 'C' library routines included in the object code is owned by: Leor Zolman, BD Software, P. O. Box 9, Brighton Mass. 02135 (617 782- 0836). All other material included on this disk (or disks) is copy- right 1983, 1984 and 1985, Mountain Math Software, P. O. Box 2124, Saratoga Ca. 95070, (408 378-7165). Permission to copy the demons- tration version of Model Builder is hereby granted provided the following three conditions are met: 1. Copies of this disk cannot be sold or distributed for profit. However, nonprofit organizations such as user's groups may charge a nominal copy fee for copies of this demonstration disk (or disks). 2. NO modifications may be made to any of the executable files (ending in '.COM') or the overlay files (ending in ne reference manual. SAMPLE MODELS A number of sample models are included in this demonstration package. These models were created using Model Builder and written to disk with the 'W' Main Menu option. They may be read with the 'R' Main Menu option or the 'D' option as a tutorial aid to see how models are created. Once they have been read in they may be exe- cuted with the Main Menu 'M' option. DISK FILE FEATURE(S) INTRODUCED EXAMPLE A1.MDL Equation entry A1X1.MDL CONTROL variables Swimming pool costs A1X2.MDL Formated output and Swimming pool costs Aliases A1X3.MDL Financial functions, Loan payments Named formats, Global Format Options, Multi-line equ '.OVL') contained on this disk (or disks). The ONLY excep- tions to this are the modifications made automatically when using the configuration program as described above. Remov- ing or altering the copyright notices serial numbers or this file is explicitly prohibited. It is permitted to modify the sample models (files ending in '.MDL') and the message files (ending in '.MSG'). 3. Any copies of this disk (or disks) distributed to third parties must be complete including all files contained on this demonstration disk (or disks). THIS FILE MUST ALWAYS BE INCLUDED UNALTERED IN ANY DISTRIBUTED COPY OF THESE FILES. PURCHASING INFORMATION If you find this demonstration version of Model Builder useful youO ORDER MODEL BUILDER FOR UNIX. MOUNTAIN MATH SOFTWARE P. O. BOX 2124 SARATOGA, CA 95070 (408) 378-7165 Model Builder is a trademark of Mountain Math Software. CP/M, CP/M-80 and CP/M-86 are trademarks of Digital Research. Z80 is a trademark of Zilog Inc. Unix is a trademark of AT&T. All of the disk format names are trademarks of various companies. GG A no_print %f 255 A dollar $ %12.2f 15 A integer %15.0f 15 A exponent %e 15 <<<<<<<<<<<old_demand?old_demand:day_old# waste=day_old-old_sold# income=new_sold*.2+old_sold*.1# profit=income-numbeCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 25 curright 6 curclr 14 curdeol 33 113 begul 17 endul 16 begemp 17 endemp 16 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 10 11 13 37 24 27 26 30 1 6 20 22 3 17 12 tsize 80 24 ll entries in Model Builder are made with fulCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 14 curclr 32 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 10 11 13 37 24 27 26 30 1 6 20 22 3 17 NEC PC-8001A Osborne (SD) Actrix DEC VT180 Cromemco w/Int'l Term IBM PC CP/M Cromemco CDOS (SD) IBM PC-DOS 1.0 Cromemco CDOS (DD) IBM PC-DOS 2.0 Lobo Max-80 TI Professional CP/M Morrow MD2 TRS-80 I w/Omikron Kaypro II TRS-80 III w/Mem Merch Zenith Z90 TRS-80 IV CP/M + Heath Z100 CP/M LNW-80 Heath w/Magnolia Xerox 820 I (SD) Systel II CP/M Xerox 820 II (DD) SD = Single Density DD = Double Density NOTE: MODEL BUILDER WILL ONLY WORK UNDER CP/M-80 IT WILL NOT RUN UNDER CP/M-86 OR OTHER OPERATING SYSTEMS. PLEASE INQUIRE IF YOU WISH T 12 tsize 80 24 SUBFIG CRL>CNFG COMCNFG COMCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 34 curclr 33 52 curdeol 35 begul 17 endul 16 begemp 17 endemp 16 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 10 11 13 37 24 27 26 30 1 6 20 22 3 17 12 tsize 80 24 CNFG COMCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. psize 80 55 pbegul 33 105 pendul 33 122 pbegemp 33 127 pendemp 33 46 9DM! n&0ͯr'! n&9ͯ|'G'!Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. psize 80 55 pbegul 33 137 1 pendul 33 137 200 pbegemp 33 64 pendemp 33 65 CNFG COMn^#V# ~#fo^#& ~#fo!+!#!+!#!+!+}|z{|}|z7||7zZZ)|/g}/o#|͉k|/g}/o#ɯ2qZZk:q|/g}/o#|/g}/o#:q<2qqDM!xxGyO҃)v|͔`i|)Öxڷz/W{/_ѯzW{_=yOxGæ2qZZ͉M|}ȯ|g}o)|/g}/o#z/W{/_!9~#fo! ! ! ! ! ! !9~#A"s!`*"!"!Y">2>2>22!"!"!@"!" ʞ!F#x±~#±!b2r~# "2r+}|~#G:rx"2r+w# +6#!6#2w2x*s!>r<o&F=-` r'~h6!+`W?_!~7z?` :>ª@w#G.¶ww#?*>?w#> w#.7:77!a{   `OE!y6$ -7rBo&))T])))!yCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 20 curclr 33 34 curdeol 33 17 begul 33 37 endul 33 31 begemp 33 37 endemp 33 31 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 23 14 13 10 2 5 26 30 1 6 20 22 3 17 12 tsize 80 24 CNFG COMCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 14 curclr 32 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 10 11 13 37 24 27 26 30 1 6 20 22 3 17 12 tsize 80 24 SUBFIG CRL>CNFG COMCNFG COMCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 14 curclr 32 curdeol 33 124 curins 33 121 curat 33 127 begul 33 154 endul 33 155 begemp 33 51:@Š+:@ʭ"*@|!