IMD 1.17: 6/11/2012 11:40:08 tpc-1 vde 2.62    2>1 O2:ӶӵӴ<Ӳ:ӳ> ӷ۷(۷ %۷! !~,4+4~ w++4>Ӏ !6#6#6,!~%86+4~Ӄ#>Ӏ ~8ӂyӐ>Ӏ>= ۀO z(ۀO 8ۀ( !4#5 :>= ۀG \ {6  _2<!*~6z>_ Cև!Yֶ2>2a{_:*շ(Ez(;:=2 /!P!6#5z (>$ͮ!/:/I>>ͮ X!F#~^w6!"Y Ĺ;ͧ*[~!8ͮ# (> ͮx 0 >.ͮ + 6?# All͹Y:ͧׯGͱ:>2)2("Yͧ>2!6!~8 =w4!6~ ( ( (  > x (=~!5 6>P(͹ʈ;o&JF+gܙܥܫܱ"C{2!"E9"1A߯22!ty)K!G_^#V*Cސ~E ,&-AGMSߛ!!ô!ô!Bdos Err On : $Bad Sector$Select$File R/O$:BA2!~62E>! ^#V w#P:BO|^#V#"##"##"##"!O*!O*|!6ʝ6>*w#w*w#w'û*! J*""!N#F*^#V*~#foyx*{_zW+*"**#"͕: 2Þy<_WyOxOxG* ~V5dw^ :ʈNÎ N#Fyʝ*}|\#u*#DM*6# x±**s#r͡*6#6^>:A߾#~$=2Ek͌P COPYRIGHT (C) 1979, DIGITAL RESEARCH COM$$$ SUB_͌> ͒> Ò> Ò͘~#͌ì DIR LISTZTYPE^USERDFU GO ERA 2SAVEREN yGET CLS տ/: 8=_.:;<>[Y o$! ~+ H(+!~ (#0 0Wy8 88Oy! ~ (-H()08 80#OzW{_W{_}!6~ɯ2:Y >=!Y־!ԯ2)S[( @G:(:Yw(:2)S()SY|(+!  < $Delete File͹Yˆ:J:!)= (#"Y G!~(p p2͜~_EË2.3: ߷b# : ߷y! 4 5~yy5 6yҐ^H@Oy H H: –ͬ  #H: ! ߾ Hù H H $O͐: 2 *CN# yx#*DM*s#r*s#ryOxG*0MD!!N: EG>O: \S*C :qn& ^#V>O^"*}:*)=":O:页o"*C *C!ͮ~2~2ͦ:2ͮ:O:w:w |g}o*鯆# ::/GyO>2!q*C"͡ʔ*JҔ^:Oyʃ?|x | s-|N-# S:2E!~Яw>T D^6k-äPYy 5*{zBK5/'/2*:Է &1wͧAͮC 8 >1ͮ0ͮg2Y:׷_~#fo: !׶No Fil> ͮ> _^>(ͮ ͧ~ͮ~#x2p20. 0Q#6SY:Է (#* 6?Ww?W #6 :<2!  # ### >!~ *)(A(S SYS(Wx2$̜(g=`O> ͹բ J{ ͧ | x͹  > ͹!w!͎"l!~2!~2ԯ2\!!!~( (#~(#x2ͧIX :>y ͗>"C2?2 >( 2_E!ׯz6!>Ӽ8 =Ful>x: 2 p&x~+é7ݯ2 H! >w_: ! ߾5ͤNkͱ¦ͱxʊ#Nx: ߷! ߖ2 ͤ! 5™#wO~x½p Hy<< ʑ :!qMD# ):BO!yoxg*:BO}!N#F "*#*s#r^ ~!J! J*:o$*C~i6iw**{#zr+s{ozg**͕** ,w͜͸Ͳ!!N#F$**O!~#ڋ>*Cw~#+w#w+ɯ2E22i^ *C :~w~͔͔# #     w ~>2!E5T*C!"C"C!w# F! w͌x2͢*C ~<wʃG:!ʎì 4~ʶ¬:<ʶ$ʶïZͻx>2>2ͻ:!Z2:E߷ẅ́͊Ͳ>s+p+q-*C ͥ!!q#p#w*:BOYG}*MD "ã:!B߾w!