ʥ"#"@'-:@ʿ">2@Þ":@"13A*Đ8H4̐8")3A*Đ8E4̐84͐8>$2@>2@̓6######~+++#(0Ϳ7@.>̀.ʞ# :@H#%p'2@`#'-p'.4͜*]#04͐8̓*m#:@=2@p'#\.#̀.;(;(ͯ':@•#..w('$p'#:@.\.@.#̀.ͬ.¿#Ï#:@#Õ#G#͇-Õ#x..͇-.w(':@?2@$:O@>2O@*O*+4+2O@ͅ(:@($(0Ϳ7:@$:@•%:@$'-:O@Ž$͜*_$>67:@7û$*@|p$3͐8û$>67:@7>#7>67:@7û$*@"m@͜*²$>7:@7>*ÍdLL'2L M'MÎOO&P~PûdP Qd)f'R*VáYÁZÅvv4wZfêwwÔf#CBx!9DM͡*6#6!$ͤ!9$ͤ!R$ͤ!j$ͤ!$ͤͧ*6#6M>W>ʺ>c>>o>ʨ>{>4>‡>ʃ>“>ʐ>Ÿ>>«>\ > ·>a##ͪ|:*^#Vr+s!$ͤ!$ͤ!$ͤ!$ͤ!%ͤͭ! s#r*os͐#|+ *^#Vr+s:͐|7 :ko}Z}*6#6*,w#wM>j >ʵ >v >5 >‚ > endemp 33 50 keyc1 23 4 7 37 2 5 26 30 1 6 20 22 3 17 12 keyc2 23 14 13 10 2 5 26 30 1 6 20 22 3 17 12 tsize 53 24 Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. psize 80 55 rright 14 curclr 32 curdeol 33 124 curins 33 121 curat 33 127 begul 33 154 endul 33 155 begemp 33 51Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. curlef 10 curright 20 curclr 33 34 curdeol 33 17 begul 33 37 endul 33 31 begemp 33 37 endemp 33 31 keyc1 23 4 7 37 2 5 26 30 1 6 14 22 3 17 12 keyc2 10 20 177 32 2 5 26 30 1 11 20 22 3 17 12 tsize 80 24CNFG COMCopyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. *K͞+zz€'+FÎr ͖ 8{ Ăw#w#w^#V#*~#fo^#*~#fo^#V#*n^#*d >Ž >; >š >ʝ >¦ >a >² > !%%ͤ!L%ͤ!%ͤ!%ͤ!%ͤͧ#| *^#Vr+sk&Ͱ}Y *6#6 ͳ* s#rM #|5 !%Ͷ*$s#rM$|V *^#Vr+s! &Ͷ*&s#rM&|… !&ͤͭ! s#r!|- ! w#w͐| M$͹!>&͹M&͹!X&͹! ^#Vr+sé ͐#| ͧ#| *^#Vr+sͼ| *~#fo##s#r*^#Vr+s!r&Ϳ*(s#rM(n}i *(w#w M(| *,s#r*s#r *^#Vr+s!&Ͷ**s#rM*|¾ !&ͤͭ! s#r!|S ! w#w͐|! M(͹!&͹M*͹!&͹! ^#Vr+s ͐#|. ͧ#|: *^#Vr+sͼ|S *^#Vr+s*^#Vr+s!&ͤM!'ͤͧ#|  *^#Vr+s k}» *^#Vr+s ! !4'*+| ͐| ͐| !7'ͤ!T'ͤ  ͐*s#r*^#Vr+s!^'ͤM!'ͤͧ#|Z *^#Vr+s k}€ *s#r*,s#r 4!ìYou typed more than one character ͤ!before RETURN or a special function key that outputs more than one ͤ!,character. Please reenter this code. ͤ[͐|c͐|[͐|c*w#w`iw#w͐͐=͐*n͐ʶ͐*n͐1͐)*p~#fo͐!Control code ^%c is already used for %s. ͤ! Please reenter.ͤ*6#6`i^#Vr+slM|J[͐*͐sÛ!iÓNot a control character, please reenter. ͤ[á[!Not a control character, please reenter. ͤ! ^#Vr+s! ^#Vr+sÙM|:!! The new key codes are: ͤ!/S Type 'Y' if these are all correct:ͤͭ! s#r*os͐#|ˆ*^#Vr+s:ko&Ͱ}Yʝ:*!öTERMNL.CNF*s#r! w#w͐|͐! ^#Vr+sMM&͐#|&*^#Vr+s:*^#Vr+s!:y Model Builder allows you to specify how each output variable ͤ!! !'*͐|ڱ ͐| !'ͤ!'ͤ ͐*s#r*s#r*,s#r*^#Vr+sM| N M,#|:*!'*s#r! 6 #6͐|f͐! ^#Vr+sBMMÚko&*1|š:*^#Vr+s*6#6!'ͤ!'ͤ!*(ͤ!\(ͤ!(ͤ!(ͤ!(ͤͧ#|*6 #6*^#Vr+s:*s#r*s#r! w#w͐|C`iw#w͐͐5͐*n͐*n}*6#65͐*n͐*n}*6#65͐*n͐*n}*6#65͐*n͐*n})*6#65`i^#Vr+sI! ^#Vr+s6M|a! )ͤ*o6YÆ!2)ͤ!J)ͤͭ! s#r*osko}Y ! w#w͐|͐|Ҿ*6#6͐|!͐)*p~#fo!b)ͤ͐*n&@͐*n&@!)ͤ^͐*n&@͐*p)~#fo!)ͤ!)ͤ!dÇor type a special function kis formated. This format can include labeling information. ͤ! It may optionally contain special codes used to turn on and off ͤ!Vunderlining, emphasized printing and other special functions. ͤ!aÞThese special codes all begin with the single character '\' ͤ!Followed be a single character. If you wish the character '\' ͤ!to be used to enable these codes type 'Y':ͤͭ! s#r*os͐#|S*^#Vr+s:*ew#wko}Yu*e6#6*^#Vr+s!û The overlays for Model Builder are searched for ͤ!on the logged drive (usually A) and then on an ͤ!?optional drive. Please type the drive to use (defaults to B):ͤ! s#r*cs͐#|t*^#Vr+s:͐##|‚:*^#Vr+s! Please type the drive to use for message files (defaults to B):ͤ! s#r*ds͐#| *^#Vr+s:͐##|:!!$-UCNF.COM! s#rz!F\Can't open UCNF.COM. ͤ!gÐMessages must be on both ey or ͤ!control character that you want to use for this ͤ!function followed by RETURN:ͤ*6! s#r͐#|!! ~#fo++s#r͐|M͐*n! s#r*osk}!]ÀYou typed more than one character ͤ!before RETURN or a special function key that outputs more than one ͤ!character. Please reenter this code. ͤ! ^#Vr+s͐|ڤ͐|Ҥ*w#w`iw#w͐͐͐*n͐ʈ͐*n͐͐)*p~#fo͐@!Control code ^%c is already used for %s. ͤ!Please reenter this code. ͤ*6#6`i^#Vr+s>M|5! ^#Vr+s͐*͐s͐|[͐*n&@!wöType RETURN if you want to leave the alternate key code, ^%c, ͤ͐)*p~#fo!for %s unchanged. Otherwise type the new code ͤ!%followed by RETURN:ͤ! s#r͐#|M! ^#Vr+sá͐|y͐*n! s#r*osk}drives A and B ͤ!in the second stage of configuration. ͤò!! ss#r͐ !*͐ ͐?9! s#r*n&|o!4[Invalid configuration file 'UCNF.COM' ͤ! w#w͐|l͐?͐!Ô %x: ͤ`iw#w͐|͐͐*n&! %xͤ`i^#Vr+sà`iw#w͐|O͐͐*n! s#6͐|1͐|1:! 6.#6͐`i^#Vr+s! ! ~#fos#rhò͐*͐s!͐++͐ !*͐ *^#Vr+s! Please type the drive to use for Monte Carlo files (defaults to B):ͤ! s#r*bs͐#|@ *^#Vr+s:͐##|N :*^#Vr+s!b × You may specify all the disk drives on your system ͤ! and Model Builder will insure that all file names you ͤ! !use have a valid drive prefix before passing them on to ͤ!(!`!the system. This will avoid crashes due to referencing ͤ!k!ß!nonexistent disk drivare ^%c or ^%c. Type RETURN to leave the first unchanged The current code for %s is ^%c. Type RETURN to leave it unchanged:*x!! **s#r*s#r*s#r*s#r*s#r*s#r*s#r*s#r**s#r*(s#r*&s#r*$s#r*"s#r* s#r!O0*&s#r**s#r!V0*(s#r**s#r!_0**s#r**s#r!f0*,s#r**s#r!n0*.s#r**s#r!u0*0s#r**s#r!{0*2s#r**s#r!0*4s#r**s#r!0*6s#r* *s#r!0*8s#r*"*s#r!0*:s#r**ks#r*k*s#r!0*<s#r**ms#r*m*s#r!0*>s#r!0*@s#r!0*Bs#r*$*s#r!0*Ds#r*&*s#r!0*Fs#r*(* s#r!0*Hs#r*** s#r!0*ps#r*s*s!0*rs#r*6*6 !0*es. Don't use any separators. ͤ!!!For example if you have drives A and B type AB. ͤ!!"Now type RETURN or enter your disk drives:ͤͧ#|0"*^#Vr+s:! w#w*6͐*n},#͐*n&|¬"!v"ä"Only alphabetic drive designators are legal. ͤ,#͐*͐*n&Ͱs! ^#Vr+s!|)#!"#More than 26 disk drives not allowed. ͤ! ^#Vr+s,#A"͐*6͐*n}S#:*^#Vr+s*w#w!r#Ó#Type 'Y' if you wish the buzzer ͤ!#ò#to sound on errors:ͤͧ#|#*^#Vr+s:k&|#*6#6#:!$$UCNF! 9Model Builder Configuration Program Copyright (c) 1984 Mountain Math Software All Rights Reserved Type RETURN to continue: What printer do you have? A - Epson (MX compatible) B - Diablo 630 compatible Z - None of the above Type the code for your printer:If your printer supports underlining, italics or other ways of highlighting text, Model Buts#r*6*6 !0*vs#r*6*6! 1*xs#r*s*s!%1*zs#r*s*s!91*|s#r*s*s!M1*~s#r*s*s!Y1*s#r*s*s!z1*s#r*s*s!1*s#r*s*s!1*s#r*s*s!1*s#r*s*s!1*s#r*s*s!1*s#r* s*s*s*s*.6*.*/s#r**s#r!1*1s#r!1*3s#r*5w#w*6P#6*6#6*6P#6*67#6!1*es#r!1*gs#r!2*is#r!2*ks#r!2*ms#r!2*os#r!!2*qs#r*sw#wcurlefcurrightcurclrcurdeolcurinscuratbegulendulbegempendempkeyc1keyc2tsizepsizepbegulpendulpbegemppendempmove cursor leftmove cursor rightdelete at cursordelete leftmark beginning of segmentmark end of segmentcopy marked segmentdelete linemove cursor to beginning of linemove cilder can use them in model output. Type 'Y' if you know of such codes and wish to include them in this configuration:begin underliningend underliningTo test these codes now type 'Y':This should be underlined and this should not be! begin emphasized displayend emphasized displayTo test these codes now type 'Y':This should be emphasized and this should not be! Specify printer page width in characters (defaults to %d):%dPage width must be > 30 and < 32768. Specify your printer page length in lines (defaults to %d):%dPage length must be > 3 and < 32768. PRNTR.CNF All entries in Model Builder are made with full line editing capability. The key codes can be changed to any control character desired. If your terminal has special function keys that generate single character control codes you may use the function keys for editing. Type RETURN to see the default key codes.SAME CODE IS USE FOR TWO FUNCTIONS! Type 'Y' to change any of the above key codes: The current key codes for %s ursor to end of lineedit previous lineretype current linestop execution (break)suspend outputend editEPSMXDIAB630APPLEOSBORNEKAYPROHAZELADDSOSBORNEADM3Ao2ÍdLLL'MÎO[[&Pêw[\~P/\a\~\Û\ûd MP Qd)f'R!9DM!<*2!<*2!<*2!<*2!<*2!$=*2!0=*2!H=*2-2*s#r*osM#|2!*2!M>*2!>*2!>*2!>*2!"?*2!Y?*2!?*202#|w3!3><4>©3>r4>µ3>4>3>P5>3>ʡ5>3>a6>3>57>3>7> 3>ʬ8> 4>c9> 4>9> !4> :> -4>ʇ:>94>:;32* s#rM #|d4*w#w;*^#Vr+s!?62*s#rM|“4;*^#Vr+s92`iw#w͐|4<2`i^#Vr+sê402#|4;?2|4;!?62*s#rM|4;*^#Vr+s92! B2`iw#w͐|95E2`i^#Vr+s502#|E5;?2|P5;!@62*s#rM|q5;!>@*202#|tion for your computer or terminal for a table of screen control codes. As a minimum you must know the control codes to move the cursor left and right without changing the characters on the screen and the code or codes to clear the screen and home the cursor. Model Builder also supports screen control functions for entering or deleting a character at the cursor, and deleting from cursor to the end of line. Providing codes for these functions is not necessary, but will allow more efficient editing. Type RETURN to continue:move the cursor left without changing the characters displayedmove the cursor right without changing the characters displayedclear the screen and home the cursorType RETURN, the screen should clear:delete from cursor to end of line########insert character at cursordelete character at cursor++++Specify screen width in characters (defaults to %d):%dScreen width must be > 30 and < 134. Specify your screen height in lines (defaults to %d):%dScreen height must be > 3 an5;*^#Vr+sH2?2|ʡ5;!d@K2*s#rMn}5*w#w;M|S692!@N2`iw#w͐|6<2`i^#Vr+s5Q2`iw#w͐|+6<2`i^#Vr+s602#|76;*^#Vr+s?2|P6;a6*^#Vr+s!@K2*s#rMn}6*w#w;M|'792<2<2Q2`iw#w͐|6<2`i^#Vr+së6T2!+B2T2!+B2`iw#w͐|6<2`i^#Vr+s602#| 7;*^#Vr+s?2|$7;57*^#Vr+s!@K2*s#rMn}c7*w#w;M|792!@N2`iw#w͐|Қ7<2`i^#Vr+s~7`iw#w͐|Ҽ7W2`i^#Vr+sà7<202#|7;*,^#Vr+s?2|7;7*^#Vr+s!@*2M!@*202#|&8*^#Vr+sw3k}A8*^#Vr+sw3*!A*Z2Mz|w8M|ҍ8!A*2!"A*2w3Þ8M*s#r*^#Vr+s!*A*2M!OA*202#|8*^#Vr+sw3k}8*^#Vr+sw3*!aA*Z2M|.9M|D9!dA*2!A*2w3U9M*s#r*^#Vr+s!A*2!A*2!A*2!0Bd < 32768. If your terminal supports underlining, reverse video or other ways of highlighting text, Model Builder can use one or two of these for its messages as well as allowing you to use them in your model output. Type 'Y' if you know of such codes and wish to include them in this configuration:begin underliningend underliningThis should be underlined and this should not be! begin emphasized displayMCPÍdxxfø\g\f]6^d)fx!9DM*!I&C*s#r|ƒC!I)C,C/C*gs#rMg!I)C!I)CMM!'JM2CM|C!SC!CMM+!3JM2Ckc&kb&kd&Mg0|ͯ(D!S+D!C!KJM2CM|YDM|YD!C\D!Sk}qD*tD!bJ!dJM2CM5C!xJM2C**8C**8C*6 *6*;C!