>2*C~=2u:B2~2wE:A*C߶w>"!""2B!"!rQQQâ~?ͦ~?rQ*"CQ-Q͜QüQrQ$Q*PLINIT ȸ³$ $͝ ,I$I$ }BBM>3>3>3M>02M?ýýýýýýy<(c) 1983 TeleVideo Systems, Inc.1>2B,2M=!"~/(Oxݦ!jì~,(/:(!`(+} s1͈͆͘{ç!O .çQ(~/Oz ݦyݦOs1͆sW{!:>!4+q( (1* S(N>y *|(8S(:ݦNy*}82y2 (22<22:2!F(7:! * :!(@:(:(2>2M::2*":2:: ӯ2:g>o*: >2:; :L2:PL[R:O!> ~==>>2!M6#~6:Ӑ b+>2:A2!p!kp: !!p@!:|!pN#F#~W_:( O{G_!__#Y^!^#Vs10G(+/(*(6(8( : >1x/(;8: x!@A :<{Msh1f*]#"]!D^R:2>2T*CGͻ:ẅ́n>2;O ^DM;}H>"*C ::ddslO s#r:E߷͊:==»y==»*Ww#*"͸*:G#š"͸:!w4!iw:Z!E~=26):B"*)*)Q;*"E:;:A2AQÓQÜQ*C}/_|/*W}_*"}o|g":ʑ*C6:ʑw:2E**E}DQ>2>,2~͓(!4p͹!p*"!4:~= >2M!">222(20!"!"!")!"1!"22>!w:OڈyO:B 22::!>=͠(!~_<@8w##~ݦ>ys1Z2</2:(->2<2{N:ݦy(  >2>2  >2Y(:(ɯ=sN1N>d:<{NM-/!j͈( # ws#r7^#Vͦ8#N#Fͦ[jKlz{^#V#N#Fͦ# nͦ }p+q sN1.͆ͬ((G!`(+| xp>`>`͘|~ :!ę::2Ӑ:<2ۃ> 2ª:ӂ!:o(WӀ>= ۀOz( ۀOG ۃêۀ(  ۀ( ۀG 2 :!5(~(3>Ӏ>Ӏ3:2Ӑ:(ہo:( Ӄ>Ӏ(! +|( <2 >2[`R[` 3[$ ,[)8%d( ~1j(~286]8 6] ]{hM6#~'w#~+#~+  (0!I+###+!G+++:L!Iw+w!Kw+w!Gw+w+w+w2L~~0O2*C!!~~#~O~G#n,-.‹! w! yG!x͢.:E<ʄ! q!pQ:E<. ʄ$.:E<ʄi6}2ExN! ~态O>G~G!~G} *C!r#r#r ^ͥ_y#x#{ùñ=MÁÆËÓïÐýýýýýýýýýýýýý 020213/,1302/,1313/,/,/,/,/,/,13` JJ J J  J  JJJ2  3  w*3(>[1 y(:9yM:(>22ya(A 82͆sͣ͘:ȯ2&&>d( G>d(x Mɯ:y!::<[Kͦi`8RRR !: >2͟:( 2͟~,(OxGç͞ç({NM>2&&>d( G>d(x !"j"l!d"R: 2́y28!!< ~O!O  ^#V~2C~<2Cy2C`i:>Я2>22>2;:>Я2y2; !:(2=2:! %* :! 4N:C 6!4>= ۀ2G 2\2>= CS">2ۀ22:  xG 2\2*[K(͹ *[K>ӀӀ:G: :2wG:@=x(!A(2AA2!p͹!p>G>G:2Ӑ> 2>Ӏۃ: ۂӁ!~5 >Ӏ::M=2M>Ӑ2Ns1Z22<{P:A!}w[!f:_!k!spBE~#OͱH!91Z> >!~<@ +#^w#py!! N#F!$'*-0369<| ,"   R:3G:s11G!~ x­5x/(2í!5íxX(~!'O N#FSS*"*[|"RԿ*[|"RԸ!6>2{M!"!"!pga[!G:(p#~p x(( ! F͟)z*{+>): ,>->.!C!C!"!91Z!