{JM2C**8C**8Ck*s*6*;CMe|TE!SWE!C!JM2CM|ʋE!JM2C*2!`B*2!B*202#|Ÿ9;k&]2}Y9*s#r*,s#r;*^#Vr+s!B62*s#rM|9;*^#Vr+s!B62*s#rM|+:;MN2!B*2MN2!B*202#|[:;*^#Vr+s?2|t:;*~#fo##s#r! CK2* s#rM n}µ:* w#w;M |:*,s#r*s#r;*^#Vr+s!:;end emphasized display62*"s#rM"|$;;M N2!4;N;This should be emphasized*2M"N2!c;}; and this should not be! *202#|Ž;;*^#Vr+s?2|ʧ;;*s#r*,s#r*^#Vr+sM|;;w3M,#|;!<*!;C*iM>C*iM>C*iM>C*iM>C*iM>Ck}:Gk&!JM2C!JM2CAC!JM2CM|oGM|yGM;CAC!A!JM2C!R!JM2CM|ʻGM5CG!L!JM2C!R!JM2C!P!R!JM2C!JM2CM|;HM;C!T!W!JM2CYH!C!T!W!JM2Ck&!JM2Ck&!JM2C!JM2CM5C!JM2CM5C!KM2CM|HM5CH!KM2Ck&!KM2Ck&! KM2C!!KM2CMDCMGC!K)C!PK)C!K)C!K)C!K)C!"L)C*&~#fo!RMQ R͐)*~#fo~#fo| R͐)*&~#fo!!RMQ͐)*~#fo~#foQ!%RMQ%s %d %d%s %d %d%s ERgãgcJchZfi1iûd!R9DM! ! s#r͐6B͐#6:`i6#6̓`i^#Vr+s)~#fo|ʌRmR! n&! s#r͐͐ڵR!U̓͐)~#fo͐##*R!U͐-R*͐##0R*s#r|,S*͐0R*s#r|,S͐3RM!j 6R|U`iw#w͐!j n&9R|uS͐!j n&Goyz$ !\&!Copyright 1985 Mountain Math Software. P. O. Box 2124. Saratoga CA. USA. ALL RIGHTS RESERVED. {ʻq`in} œq͐! cq͐`in&cq#|¸q!qnq!q!9qßyx4w!9DM͐|qqïr͐+++|r!qïr͐##^#Vr+sz.r͐^#Vr+sn&ïr!͐͐~#foq`is#r!kr͐##^#Vr+sïr͐##͐?+s#r͐͐s#r͐^#Vr+sn&ïr!9þry!9DM͐|r! n&ͻr͐r͐##~#fos!͐^#Vr+s! ns͐##^#Vr+s!4s.s!9DM͐͐ ҄s͐^#Vr+s͐ qs͐0ys͐7s!&s͐ ͐͐ ͉͐1s`is͐ ͐͐ )͐1s`in&#&s!9si!9DM`iw#w͐~#fon&s}+t͐ ?͐^#Vr+snѯg`is#rs͐2t!9!9DM! n} ͝jt! n} ͝jt! n} ͝tt;t!9DM͐~#fon`isqt|ʣt͐^#Vr+s|t`in&ët!9tZfÔfi!9DM! n&ͺt! sͷt|t! n&s u! n&ͽt}u! n&s u!! n! n&+?u!Hu! n&Vuêwxw!9DM͐+|vu! n&Mu͐++|” M8CNFG11CQDRM8GP-1 AQ6Z1.M8IN-1 AQ6>M8LIB CQDM8LIB DOC$M8NM-30 AQ6 u! n&!Pu͐+++|³u! n&!Pu͐++++|u! n} u! !Pu! n&!Pu͐##^#Vr+szv͐^#Vr+s! ns&!͐͐~#foSu++|Dv!͐##6#6͐͐s#r͐^#Vr+s! ns&7,2q*&:q):v=v=r:qo&vy7:,*v:*v}|2q "ww:qww! {w7:)~:,"s!"u*|ʊw**sw! ~Šw6*u*+"*"*u#"uVw  ¾w > _ w7:)~:,"s!"u*|*u@x*~#x"*s*u@x#"u*+"x7*!9& 6C#6O#6Mqxx!w#w#*w#~x:**ʕx*!Âѷʤ!Å7:O*o` *+ 6  #F#x y~#x7*|DM**Zy>y><2y~# x2y >?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[@?9 GN\]^_`abcdefghijklmnopqrstuvwxyz{|}~v x/w80OD=7>6 |po ;2qFM-'nA.%[ s]\^~&cE53,bWT(U_*r:#yZ1$!ma`RQ4fYJ+)"XPI}hgdSLK{zlsJt,ŽƛܕūW|eoܕU[w+oXTj\Zy+K*[>i<'t ZoaoVR}+o)q &f汿8AVW@ho';FW#oٯOvԬgG }}ct>; sWkqDFsOH(Z9Yy6~7g,3'weiY嫺0;wDV\.My~nعca< tzkI$*:ldU~ӕj=&O6ZQm\5˯Qg6s3t(6j6KZ:4&i&I9&s1}nia"Vi#T؈aˋi6yyn9F 1lf1MQ&,m2#1y!(3lbY*3ltn1F wޢ0JP`s1r^"P%c/Y>5,o4!V\/G6"lDVF4_RAdQ',ąX"6 b_;YB5ƇQmTiD2xR,XS6Q.W" iLX^bgE1nGb)9~ Q=$ςDIV`!L!iejNkzΊge~OX^bIbDVQ߂H/y#u2_x)ݬo&_L+fMEU dT'fq&;$KZ_U`XYg.BV-Dg(-is hAzN"dd\[|>~c#Ҭ+ԞO{2KBrijWIqӛ4)p6iTON <2,ȭSܳC"q DaTY*ZGjVHCkeBid+EJR |G2v\#wݕ<|cgS//ܵ~k5'68׻f+W`Ӄ e\hoN"+vI .L 4"қ/u޼ně6\(\.J_-yAH889iֶxз( d=A/<;m˅y ϢgXƌw3ISKU+̳07fyLZ*ͯa`enKK9(Ϲ{n \UICNf}|yY&_DYwbpxiõ^ƕh2 UNVܼy -JF6Mܓ`'ͥyKkژm6:<[tL0i~uYFdT")g\E} h]=``#:eDFxHMk/K \p [p80@46 ENƖ>U3:K\ZY;0)1 Czӿvtc * E"¢Xz!'u<b҉1ގqOb+_@$Tʢ>6TȽiS(-oT'‡ԼpRy0VW>G~cRbR pIH.mEjsZ-Uȩ^qtKmhBgHQ5prqeUg~W 9{ܡÕÄ}?jR Xg&_ -RqsTB<ޤ^F$==$I|Ye;9{ GR͊# 3+|,#U6TR_׫+2f) (l.s;QTɦϽi8T"yp0iAx˫ tMpAM:O(,%}&,DBU%FfSg7>{j9ٿX(= excBX^e1?_6٫׷Y$+GW逗F3$![ LPvd:Q1'O: |t,*f8XOX/Gii>!SFrh%+<3{`E2py4+*7a d:`cB98=ھ+QsH6l@h"x\-tDp  )^Jw o^/-PsL+;⽅G <PVX^eW삀pZ6F3/%LDG3p$ZbEZ~tXn`HI= 5m4适ltB6kG$tQg#le:/ltk2p 0gDpZh>AՉpZՈ9A |ns ,{Ad?59XвoMcBrjĞpH>se璕GBIfiO <f^!YFJo}!Grg =>Ͽ:6p(Bv#+p@/hl6K_nߌ ?~P)\!~F|C^58.Ͽqli)C]_1|!44fKG>mq$TS13$?ԅ9RȻ{U_1Wd5RecD|["SG%Py5áMFŔgiB٤?Qo]eYZ0co9x'ל+7RT*wJF.Hn|•U[nt ^pK܊IS3 ^߸8ה}JRWrx.l:*҂{˭MJTi<*2O pݺ7нD tРݿ@AwL3\37>i8\/k|2sH3Λ湲`O%:{:0|ѫ5v[q7^5;'K*f5ij[>i<'dqZ0:cvM\/bǔs_\4]YZVy]rVtV4>l5&[.:0|Iá5|'ʍ*vkE [,-<8zOONUFg;;at}HcK+L+5uq&%, \Yʻ(4. !n,¬:wp;9N0w9\[ZyeZx.N0p83ťwQq0?|Wy I`Й&눛Xk~I}BB1w U:Ź<4]}޷H9j}Jt WVyV|xNL[$i~pڍ@LW5YqTZ+coy?.W5YD~nU]Xf<)t`nmx> !=_=GYg흗p*<5blNGk60N֚Lkp1b 6Zq;Lњ=W봈U*ꫧ>CۚEm] ?aOEt-4SMږ9ĻFU~;-ҟbj6˶D֫%ao@ai9HHkA)"Gnu ^;> >dNL9ͯ*mR?fZRKQi*D|&{K{:,EsiDE90+H-?u'8/`9ĆXT!~Ot%blȆlBىLE2E@J"%Ǩ([L ! =-ȹۢo4 ItΜI rLnBU%VjAd?3($>ߢ6d:L49jWVN8)D^~ي5 ۤCO$ejRU wK2̞;a*zr~Hv?IE޶4rzs btX^.ʙZǣfyNo 3AsC6 o}AEYAIQ1-m9iv\DžJD\˿" gNvθYm\wn>k#Jjf?P"_lD2ErV,uY"+( xVڄSN 28f=Ģ^a#<2XC6̮nƓU0!o Ķ!Y)ïKijv6'w<zSZ><$e$MKیw- o5cXl-&X?^-|eAi$*@D,_飨zeMAi'zUt~'X;"zzF;|ZX1gjE$W$:UMXf<9j1I)GXlk 2=IYaZ#-ukJ<.c]BW鬑Ǩ2ݓglHȏZwLcWHzSXnNj_!z:kd=E1*tz5`OBtFO?ENciB~NnW2OMWs1cUͨ '';Zk܃+{[V>zOʅι =s[@uXZ:sp g"!? '+2O֥cB2R,#k?YFŠJ9L69Ϧrc3{n_n !oW6rI@*ۯd3@}Ǯ$2}9i{^ou] UVaM`;yWOpr_NZiG:|& lgx=v4)οo~O~sE\ yq]Kݳ&iIn Vtk1lsP=%a,LtAq}ۇU=/؇pS3W,XfeKAA~}H;훥/{wG˷?]W g1セf`]ŌoT- dSbƷhj dSm<eș;훥]w:h&>Ǒkג Ÿ#ˀFVܑo,L>b{7ϻ>ǑkגaVObW+, 80.pCCҎD|ܿO5c OAW쮻H;ȥv1;P7 %64YaMV hi7&M+KI:lK04d!70."Є4nM4!7WғL7#,@L'|?]b֓H]Q\GE/ Ňϫvϥej&NO[n)qƹ?E"VBZ Ǵ.,:04 1"i]ZYJAiX˴ꦍQ2\S (應lanK H pZTY?!V*,K!;b- FZGAFutDOE}^mʖzȦȖb2M+lt1K+K)(8MtF*mk`HBخ6բp*$.7Sx[ՖpQ[-jV^S㢤"4loF<,U&4(b(5Û^wW\BoW B53߭>Ӕ6CbtR j1RP:o1 <*r^-NXx@W} ˅pyE=+8Cehâ^Ns/spj!: -=b8Mp NڢzFcZVRPp #LoQ@7m$&#d=A"1Bֳ #dX=aVb6b:SWE)8OR 1 h6\10ؼuO Qa06Ў ?[HJE[p5oGbjIHup_y c lmGkeژscK IqAMw'l=l{Hg \s7ʛ6)txo<7CmN":Bg[|/Ckj1=2Sp *??m,רWW6Rl (ݥXMԫmEzdWW(J}~xϿFlʆB8&#6&.tj1=7ϻ;olsJ#D0NTYՋZp 2~xN")\=3=K.--;0.8Gggf7ϻ;ols6̂`-Ʒ(/)?qB^?[dsAKaV?얓?e@W"xs.x?NR P "ᵙV q&jpƖ%Ϳ/~gjhx1_ր17L6 %=Kzy*Ӊp'C6j[7>1;$1. pK8-,a+2_7 `+BLI w8ꆭHkzt&e#Q@ꂭ 1 $+sedVVu$mzYw*(Eף< 'qõRkzU"<8ܑ" *Ul lm}kK{N۪;.'Z.