>"">>`222͝>2@>Ӑ>Ӏ>= ۀG W 2@2A!!Jp222~2>2Ӑ>Ӏ!.@2B222<2 !5|5~O5#  55 >'>&>(> >F#~#^#V###~#ͧE•666?7_6{7{@7{7{_!~ͧE!'956:(9w̓!74:7̙6*7~@w> çE>*>M>CUS7+(>2ís1>033(1>3>2{M Bios Error: Boot Failure -- Hit any key to retry. Bios Error on : Track = 999, Sector = 99 FDC status = DH ReadWriteRestoreUnknown Check the disk in drive "b", and close the door. (> >(> >d(> > !#6> #w<#62ͱG>' TeleVideo System TPC I V1.1 (c) 1983 TeleVideo Systems, Inc. 60K CP/M version 2.2 (double drive) (single drive)11@21A31B41C51D61E71F81G91H:1I;1JG1KH1LI1MJ1NK1O Insert diskette for drive #: Press any key when ready.+2HooH?2 t*9b85*9*9#1:Z2!P|G^: =W: =_>(>$ >!>(> ><1`=1a>1b?1c@1dA1eB1fC1gD1hE1iF1jL1kM1lN1mO1nP1oշR,}O"9*7*94z W{_*94BK*9*7"9 "9x#6 w#62'92(9O^#V#E6.6:'9ăz^#V{N6}s6+V+^{X6w#w+++N6 ~"7@w#~S7+      VDE262 LBRVDE262 LBR VDE262 LBRVDE262 LBR VDE262 LBR%!"#VDM262 COMb$%&'()*VDE262 COMb+,-./01VINST262COMH23456EDBACKUP$$$=VDE26 DOC4ÀaH8u_VDM_2.62__(c)1987_E.Meyer__A:@@_@@#7Osborne Exec P0 .0.2˷Teletype printer13!116 2 & &-21<2\ 2121!`^S1#^S1b21!3:721*5"1:>2":/ 21!35!~#;&!]1b ͎ D!("(" M+-H H!c1b DDY >D!f1b 08:$K"M@$ DBCUDEFH=IeKLNP QRSTUWOX!$=)%~-%##[ :1k^,!xJ*!J*:1_%:1_ *A&VDE262FXLBR 7VDE26 BAK?opqrstuVDE26 DOC@ABCDEFGVDE26 DOCmnVDE262 QRFHIVDE26 BAKJKLMNOPQVDE26 BAKRSTUVWXYVDE26 BAK8Z[\]ͪ#!pJ*!J* :1 #͉ ))<:] (́:1 i*:1!02113^,7+͞+7.G%*.<Ͷ-̈́ <pV_ bt s = I   (?:1͙%Ͷ-21:1 Ҫ-:<*͙*Q)@*[[:1))))=+ :1_:1 /21*./,7.=!15#~T]#`(O!14^q{8>2a:12aɯ!=/͏*J% YN( (!c ( (#OGyHJ%Aʃ=ʤ=V=D>B2!}ր0Fu.J%u.̈́(2(. (MO(Jy(!wVINST26 DOC^_`abcdeVINST26 DOC"fghVDE262 UPD5ijklVDE26 BAKvwxyz{|}VDE26 BAK,~VDE26 DOCEDBACKUP$$$EDBACKUP$$$ VDM262 COMbpVDE262 COMdb>IVINST262COMHVDE26 DZCYVINST26 DZCPVDE262 UZDgmVDE262 QRFo&.^#V*E* Erro]]] ͤ*1:1( ^,ê-J% >>>>>> >> > 21C*͙*]* u*F*u.J%C*u*ͤ*:1 !W1b ̈́ D  !Z1b̈́ DRi?+' S # 0@͞**ͩ**' ' >+ͮ* ͮ*ͮ*6}րJ% > zbk~08 :0 #x0Gx(?(8( 530/0( =>dG0( => 8G0(=(x7! FNy(-B0 ##>1B84 ##NFy(>0}0   B> 6 #= 'd !1 <212121/21>2121!.͏*!1D *($P()^((B('@(/#(L=(`"(l P^ 8|21~ m~!wF b^ 8](Z21221P@!1v W 0O!"(I!( 4>_!(F#u $>_!~ F#˾_̈́ x~ #x^̈́ #!3"1*.%"121<212121!"1"1"1*1+"16 *1#"16 F#^#V## ^#V## @`0@a{_>G:1+> *1  *1"1*1+9> *1 +*1R"1:bP͙*])! *!/*ͤ*#+1ê-i?`iy/; *1#[1RBm/; *1[1ͱ*1[1ͱ [/; !P/*1^,{z~# (8:1Ĝ!pJ*1))ê-*1J!"1ê-*1"1*1a (ʹ"ľ"(͞" V=ʹ"ľ"(͹""@(ʹ"ľ"tʹ"ľ"tͪ-:b=_!88<_ͪ+[1S1a:1ͪ-:b_=!88_x[1S1J:1ͪ-:b??21:1(r:17:1/,:8 ( :2{ ~:1?:17͙%C*͙*!i1 ]*7.*.C* u*ͤ* 7* ʹ%217_YN !1&!C8#~=!`.:2~ʆË:JPO!C~(0#+q!IJyH&!C(#P6( @ê-BA=Pͬ͟ê-B#GPw J+aMê-!16(8$:> T]m +~68*1:> F T]i+(:>(:>T]+8S1+x 6*1:>6*1:>T]98S1#!.*!F#u *1"1:1 :1!121!1n(BPR+*1J6^,*1[1"1S1!1~(21<21:1G 8[*1Tͥ % ((x:1( 80>21  [1{z0>   :1( y !~(˾F#u !15Y !F#u *x= :@G x BDM*1DM*1*1K1K1*1+++*1+*1"1#"19*1#*1"1+"1(0ͥ" > 7>  ###7?(#+60S> *1 7?z 7*1+> ##>4:b?-*1+"1:1(=*1#"Mê-68 *1>2(8 *1>-Px>21J.6͞" V:1=G:1̓Ͷ-4:b!1G:1ͤͶ-".,x-J:1.".,ͪ+0*1~ -a=*1!168$͞" ( ~=!B2*!2~!? +5(#T]#@~ #>2*!2~ʶ-6L!2yOxGL*1"1*1:1 # xL:*():2=(#[2> ((:2L  Y:22T] C1T*( | } L T]#H&!`1b ( D!>D (P  @ò- Dz܃_?8 ܲ-*1"1Ԯ*{@{  :1•> Ͳ-:1!B=!`.3:1ğ:2 4?:1N( ͥ" p7.*.68.V:1> .> :1!b ͪ-͞" (ͮ-x BOP 9w DM*1B`i(#S1Mê-K1BDM(+S1S1#"1iBP+#RDM[1͇@S1Mê-?`i7B!.͏*>:\G:1O(& 08d:8 @8\0XG^ 00JOY !1p#6?1 6:3(*:b=21+a^,:1>  :1g( !u1b(u!14(oN:1_:1=8c8`:1O:1!18˶N(@:1G:10>F>  = *1:1Gj >  :1!1o& ; ! j  ̈́ :1G7nnnnn (.