غf{PΕĕåL)8K"T@r8ϑ[:J#%'UЂo$Zւi~Ŕ59V:MӴ>&_ۊtcqt2^߿@(PRCkVBnBL)㼚n؊69(y~ӫ醭Hja6>)j1X|eA W$^Ânغj[7njã^m+BZLD8hE+ʪVo4-GXE $`P;Y>6 fYVMKgt}=>ݰu"}M(6 1 d 1 WT64;MsmE$"=yB,~"~ 1 r^Oi1D)޻:x`ƇEѯlvu6: -Zj1zaJHLQUzÉ*k-P)&@RNKi`ǣi ZD{{P1 2; !tqk(;A+oQڑOe'hz-[ۑK+oV3EIŜI=LXGv$+X144So6rWަ9LL9 1֎(O=.z:kt Psp, f|X_u#YZy,Wh,5"÷fG\TV-^'U˔XT:ݜ.Q>M f]Ke8K`ػr魝3:!6oAooa7oj x@&ɷ$SŰ!ƍǍ-MKr?_~|Uq>V?5ccolmN KzSmނޞo568: :h3xM:o/(.H a!6BNE"VBZ Ǵ.,:04 1"i]ZYJAiX˴ꦍQ2\S (應lanKv M8GP-1.A86Y  !"#$%&'()*+,-./01234567o89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX+<<=;b۸]j7)c"L.|Q ]j7cTYuNެ E `?'Л-Jۀm< hl1.6E/ovx{?|5u0 y1qNxFz򺬕\%OmeKz^=?|5uFRZuN-yQDf~2./eKzΟ>c6#FC7f2aGT^Jz9Qᣨ̯1fAjL”B3QyVr\:'ʖ|QD+̐l#FC7f26M7hoA3`Cy];=: &JGEs*$L3KQuQ04'jF4P6 bu(<kfN4:|V(ip%EHVCn0 Sft1$[^E~pJQ|Y䰎mC I=`3N`JlغjD8lDkm^#]@KL7oSU(ipY8&v/xc {qT(i 0eLF4[v@w1i*N8en6e% N<8FICq>t0eL4 ]p؈Aք۞>q6KPwX2[ٔV .ew=Qݴ'h.莡;Iu!. ubl-;p>6EU7߾wL”o4J"Z;TQMQ$_W}V幾yWQuN4DM*CU)n I/Qa*NpGUgo+i400#``F 33ff)i4(o>oPx t)=`7bc4J00#``F 33ff̔4J.Պ(BO54U͉.Td5[Bg8֍JFcKprYvJ.Tk"'̃Fɫh$~Pq_+9M.T(i4J{=B?:Zza#[n{ZI"c mQ+Y%YJ -<&2UEd $,[ -<{Id$*dx$,[ QÅI$2UEuFrHX*ɲ6[E?\ȴЮPߕ4J.X%YTQiBd6UuP*1pODeR+9V<,([U4 z}{t/wbXTՑV2N.mƈ%=D&i̻m:݋T_j%UL- 2TDezT_,vr zLe^+Iu1FUw;4{9ߠG1@Ueո([RIdYY(g/EǗ/짲Yy]T?J;>( 4) ̾/ |?+. wfmR  -0דּsf$3}m^ I2>D88aJy"ʖvrV_f_}|?((k%xbTC=c"v'j؉f6_+IL)z10&a`NiܷɊ(["1\M8yXJQ|YcLْl85; <`dlDCDe|GcLْȴ \xD 'z&hk%Dْl89p<nhv~/ú"wƋ s؉f7tϗ*([4!2f= &alghr3ET+mv%]E#p0xbTC yyC'*Z8yzZEmRh$2f6M Zi"DH/DKgx=N[%^ ˛ZjzmR-n$Gz!2tx,oidQu$Q> cyJ~V/[%^ ˛Zj(U(VZ"U(Kgx9:No$Gz!2tx,4J% r31FX,5~w?+ilWyh׫}VjDZIʖyW]AdX~JRtx4tx,/Fvm>m׫}VjDV%Ec{\T+Iy\Fjh׫}VjD:lI_fmJ ?+Iْ|JRJ;%FIpxR(i0Mp%̭Ǽ~cF9zgh;F*C ٝc% 1F4 4htA'tfׇj{Q'h;Vjco=v(jݱ;4JÓFI+`n=Fas=j. ա8uz16My@)ԝmzHN*yJl;f5 Wz4#7v6EzN48g N`Q4JdJ-'X؈Z v]VBIs>|Q(ilD NN4:C X9?B DaAg+i0 BYIMe-Q9S(i4X6q''zFǎFH wYIc'z46@us>;N]8h0n4J>%In)b%FIh0M]:7<mЇ:iC!Ѡ% NaA ~6;Mh),B-+鬡7=ЬaT!vY|~W= 9R ST8.ӕ3\VJnϏ[tCga̕-j;unîzNK5`tC(=CV9rnîzCʚu(h(=;x]g. s4K'I!G8$zf4L#$U.-UWO+F'lֵ Ѣ!i%䰍N8NmІN/h# +ʒ8B}hJrH#mvփMH90Gɾla;X!;8bۄ@zGyϿUޫUh\V8bUI(ٗQ+AFޙq[DZȏQ/D:>c丂ϣ_{ʒmspsaa+!`.C F (ٗQ+AFޙcx3X{>s9Jeqfu&J=x\9N˒[ԪޫUVGf(}:!06I*kzAג$/+ ~U9{jB+?_c߯C~oˉR{U׻%h\>ǡoxS-^d_wK}̏CcvIDmã$ Ͽ TYӻ6fn<5R 9~OU+wwJ#~ovCR9'5*kzAA\Glvl#~9w~”arF^*kzg?ŕV#9'5THWYӻ::rdf#Jq%#*^M:-U;BM>s#wK8~sǙ(=|%I`9'5TS(>ӕh0?Bw ;vJ7.e7vp`'h 5c#qpѡZInpgtnJ%c\%-GF1/<4J% 4A0^ Cwa0@ S{2NDalyTIygJ%EȣXIQ`-1(uaq(jv uNbw% QEQS;hu+i·4JM3%y.X%YTQiBd6UuP*1pODeR+9V<,([U4 z}{t/wbXTՑV2N.mƈ%=D&i̻m:݋T_j%ve:M8IN-1.A86Z ! "#%$&')(*+-,/.0124356o789;:=<>@?BADCEFGHIJKLMNOPQSRVTUWYX]$QiDz@p܃c_d#+6DlNۆsX4BxMВN ]hHA_d#w~caaGmuo6a;m$M =6?*X߃A)<č;*A`ZCs~A[aX#簈B> ST7!G} lK3LQom_8C"w!yJ98?]q9~PSqr6aƥNi9UHWYӻ::2׵ ]Ud_v!xz3y7r :-Uǟc8*YO_q҄9巜”OpTYӻA0l~'0GɾOt~a-a?"L Oz˯zCʚuAב#7u-0ertan*kz!;?QfFw~s90G%5ޫReM:1r\RSqL=x80Gɾni8~#?D͑r9&enzNK5밮cHq\x%׻fC8:7G|JV^t5렃 #G6;o6)Tb8?azNK5kTY 7>l~%mzR9N/l\ʩ"U9JVǻaJsܪޫCUvn sxV^}|nwKX!̵:r_M9No9~M^}>ۈPe78~?#|~H+gPO?P?ۈPe7Pqn Adǻ䖳-̡Opz>6"T D6;xHΏrW9' z>6"T \ %#?,x|nh\ܪޫCUv4\g!G4CUv$ލN(`)Uv0G nUmDlwKYsϏW99vrZ)eKqӅ9OFuV(skTo0Qz <HDmOzȗ|ɗ|ɗ|Iŕ]s9d-}O5tQrF%c 鬑ko(~o<[`sX?? 9Bz|59(һQ\_a/|~;D1.6 4yf/\ׁ 9,zumgv_ NhV^F>?"~o &JBwK?Za,H*Rw~eYE;%uV.$"st6OGѡ%,DyMQtJ-w1@"<"Prf3X8Ȧ9zʯ""%S9mbUnafnݟZ~{ʯnԁk`w?-i sTa3:}OZԩ~k,k]q[Z2Ӗ*Qva閞>j:mu<#wK`w?-ٺ-QvrJ+eKq s9d-QrsKv- &J?ޙ3|c0cI6>u{ܰҵ]rF%cw1@" p s9r2ox uDUcPV9ҕVr˖,⤭slvϧe=pu3iYz?,eKqĄ96;|27үnv's-}-ˎ8(7lb,b?gQDӎsi1(7lb,b?gQDnEN1Ga3Gd9$.]gJ'viuZ96;ÇB VْEvC? OU`3]xJVْEv0fg_B ?U).?~a@ `Sa 96;sCj*d_-Ud'sa#?q}x;slvY5fu**["̱>擗L]ʥkʖ,⤧ slv~KgQҵReKqń96;|>VrZ%8?a9l{Zʥkʖ,⤧ slvOcBwu**[#-̱>WrZ%8b[96;gKo>QҵReKq҅9v 7*yr?x#G[B<5|r7? z-1G^}%sɫeK!sԏR I=Θz>mB>dz-1G^}8bۄ||yjm2G(U1TY`t߅ރ'}_ &99waxw&~ԯQQt$ =cٲBju_Q)e;+ u9j3R[D-m|ܔ͞αlI#dů(2Gmv]B^?cln+Jn6;.uzαliK'dWm7Gmv]B^?c"F*ů(>Gmv]B^?cm-~E_9B^n+ϔF_J-?ߚw(~[B`tҊu~sfgdn/e=:7#V$" )o&sxۄ{E,RphiE7 !TxTw&AT6KaB*lB-BҊ4׷m%O)e۶ 4m~O#ZIJn4BV9C*l,Rr˶sҊҀN6a?;ۄT>Y+턒[&,Hsxv!O)eK+NK:iۄ^ߖNH퓵JnٶtBҊ4׋RadB-+FXZzGl퓵*ܲ6!`iEQK!_2Gt9d9=x !_oJ^F96!_n#m|^,;bۄaٷ|z,0MN=Ipdc>9A4aa>B|~]3 hVsT24:7a砍څ6s9 W ]nЄng>QM5/.$S]瞾^Â& |Yq6㧺BGjmvY5ܦʖ,y{ҿǗ|ɗTْEPܰ)YĖ,P+v?T6;ǬnSeKq6a ÷}|ɗ|I-Yġ s6%ؒE'ai]ŏR jM-Yġza{cE&akTKrY_`wz Q_Pm|\]؏sXHր𖰾34vuÜqX͆M_\w\Ǟ?ޫ<#=??~v&as9,(I)*qJ9?-AeGE1; ya~ꬢ[R]UY/x ?Xp$J|)u2Rv&asXPST8 rn ,S~oP*rDǠYÈ?@ABCDEFGHIJKLMNOPQuo`<2a;yN?RSTUVWXYZ[\]^_`abcdefghijklmnopqrst_D7{t/]O%uvwxyz{|}~9.vR J&wQHF86 xI-) qpXWL=('"! ~slkihfc^PMGCB>:431,+ .cY6X'tLmvCmwaO{9#-~E߮Jn?9jI64R-~ET䖽-şNcX!ΠӲad_s9$~G%P2EסoiÑz :r@]Bw7(y_Pf# ǧvO{j~+e'%TXKsT-JRj-~#w;ǧe=YdS?cq/QW?Rrf߈#1rZ~fg4.tn+JnJn٬}ゥ)9jI63RvM5a zO9m•x]=:7oDe%SThuFHo  F2XnجT7O|~z mps\GX{~0E#Q.GsX0C<9擹~[R]ߕܲ ?sԒl*i,n9擹Yů( %HkwDB=pp嘘dS͗RsO[9[S)?0~zV$pՇԒ[ZʕqYx<^/Q)< %,IksT~9sԒl3R-~EvB-~#/%XKs6s5v;Ez:l> o 9zghHҊAMpW-~է~d%SEM[~' r<>>G(U1QW;dxZ !_Mm|!F6!V%sԏR KQW}x J^2UsԏR I=Ψ$4d%S}5 {BǗQ'-+ܲv`t>#϶ nȈ=RE܉MBpvc~%N ܻϕg#kö#'3AK۫n|d+f{.9 2|LG+Btnێh^-H! _6V9|LD=e.^.̣Mquv2e].VswG+4RufmDeS$ $^ODn/W7͉ʦHծ/E\'8<.>I&lI DA9.~f$$=[LJrAC>I&_N[$]Jg7N/8ӚIg_'YyI.oKٖ]\bxddlG4OfV|j>KDeS4f߸H-L AF;ܠ% XW.ed[.5Lf3_.Ky7t\kys=b!M>%̾q"#\L~LdS"LdKMy"~&f67d1a!g#.&S _ol\u|͏_H TH0!;υddv䅬ch~jI^%0r̗rk"*$Sn;"f߸%BԂ g?5E7.+Ҿj̾+[J{_-B̾q5Wy>%&^&g T!h7##8,{;qWKt&[꠿d,M/G\g墳&Α墳CMUpڜlI}|tke䍻溯)kgYuXY\'d# npt\-'G&G&G&G/hL>q'Owu޵c`QWœ?R^dKM˅ =tϲ9QIy[G+1EZ콢X?hi7o)*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZq::NE;)NGkRΕ%r# uO2es0Vf:dg9Z}>D8I J4U 3vK`t4I&PchJ:W`َ+|س!Y-瘕NcGh59ʞ@S 0Дu,IC꒪?4U9ai iLAV˄X*Us$:'"IJJI #k6U\C9sdxٿ=4x_|p;czsiw{‡CīR3aGdX#cJ\Y;M3HQ&BK!g +܇hVkκ$9IYf-bu *$NLsчVHl ̂Z*a)UXy8)"i4t+KlGaWj$ .MNrQ%1Ic%gL8}CD*K%o1V/*EVi\*yʊ!}w<%iPh&boh}y:o+2/ ^Ѽ,o?7^ΗnDEL*쿿W4//Lզ͉vˑ4nMNF޾V&̗%=^:h.'ȩK=amn>ErGN9=X"kN׹v)~>u,L XEGpH)![i[< Jvwt@E"v{WC) @ wGufu m2 TjLn1A=[=HMePBVQ6((jl z4A /4d50LJRE:t+!I=Wi1I=GV> wv50>@rc Bwʡ)Y РjPb婾 !4 8ӭ[f! 8*) BVZ0h(@Р\eFRCT4=yjyţ`1 ţVB)ʐjmţ)(V<vkC uk y.p* 5Nu]LQ4ζ5N`e XzGVV !ՓάFHqZeT <;3!a` ІX}bny!P(GGh[}b4EcVQ6(CNUC!NS4Hg#h[D7fd4Ci?WUbV:tNx'9IJ+*%iZ#}'v1VrT]b:9>VTR]L`!rά$_tNQӉ`6'HƘˡ;eE>DuNxɕ%َ$Il^l"4Ι!r$e1W%rvO`*H➤K-0eWJ\=9'eD4‡C!q|8ǓйrIK tNZfWrnsBe>D8jhGd ^%tT!'IH%% >D*}!g,QEUC!n7>D"&?7 c%Q:esL騝pӔ.pPsC!n7>D|O|8>G>!}8=|#?>K9_lfs6=}4(YaP>Dy<>ҡ!*ﭒ3s~L>~|8I Z2$+cH,>\4 Vi-9Α2yB:gַTaX`imƇCij',$-ӄ*aibO!sޜ]zv< [q wsÌ951 Vl~bCUTA+"R9eP%,M U$RZ\&:KT KxJ!9I6hxM2QqbX C+]ÖI13| IA7Y.WU6dƉt'RHtN>DLoΠ$/gsa `َtNp4([D # [v$ (40@9N*zxLәt:3( ٱr̋B[9j50nSuvjoQ}vR;`!mn" Egn YyƇ XR#` x- D ,S@D1I=WГ!WT+HU4p(c81K9eK&Df,sb./q[:Otx1o)Nu9(M8LIB - Utility to change the phone number library entries in Modem programs that contain the library as part of there CMD file. This version was tested with MDM830 and MODEM901 and may work for others. M8LIB was translated from the 8080 version CHGLIB22 to 8086 code and renamed to M8LIB. Please report any changes/bugs to: Alex Soya P.O. Box 121 Melbourne Bch Fl. 32951 Or Attention Alex Soya to the Melbourne RCPM (305) 259-7955 - Alex Soya 09/20/84 vd@M8NM-30.A86[  !"#$%&'(#7ciR6GP~ lIB]=-g;`Sч9CSss?^]]nD6 UI6h>DNϛMExvu0sTa7?1LA!w/hj~{ry1s 9'×W' MsCp/ק/80 b.IrfOr<& 0V$%x6jɬtLt9XI;>NZd*JsQK9xv4(Y9(‡Co|>Dl9ۑD$shK c%JD4'߳!-g;NcG`·T0~#Lj1:ljF`e" t%!bșd&!sy&ڬZ,nQp*5CXc$t#"c%RM2M&n4 V`x+ jiB4'>DN `$.UV4U9 d)l9ۑXI]݇CM9ݞ4XчZ,FA6SC!Bp .[O+|>Dqs*ג:'A,u,Is#+!D6Bd+!D7Bt+!D;]FSssjGv^2M6Zã95>s,g6/oXf+YrYMm|MͶ@C?eb5وn[͍757%OR09/zd%V]'Fhojn:IS왴tDDv. fo|M&/[<)v$Om&VVL٦5<'ojnl_œLIoXfKZbi;ãyc|M&g2Mwj<1[E&FY+Fm&bmx4wܜm`->'=([r!FhΌcy&I&Ltbex4xSsy{HN|N KMEINITB5AQM3MEXIT AQM5MEXIT DQC!MEXIT INSN MEINITB5AQM3Xv{MEINITB5.ASMc  !"#$%&'()*+,-./0123456789:;<=>?o@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab~vv0O);Ջh|I6/+zJCWХ ^l\ }ox _zvh.|Z/YD(`]ƵhtmR)gRdCnBѴX%jHMʼnF7Pu߯V(@o+ܾV(큮M It,%PRø_9+i )E\PpSV3=еҊERXE4DԔ"i Xw56tJ)qg?km ]lƖ&pS؀Th77$X"B VarvE-l%V|6>y{sxV$c&I&FV,hn%L$]r2b$hM2bJ*z.kbٺ h|M4ŔrYr2];u̓757/XEᵮE)]֊b!6h^2y2'Y2fX6bl 757Zi5LtLtNdh^9l?ADҢnh)6]0<757>\!&wJڢ(2f-bu ã97>q{j޼L[&R,K'Gh|M߶ 'N'eb1Ynդ3<xSse5;UɐE&I&˅XhxSsu9hw٢d$Z&|5>m=3Zɢuݢv4<_e{-^eb9vM4<_l$M¤TZLlVGhndx4ojn3rW$c&Jvbx47574 Ԝ=D;Ynjex4757\9ٔE1n#Fndx4757^TŊL,'#h;6ãYxSsڞ5C標]eش Ѯ'#ãYxSsޞtVx`?eb4Y3<757m)(U=:ۈn&[p$B\o fd|Mf{f_ qqq!.G1>d+"FoWBl"VBn"VBv"D4>ĢCcÿiV%bW]ho|h;zĮar E%kW`iJho F{2}P-ϗݬ^ F{=еIa2BUPbʥ Bdsa2a σ≢J.(\Ͼ_Æ ho6)$@AR[Irf( )ho$?$]!)BkCE(Iab'-ED8!=lӐRPk%4*m[ΰY ZR"+$e*E%Aڤ]!)M -aBJ-Ah3|nIZp o+$Hz"=`r)EBQX4RDC bSPP(F{-EitHh3X\ B -PJNH(b]V.)l PgܵI!mz"HV!i hπ2y$ dLDxOG==ww.qo?Ʃfd\m&I q~Χck(f£e7кI%D *¥H=3nI [Y5~eOEخ\1Tz:OedBѯSQ. 뀷eG6xrQ-Y~zs b&GcbcLc;o^ߌ]ݏ$3F/ ˯~7úq0=z]0n8ۄBc3SdrQ_*bd,^Wv=݀9QxXFh 󰞊:9SʱQ#PdWL!db~0rK:8U9h|:b&ܐ[2̣uFE wBo7pWs^O0 )1q1G \oᮂ|1^ϔXX:;Fwq`zE]$"&{.@ZZ+ľA@fF{=%!)46g*aB EN6XY\,'2cCD1Mج!-Adf7=6)DWH I MC%klB ) SJF{>G *]c%qX$2m4S[PΘRvKPk%4A I]!)|R!%6g*gч|qqelHSlք`IO4//<~拳=\ BP(PFHF/_xg?2{\"ġPJ/.vbwqGREd+g3h%L]!-l$T(LP`7Fp=zEl(f堈>`RBQTL7}ZHZ>.:{~RT`'7E(2ξ^@(NRB%7FzquG[%vBpS"$+TBILa{ctU/\7qezpd I V~BJvK%\`}P`J()loPqu_G&l J8z{8I PSݟ[{;8%YMQ(8z{8I PSE8ru~`[dmS{lB~]?=zEJ Mkm"nQnx{ZO~}{ԅ8 \@v~פnp{ZP\|}q&Sn&u8z{Z/޳G]C$[dM']qMgr{Z\|}{9+03ξ^c1/W=__c$RڶŒجn?//~I 6!256kjG{{liʄAܾlVDֳho4O/q*b MibRrn4Kvw3G4%;yy~Kyx]Ѽ._THAҊ6 c5z4%viٽer)ġI͌`4qQ[lf4k=Nlm(r1]}caI84E)X\ Bho7hoU!P(dC)@ZBJb~ƦN)N$ClhogB mRV Rh"$U.lI }@2jer %pO6h BZCPZF{yx]iRuXw5{`~뮆-HJnm F0F;f+@>f-8HKMiFFX|0% fB`q簂ܔV/#_ 3{{@kV.qMi򢫻~BKA(B EJ 65%vn9Tc+@$M0IRFX|0+W٣%V <.[TP"PRø_@ %LHlJT| h?;h):HKհq؏Հb-!dgK4BQm4c5)~5@ l$JXs3EWjD͋jGf):HK(V+P4]|_3Ei {+P4QOF{OU;fʁ$6 lPuho7hoc5z70{f-tkg|G{f=liʄAp JIǐB!ĕvoY 98AĚT {}PiD(&pS46g8zЍX}?[WFҒ"dר 1ѵ=Nit)R;؍{lf7z_pu{,Jд6o즹1z1coPDF//={ EE}}ߡ;{ԍ$kH+)`­ BN U Z/{=~rƄ[Rf͌^|z4Au;ebzR?x}ϿfG%V1=Y!LVdj ?G{rJ0!OF/P}Ͽaۺ& A P)?4_{{f-M&6 Ӕ lgB^x>W=jyV$A(͌x>W/F{=qA "ֆ->suoW=;F/..1{4M -0{1Y~i}Ͽ`8 )4$Ö+P8䦴b^TP\3{E}I2gg1aՂ-)) E)laRXego{+PTF{sXI.MaR~{3q%MP%Wh|>#/.޽dJrnۛ+i=lA(F{TQX!e7b7c!6 Wl63h|챰Oz6-K(VPh<2{H"Ÿ6%~qWF{~vW@PE$VH  "H&$+!)"Bkջkl7ʊpx[}imP4 %LHlƦN)ǚkfBX"~hϼ:?voi5!EQ`V!P"1@Ѽ#nE;HKB)@Z4]M1R4G=Ɇ -aRih^٣.lhV.UVD+dV)lF{ߍF/Ώ^\pqU,6ih^tGfePI%Oc)Eyy~٣.lh槱j\ Bh~:fx$)b8( %Eh?;}W|HJ\$ŵ)lF/F{c&L$E P*DWH d7Zcn )HKV 6k!)%DWH d`C$w ,#)I-\D&|hl@ûZ/9)T(*EM84-5 mR7F{=|wC<_vz1ggaogf] .q%Ç F^p,SZQ4кIaE[y8ȒQlӊfa5TcG7,pi̢iI3" AKyaM֭6"vMEXIT.ASM^  !"#$%&'()*+,-./012345o6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]hP"H[ⰱqoF{yx]r{5GF(T0hZj>O=jSQ(?\ͧz>ø_ͧ%QGDH~2t3U;fs[l6Ib7ggn7%v/U7?uW 槱jزMpx[ͧz>ø_Bi imP4OWKR! ,6d4gnwnE >6D-E†.lzh>._c`W0?uWcRHAh_Gգ._4E)X68._THAҊ6 ce4/#h|WbqRUhFu(ѸI()$he ?65o26鿯w20׻F"qcR^+<Zo͆Vhe2Z;;,-1ɞs:VF+y<-20w$r>-p_~ieO VO,@lZ}F>hwXD-X|P@jMdrC[0mcVF+xZheo!