(:1ȯ21ͭ >21:1W :1(>21 !":1W >^ 1:1!b(<:b21>5:1=(,!18#$:1=:1=!B<:1!`<:`21ɯ ~#(  > (8)T]~  > 8 > # S16*1T] >0~ ~+ S1o?i?@}*1#w"1*1+w"1!"1(*1#"1<(-*1~~(˾> #+"1 ( (,.M=!`.:1=.6-͞" ".,~(6 +#"1 ( (@.>21:`=!B!1.3͞" (ͯ"(Vͯ"ľ"( Vͯ"ľ":1ͥ" ʹ"ľ"  K1#:2=G2T*(!? y++a*1~( (~6 M!1Fʪ-!2( O#> ʪ-!2ʲ-O#> ʪ-ò-*1"1:2( GtP!2~(G#~@H>21!.͏*^,2O!>21':2:1ͮ((0ͪ-;%:1< :1> > î-!2~²-:1!`.*1> > ̲-:1t21?*1+"1~ ʮ-ò-?x(*1++> ##"1î-6Ͳ-*1~(͜*1~6 +w~#"1 ̮-? x7*1#x8gT]#͜> +tͪ0 *1~ # +"1ò-*1+͹"1ò-ͬ:>1:`!1wgN 1% P1%ʒ_!#! ~(:9( ~w#6+6 +6 +6 +T]+y6.O* !15( > ):1OE*...  y!1(> )#+:1_ ͪ-1́:1  &:\&\%P͛c)^,́:1 .!.*i?8*1>' @   0H [1"1#J͛c)ê-:] P!.**1"1*1J60*1(*1+a^,́:1 !.*B RBK(͛c)^,P!\1 :1:1:1!1\ ~21_#~21#~21 ́:1ěc)^,!.͏*>PG!~ w#!~[(x;&P21c)P!1P21&^,7!11=%&:1=!~1 !U1<A)!11~(6w>:1G:1 @:1=G+͞" V<+ɷ͞" t= 21ͥ" >GxT x!BG>" (++͞" V͞" tt {2":1ʶ-+͞" ʲ-ͯ" tX?ͯ" t^!1:1=G:1X͚"(+ͣ> +?ò-*1~*1~> !"!"!"!"!" !"͞"ͥ"~ #,;/-.?!:  !'/͏*J% 2121_ͣ%Ù%6PV (P*1++++"1>>2A%:1TJ%_͞"ʷ$J%>21:1( *1^"*1^#"1~< :1 !15( !3"1{կ21ͣ%͙%!*6!*w.{:2 /!1!*~621:12*!*~621:12* &*"%!%"S!"1321 &:\&!] ˾#:1(-!\ !\!1%%\%212h2|\%<&)x)!T!"(aw:1W 3~ (& ( ($21~ >21:1 ~#\% A!:w > (| }KB*1K1 DMB8 ]͙*:`W-ͮ* ä*:1_x0:121:1Ox0_:18 8 x={(<21D21_.*1"1:1_+BJ(R8#"1C1= ./,+". :1=,=,:,:1,,:,%*͙**1,$*1+-:1o&+ͤ*%*^,#~W( A(NP21c)ͪ-!"1:1N(>2121:1= *5"1 !"12121&!1(F:bP?+ = /,t= W:3(*#+=2bê-:1!32bê-͞"_A8 [0nˮ Vò-!1:7(wͪ-!1!4~/w!2:2!x1 !U13A)!1:8 +0x+6 :1!14L5ͥ" X- ͞" (> ͞" V4z(8 ͣx={ XV=:1=+6ڥ!͞" ʤʹ%!8ͫ!ͣ(ʙ!!16ڥ!͞" ?! ~=!B!3>_!z(N #= ~(^6#DM!BDMͪ#{(I: :@s#K!T]BBDMN#!3:1N(Q +~#8#+ͪ#^, !!>ݾ8^R8#"|6#+| !"