(kcK+xZheZODmEj5˒O}YǮem}:`o0geKDIy\kW}:Ю\ڨ`XzVF+xZheoaV#_ ׯ_ZB+Yw}:&2ȷ. ΉVFYُ&[>;|`V#mrke)evn&nje2ZB+~ 0_F_OZ~ۊOD?m#GE̵VFITV}:n\$n$rnMZ3:>h 797ݒq/$}:e\ 797&|-b82ZIA٧}F"وh"w2歛A1ie:lrӁv߭ 797iҗeB+hU.rӁv_$n$rn?&%Ӥ/ jw[j]E+jHӁzM1FLQ3k0V}:D1FLQl,bsdhe2V&Y&8)[4f/iA,CV4,hM[J {ahR:Y7&m!.쵢*2Z Zlpxq,Sb!jñq#vZ-,-߮{2غ āupZQ& ma%D[yA$Zv9Ǚ`b:E[%. ъ2ØU |k2&|dLp@wk(Y'%]_DdpÂ÷/Ҋ &3C߾|ъ&-M`[]Ci.q/=U)D# dɘM1mÅVTeT,}V+M-hr;PV5Y2.\/0mÅVTeT,}V+<*oCwEIa# օ:֊@ݚ`l]Mޡ0L= ]F-#v"H2Z Zâ?tWIBUÊ`kdkX5-Q˰C.FšƘF-?ǽpa5TcG٧* MQl  l75bxꐤcG٧]!$6 7E%qD>׈FA6G>w2؆8s&;MpXl/:iQ@ﾐAцXк <&AF,6ZaQ@ hhC,hppv \#}Ӂ;(bD8~a|ŃV$Ӂ &m<ܿ:]F>/"C)b̗?} N8:|lO_ -?%ġzJi!C Ѻ˞ǽV!IF>z E "q^A:net :ȇK.B?q ?hux;ݚO :ȇwQ-K"q^AaiI٧]BօӨe]+{ƞ{"ӒO&օӨe]8w"{:LH٧]_$I C\8=_~ kY޿ꐧI2R@_s _llᦘ ܿ~Pf+>|t#̥mG3d1uׯ_heO ~7LBqi݅ K+xZhen d8E#jҪnAu 1n?X'ZѸNJr? 0Pז.1ul௑c['DdpÂc,\ [()SvD7,ֲ6fMJd0όHiu7Ê .q(biE@es(Idp7,օ:֊ʴ kDq%E^jEfBdpY2\[c /ZQZ4#2Hdx^IK&%2Y26ט "Y2tV+$U7; HduѺ  A:hEOUJ)d]m]JmRDKF#m<},5_`hR*I9eΟw ġu ~}l){:"1q3{82K1je2Z2Z%M-d4f8 5,_hEeZRId5"8Ȓq"/lIKi3!2a,eB+hE@E^ ^yXLl; nX KFkq 7,6<+S<։V< T6˚ȠNcå $0G7ZQTuHIKi3!2a,m֊.~ `ghEہfZ Fe)$}z C[0m0iEy$4Ia4LE$Zإ&I7L2"QeDhՊ@C 1"A@%?kE~ТIFdpx|,Cm!K`:Yrdqъ0GL:"|7[2m촢|;$DCHW󟵢a|dFՊ.>)cEd0 YF+VF+xVF+$,_Ad0 oqaKa(ۭ )v5"}XYZ>fD w G| VIBo8tD7,xQ um9_=8 _ll|;?Do K[,mhM9Fǿ5p]^Zч= 5Gl:?%\! b 71;g^+6! nXPl1ZFmϬiИ%euKd0 hr;Pڬ$;ܰjEy$4fa FDiP貧 ;m"gq"ہv50E$bk KF6HaZчJ,%7hE/ ъ>L7#_>>u"heOh5K슒&"2غ āuB+$m5,`k#/D+<*{+Jʔ<A,õ5j}f_jEcn{&2N!Kheʞ#""fTY#C3f3[&IVdɸ†Vtz6H} zsPeVF+y).KՊuBDBydK,"9po 5ED@uZie2ZB+~ Dm${XWH9Ư_2VF+:= >.,CA Kuc1E1.ĈYKlPEKiM;\@"f _llzǡv-kE~KkhX<њoP\BXl/p"/l-ma%DsmQ;Zie2V[rU wy,cjﻝVhe0]Զ; `/1͑-a/,/͑Vyh[E}r|{bsd_Y^yH2Z͆,/h{4ӊqMk(- & #D]D_lla\v|=U)Zإ4a ŝop,SZإ4aU+[ڎoiu3aE8$E:#_6 dw`H%cXÆe@qQ;ZQ& -`.A>3"i9dɸtVaKұ#2a, `\jeZٕV4(m;tl7%# l m YȞdRXql2Z鿴2Z-.}`[dɘ/ sapZѰx5%E^ZѰxR+ *zC̾fheOѪI(OЭdV< T6Igdu,|iи#2H{%c R"a;ƅV8Ȓ-#QZчE,Qh}o;H (ƆX+N+heOhUei9;4Ih̺Ö`kA5%{Ȓ1Z֊4IԊ@;-~iPc6tZQuDdPCb5[2'heӳ[ Cc18ȒQGLz[u4Ih̺Ö`dAqi2ܥVIBj2"6,WGӈkX;[kEv$aąeDr}XE?IȈ fƱ_OϸplZQ4кy[u ư,,DB+$m5,hEy$' A޺k*@Y#2H8ԑ_:LpMn*N+U߯hr;PޜwZ,zEâ\+3* w;8VaS_ Fߴ,$2X;F$8hҬI *ބlIKiܰzN+ʷD?غ?kE9YGIKiK ZQ_TY+69Aű88?$_l]`kVewE&MJd0Hy-.]kqu 'Z ~ny^Ѻyyhr;PV5ȂuB+UIKiSjEa w;N+T6V4o)mfDoBkZчENe&2("A׊rLd0 o!GV4oiҤDHmR+[iEUie2ZB+C?pSXWH9Ժ f3iiy<-20+ж1~y<-2Z~-~08\XX+ *zC̾fh5~l0c ,, v-?hEہf&2ȼ=B<"̗EjE&Պ4IhVVTeVF+U2vNg}ϣea.l!]ќ@y}Mdy{xE/ sa#Պ&-eMiЬG:VFm5,J+:=lm_E^8(3hr;P&28 a|VIB*2Z_+Nsc2tV+7tMdy{^p,Sum9ӊ&oV .qX3(OmX!K4jY+DPr?Y+}%2ȗ௑hEy$4,nψ ~u"D^+zRJ ~uHKJ%6m`9ԘKޅ} ˡ֊.*]k2xluF6(ylf`"/iPUeiIdPq\br|;ЎȠX:}XEo ƥ[V< T6I3;`"/c1Պ4Ih̺r,('V)ƬZܰu8(bV+]MӠy ,ϝWN+tQjEIa̪ѵV.ZLBF+tQ`d vX;[#[(ylfϴ*Ƞb)8kZVVbVJ)%27HWN+f ׯd+dV4v)%*~jEUie2'heӳA޺!K4jYbZ#؋?`^X^H/2ZV]WZ/ӳ cH Zvy 2/v/; -ÝѺhR֤DG\;,(.; u7s>VIB 2/v/Xָ,ֲ,:"2X A^ZE"h5W+̗/tz6a{̂y-8LpMnʛw bH7 b;2_BgpST]c1Պ&ͻ՚Ƞb): .GkqiЬG"@um9ǽ{/]aR+:=W.Gkqoǽ{o"?`ZQuDdp_-1q<~,/ӳ}?r~9{)ԊNUr^=fy U#Ե87N{8/R+:=W.Gkqo?R+:=W.GkqoB{hpaVӳAum9 ߁ǽ{4IhVVTeVF+՘%Ҋ&-eMJd0rsAP"fMnʛݚ bH"f _llHVI3oq8ػ"Dr֊Ud՜2|f 5'g|]Q93VTi}9kEIV3vwu$pSU3:8kEΘF-ssYE_MUd՜@жkU7LY+*gt8 -6/c8Y2},jUsYnLƛ+*gWMjGW`>3V0IUwU 3:eVF+}; F5 `\BZ7-Ǯehr;P޼{&2ȼ=`\"HIKYjEy$4+Q+N+jRVWZ?N7,Y _k}fhr;P޼}Mdy{xAmό^6 fhR֤DGVdRXya-{&|m" V5R`6ZQuZVX]ielpjEہݟDG1[]hR֤DGVdRXya-{&|-bZQ& ~$2X qMA^)^ _VTeVF+$V5 nX#[)|ѶV4(o}Yd^)^͑-h;_IKYd^)^ZȒ=,Ka=慵jEy$4+Ƞb)}4EVk{x/6֊heI讴2_^lpM!ц &pMnʛwDGbsd 7&V4o)kR"̋# VuYe)Ǽsh ֊4IhV#ARXh/XbHbX+N+*OJ+' nXd~b6\hEہ_DGp_\^uwwl11A+5)A5K3oZQ& ~$2ȼ=R`Z޲c^X^H/ӳARX/Xbֲ, :VFd5|yGg,h#Ϙ2؄M/@y.]d^)^}!f_2Zwq5" x}rnIVog+*g4˒ɫ&Y5YowI L Jh4o:h)0t ƶ 28j5PTN)驙I!htȖ<ޮ{tgu-htq[RFw\]I1-K.g˼C0t1RQ:!NْWto=3B ԕ})i iΤx%[Nƨv)g|IQFjNB\yVͲI-GrJQv_}:;)Vc˷_bL8jvb%J՚n\ B Fd;_fB .-q[!aS=Do(!-%)dy+| ))xo{3p ßg)_yyż z6CíBTՎ\K,y=j)xxpm9 5E(44}Th{% ug2+\>?n[)xЖ%]-ڲ۹R!2PQPWHzD> 5R`;_].+L ܇jrg0LzǓ))&WO, ;gKf^ΗYi-yˬR-K.+W7P9a6 ]$)v2Ζ̼ +Yi-yҽ]W(Z .Z)xx}oR-KݞySr;%m0 䂊Rp9PYYJ<ׇ۪+)xЖ%ݳe^W)aan҈ި CT %30ޮ{tgu-+ \0v=MEXIT.DOC\  !"#$%&'()*+,-./0123456789:;<=>?@AoBCDEFGHIJKLMNOPQRSTUVWXYZ[K鉹󬚍?S'B.1I1A%<F{EOWW^۵ϔቯf+)@aYgqL&\Pj0 !LʡrBaz]쌢 RT9ا6=DaYg4LP97`)pa TN;HAAQäP9a #W 7PoB = Q E.ro% .*x7NOG vX9@}Rjw56>Fs )a؇r:DpaP亏 W7ѺAt+D j˙B*'vUr}ultP01 7OR? ;ϪY[x91bwHR ;Ϫٸ*w J FvUž%ƅ')Pت-J8p5vW^)/W +JRFwRR2N\)hc*'~%I~a–jfRH!Em*|Wo+)VRHȖ\e&\c/Xߤ:_ O{r\{8C JַRp&o -B )gV3 ;Ϫ٠+=MjRP9acSn@"PyVںB .kl||X'ʝ3P9!WNRp{}$>x8}S' 7D [rR{kK}ϗ7{ `DP3p*'>RBRe7}O4:A .c.`a/C9پr~@`0u* Qor:|)ƗORxRk{\,zoNP9!WN/I ^faxyb0rg4TNh{%E3A ^fg=_}_ )( zC > lk ]$8 ڞk ]$8+tTPت-pC{-QM 5pte*1u1"5P܇ /^A$!TN(4(젛,3ॽrg@4B )U-R) TNXڞk ]$ u FozcԾh4Dlt9Er7!x iN9P}mϵC >F=5xvO:eN1j}sPPq !wP9!;E [ lt=]jRP9acSn@"PlUY[RH_1þRHk {.kǰ{\sx;5H(l6ɪ5нR~Vm9tNP9!rR(l6ɪ1tf(ʮk@ƑQFrgfRR1&Ga [lfZ_\ H_^0WX|4[BoI )GN;'vbj[ QNcGJqD/$NBad}>TN~ACNu-_ۧγj6[H/ޘ~zT ;Ϫ٠+ Ɩp~CRH!Em*|{}$R\P CpK|u!lˬlak)Go[ŐʝP'$JPW(}w/T :APOQyV]gI H?l-m;.l<餐B&z1u1"5P `ЍWN)K]\҅*wI X^30DƖbݎں~:I-merBҽrxQrOIO$#[/J1qPj_y"mzC >P'yV-J1q=>K1-K^Z莋ږ PSBCCG&WP'yV-J1q=<EA`kzb%?E` I hPap@H- n;u z*b|!ui"BErؚ#tO|Q60:BR162a$T=*j84-v<ɧ08 }x*8G-pL3X酬jQ1 atܖqy_^0>@x&SI>BD 5=1~q8BV5XRʨ0:n˸կ^]0>@xz;|u/t{u5a@ErؚccZ'ft?OWW`[ cT@E}lwi.h'W)L0ac48aLj%Ra@*&qiZ>|opxVRO؇P``Bkp|1ͫZvKQ(f(: "-ൔ0KCD1FD6x 4J C#i4ذ$0wۙS^_n?NewORi4v0k;Tev&J:4~gϜpƇEO?I_vTZѯk%[TGsЕDZ؂R]'?UOg%̍PA"@g駟/N*-է0ѯkz?Oa3;B9T_QѯkhKk33̈́y/X*-U3~]ќHf('Lnek3~ؼI5ߖ_ѯkz?9 {S&xK뼀0ƅT­o> ^af n\Ddaݽ^Z[[}B v1{S`R^/ &.B]C,-?YB*u^`i0xIhy5͉Ed/G# ­8b3Tv6'(pf9~j4uMGs"'̌EM" Ed 8f8bm)jmI_ C[̐_EWڄ 6gݽa VE83ޏR͇@_~4'{=2C]d&dn4.?3ΤRͧЖ4uMn4fڄ,BX&d8X ;P2sk2,{R~]\*-9~]/ڌpyQX\e5ZX&d .Us_~ڌpyQX\e5Z 376!^H:iTMi.o-|4cjFfT6)~]/Dz=M瘹QD|:JK_vT?3B;"駟/N*-UNFvK}Qpk6hn%c㣩gk6s?l92Ytѯkͷ ҵ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abeI‰t%vPvbJ?xV*?/~?I*}cqy, RiˮJجVEO?$~uRi4aY;Mo'cQd/J0q3W3Va3cf=f8 jO`i Sp4Ǚj3̌Œm4>! =΅@[6: {H3[50Źv`^N3>bf,f(,XfApJ*qfD`/sLGr_oo_oE*ME\X=B Όe\֝ n@Lѐ'Y*M+1qT>TZ*6l)x3 p1s5nq# +L*M-f#g8'81aƂ?:k 򿈫Pl&4l#^_n[, X.03 lT@_t{{˖Horqk,T!ѯk}C*-~uRiX5lf6,"~'ˮJK>@_4fFV 3Cb_o!خ3Da?}j@_[ҨC>f"N~`r>uMu#4 ucGRv1ѯkOZ/nN_gX9_0da=^7H^RW4uM#bYaj^ "_? R.yE_J ffM8TFI# af(VGv;7|}y/T~]_HceP?ﰻ'__q &zhh^?4[q85g0b";7|}y/Tu ^?4V[V p wo~=^7TeI?cҚ +OR]'3 HG@ƙO;JK5p'*f=DZu3T4r*SOt  1TZ*jh~l?Uxb26Gpb9t{%n-(?C*zϛ#"m &b`ҵMH{K[kT)av\*"  b~_R7GwRQD_lKdA,c3_"RQsh Ox1abVS7?0,Q*~""e/VKB""Afv/-MjHEdu,5yJ4jH# 8!-[cFRQDQZϧD:RiS&"-8 ̌8XJE͡nT\Dm),Y(eGB2mO0@mNK/N*MRp'*t+fyQXA%4vTDOFj`|T ޛ77, nT̍M`p.80! 6ǧEM"n&!&,."376!sP# g:q oA8#Abksڄ,`oŲ6!" 4v$&c3 yJcR/-,g8" þ EcJc'"dg8("[Sbd..밗JKF!xsq.Nrsqq("gk Ed _lTH*6"dgxN sqY=ÚB8ϱG3?)҄_I<1/8=T[G#0~5pI*M-5%NHl#'ݽ, 1a˸GfCJE!f=D:b6Jѵ^濫h "}("c:pq("c~nF?CLKkN6ݽ>\XDLGTZ*-~uRiXQW;5p#~'ˮJK粻Rz>v^YNRQ޵-vN ߥ7'Js} {^6gpGZV*kj(Y k ^0όTϣ8wDO, &QKE~AO, &$0lRNH'ߥ7(#{^=Ą=n227NL &QKEMu@CLIa," Ώ!&q^RћŁGq:Ąxl $UC/FwDO, &:DV,-[P_p!B .Øqfq1s6 QHEMu@cx` c< 6[1Ą4 RQSY߭S>H[, &"3q^%GCÝT()DIc+ͷuw(n<%/QC?pB*Jז~]ݜt {L VrqgFg$5yJt00Hm7/;ʻ M*Ri푚T6wPvRQDPvD:N ƅ[10H ݤ0ߖ_JKERէ|>iu 11&OӶRћŁFv =gTZ*R>^͊1a~/܊1:pvYs!ݽaL#ԖCѕTfqѵ>i 7@ksˑnBrmNRF]tW8TH|> */(iQf\KE͡nvN YJEoO4"-&(-qKO,0.e/0<%Jai(Zp%ҫ!͇Rᘞt  'z~5-6' ̈́=n[Τ&Oևi!山YY-ěX[,TZBZcP:TH {G'RⱥM?C[>00K <%j| P8cXSY*j-u딈p?| 8TTDԕ_7=Ą=0KL Hiw{XFmORⱥQ{n*'dG/-GHG-nT)QjÔHor?"*T>8g"-8 pCK:%""F*z}ѵ7=Ą=@f8*V*Jז~:Ϥ{k &1fRѢ|ωtd9hҨ)IEM0LT-U<?iu 1aFmO̍a,JE͡nvN u߿KEo>Q/FUٍHyaȌgSnt7KÉΏ!&q^RћŁGC>0<O cV._IEǖ lWFIEMu@(f38!Yh]"by),];h>Wxl 7aO$ݕD1Ą4 Q*j+URt4, ! "T:IERoGy5^'XZbSô9^ZĄQD>7NL06Ri(][C D!ùJEmhʶFcS(mSE|ެC*8/ όT)Q5j@3'tmiW] Dzi!CfnE˿dcl /TZ*B{y~^i7ÙO'O9JEǖ64ڒH/ 3pSf;"=uf'LXSY*j-u딈(`YE]㏨9FIA8#D]=h8I*Jז~3z/9 6gz,'8pb<%:Lnu^ r3z0Hy)i>]OaJY"376!RQrf"YJE͡nv3%}4KMr>"fF #X-qCL\0HCy@URiCy-m4ڒA8<6RQDvDz͖O3RQsh[D}Q#RћOԕ<hbT-U<?i8f8 ™K㼀0,ÉI*j0maNy'cKx k 0Lq MȢT)av\*z8D?:aPe.aUHTZ*R\wRiS*tDr`yllclV`ccm=ecl /TZBZcP:THG' &.b1JI*B{EyWIeY*JUNhڽ{%'83{L2fu8IEynDE8߿O>T0"b2 1s6 Txl)o->*|numn8<%Zס]t#lr*5n(03?'F!*"!&1 NB*j-}""߿KEoO\"ioz Ӝr"el ,t?"ҳF2R=eȯwRQSYׁ߭Vp+F KE6B*7!ұ8 R|)ϛzqHZHjf;j>IEi=MwDz<Ada{aRQ޵ۭTD.FDz'x1aYxb`k03!ԐUu'͇RYׁ߭7')ĄTz.v1#SlG"}bV ò(qb]PvRQshH~5={,CE1IEo>Q^H?:!kK>ϛzqHX`l,P !2Ą`=gnRѢ|M mtY1Y,S*7cx`#B-Z/m|'*T>ow!}bV1u^*ʫ^t2JE!T>ow! (][l<9q^@8vb6c+ͷuw(n<%/QC?/VgRQTmjҜ8/ j352{8pbSôDW p."6PciJKEҶOf}|aD+D*jy4HE!T>owҵm<%Ja"2{Dlr*]KqKW!>!376!0T(s"YXBXNTxliw딈/.u-5yJ0%҂=KՕJKEhOaФ,*/(O0u4RQsh[D]Rћu.FDzbb+L jO#XFksÙTQWG?5)BTZ*B{&ghR["Y@XX׷C!cf #SE~ňH{pB*9y>[/N`f,yRQsh[D]hTu.FD@LCp]CLxAm b"ԵL*z8|[H f#%Ą^*-UWbt'kKU??"F*j0ma.YhhUٍt|rK Gk [/ ­ gRQvAya &?#ısn8GhMCvT)|Q"}×GV /85jHERwt'K뼀7vj8?3$5yJt0JKEMMf> #dafƔC=oٌ-6A*Jז.ʎH/ ıs8[TѺ;m7HEMը!ҫX!ҵbL:=&bKE)ϛzhHX@GC]saҵm?4yJsK㼀0qlV*oSEP 5yJ4_TH`+T-U|)I k 017Xp+c3T)av\*-*T>owEIX`i"b|!8B,쥢tmiq^@8vb6'n]ݟ}b,쥢&OGT4rJf}|H4T"=EyWIeY*-=RT)th6#>p+! {谞oiKcx`,-IER7.H/ ıs8[ShhS"=6Xd..밗偶D0~8/JEmw-^Bpҵoӡ]^B;s1<%f=%c (][f=]̟I/`V5Vc8T)avC"K뼀RF]tTZ*z8D:={yb"(f3TeTh>Uu'*T>owu }bU(܊ '9tK]HEo>1<ʫHyCLdp'a!JEMMf>ioz ­Ώ$d(|VNp&͇RYׁ߭t P 3p+RћŁڮَD߲laf!܊aTZ*-~uRily;IE{|,,CL0lKٌ-7!"(R^[wnhpb1a-|:vZ*j˶$'ƗmecT()D3gy/RNH'RћOԕ_%tB*j-]p!. e3|-=L!&lY*Jזi3Ep`i!;+8/ |Qר9dlaf("[buf hQ>R/L l~TZ)i~5RћumIY2^^^ &qÈSva` 1qQ*-ݕDzi!;OR|*-'"= '03ulEHy ' {03-|:CNhe!MKEmw-#HX`p CNh^B eQXaglRiˮJK>TvRik!CFX {'I*Zs"}be­c#RӢjsr+ ΣCKDnBwRћOTr=%ҫp1O?JE>'Gl3Dj ;jRћOTr=%nlM̚%Ą11^HEU3 x,16RћכaJkcRѢ|o<`|!.R|ivD:Ri(U9-ڎHX`|!8JEҶ_T4ߦݡlA*jhF ^'Fc礢T-S"}b)lT-mmJEmhʶ&OjUxb8vN*-kK>ϛzh#K㼀0 ­.X*JUNr=%'|)T(iD:b6RQ]iKyaRvJ(f3SXhQ>ҢωTZB NEeT|ṀсHj0čxl GbqJKEmw-^"ݕDzi? (U9-ڎHGQf + Q*Zs%Qj^TT(iRQsh v38aRQ6y3F"=b7Ia,g#oY*TeTÝTT5Ws?XJE6HX@L3NdO cV*ZĈ` ial /TRQDQ^mG"}b1aXOxX 9t݅HƂuwh.=eQX'&[k,fu8IT>jNO,P(8 buf 3CMȢTT>ow!yEzib("[8?3RQuJD[#-GjHX`i9 +eMT4ߦRYׇ߭Te!p' ce27sal /RQrT͉G_laf̍GmBMy>[W]*8/ όT-mnHE>''3M*hCCALo06R|*Jf}|Te! &q)ƹJ%]9D[U)`#:?f8<Ą1s5Ûh>>jNSեjNh "mYCD[TZ*R#ow!yEŲ6!^HE~KGlTTNsJDZ*z}P~&`kҖHq0 gaX`l|3^P~tl'0FRQڦRY߭.yE Y#H ?攤7'C[F[#ݕDz>[#42Cy > <`谞oiCcx`8p cf,<nRM!N*+mt,01fxMT()DZpHE4$D]ɫi>ȌİG{1q$U͔6D:1ĄapcSxV*z}i><ژ%RQ\"ұ8x̚%ƦB*ZR|JK_vTZ(6T-U}*7#b¨90lV*jh>EN5Ąqv&JtmS|l6ya &c<%| ҵ1O 1a\RQM)'n8Ą-ExY*zmʁH{=Oр?:1q+Q*-kKUc!4 c<%*H͒=Ą1s5KEm7HC!ߥ7+ T-m["]ap?hMM"?3山ƦB*Jז>fCziY*jh:2D ckVV{X79tKGXMvDEd _lV*Z["-cp Dz̚ Ǭ'hQ>Ҷωp0~T4*6̬`yll_lRQT|>6StWDr &caTZ%7! `9dTD]Y>io,-<|X1Ο06e#5U>|R^bDa?y\8[S/ےH/ l#|XT-U}*7q^@b8:~ fR5ۦޑT(i/Ɠ`X̚RSC.*REO,` ̬Y~5RQ9i$>42tmȌgPhC5b(I*ZҨ_ F!ݕDG!-G>IEuK ^'8;^*Zs" hQ>Rޏ&`hnr{!ҫpgKE>'҂WKRⱥQ7"*j={RY^o濫"!ːCN·.$U͔FD\ Rћ<ژ%kdƳTWmt289,MGiˢ ZyRiTeJK>T0ҵmn]K㼀0Ȃ`S@O,2^LbQvÖHpgKtmiۧy>[W0zg@ga1q­X*jy4 8!͇UH8;^*-kK>ϛݺ"4 ,afC(VG,#m>0GRQrZT{"}ba8;^*jY-eMUH{UIo\ -{a\sRi%K㼀0X/&03! ,#m>RQrZ,n ,쥢fq 2Xt\7X1Kk=[?09XhwcX1yyJKEҶOf}|ň8/ jsnRQDϣH`+T4rږ)T-mT>ow]Y*jy4lCN#1<0JKEҶOf}|^ݜ8/ V#0YKE~AO,<9tK]R=/{