!!!1FJ%0T:T͙6&H>0ɷ(%!:˶#˶<(!()% i*T](\O>: S++~08+:0'0_+~08:00W_+0_{21 }(~ (A8G_>8A{<2\>:> +#(]#(j.( (A8i[(C('( > i*7ɯ(@. ##(4 (87[(('(~(((6#\% \%1* 0*>:*!]~ (*#>.*!e~*#u*>[*:1*ä* (0_)Ү*)_̈́-*1[1"1)> * ; ! ]*V.:1GEV.:1!1(G#7+))+V.&Ͷ-21/21`,:b< :3W*:1(38_x:`<_:1G1!{1 !U18A)!3ʘ!b5̪-:3!2:121y21&^,:1NP:1=!/͏*:1O P V> ͯ" Vzʟ!ڟ!͞" ( ttñ ͣñ ͥ" Fͥ" p-(RVt">͞" p" V> +ñ V":1;%ê-;%X;%\:4(͙%/,Cʹ%0(p(?60+7V͞" ! (+V+ͥ" %21!1F0G!(^#~#PO~˾(#~˾ē%>1)!/͏*(cO!/͏*J% Q *͓%J%y( !36^,*( 08 0Gx21ʙ%!3"1>21!2~21~>23^,:1T21J%!16[(+](.>(5<(<_!3~#T(T{ #"1!3"1ɯ #~[ #~(A(N(W 21:] (!5' .,;:?*=[2h2|21/21\%< 7%\%'0!:1W >~ :1(d/21~ ~ (0˾> #wz ˾~ +~(5 21!!>( ~ 8~ (> #wz#g'1+:`<*1+*"1)_~# ~#G> )) **鯆7G#^#*^#ͮ* ]>  ͮ*Q)͙* *ä**)_v-:=>21:=ȯ21{(:1_*1͐s͠#"1*1+"1 _ͮ**"1*1K1 DM*z(   q-Tq-( (3 0L@͞**ͩ*@y (:1( <ͮ*{v-:` *(> *{=HG*1͆-"1K*1:*( T]͐:1 w͠"1> >>> :1021:1=:1=͞" ( :1!`(":1!b(:1=(:1!b   (:1Ͳ->21>21>21!1!16_.!1~6C_.!1~6͞" 1:1(+ͥ"  (<ͮ*:1_:3!1W*"1*1*1:*͐~˾ à.........MemoryKeyI/OFindSyntaxReformat I/Workin] FileFindChange toDriveOptionsrfi|^deln|[^wait]||deEO|undl||flsh|za||DeletKEY,Quit P0L0C0" ^W ^Q ^O ^P ^KESCChg (Y/N,*)?RdyINSDS MR BAK] b*:1( ڕ,-% >>>>>> >> > 21Cͱ*M** )*Fͱ*%Cͱ*)*b*:1 !1Iͯ _͘ + !1I_ͯ ͘ +%< !1Iͯ i͘ +!͇* ͇*͇*6}ր%ͯ >ͣ zbk~08 :0 #x0Gx(?(8( 530/0( =>dG0( => 8G0(=(x7! FNy(-B0 ##>1B84 ##NFy(>0}0B> 6 #= 'd !1 <212121/1_:1=8c8`:1O:1!18˶N(@:1G:10>F> = *1:1G= > :1!1o&p ͑ !p =  W :1G7nnnnn (.(:1ȯ21̀ >21:1W :1(>21 !":1W >^ @!1v W 0O!"(I!( ColumnMacroRepeacoun([Q],0-9/*)Kenumbe([N/Q],0-9)Abandoedit(Y/N) FilsizeNNNNNMemorusedNNNNNFreeNNNNN ||__^W-____||^O-dsCR||ESCHelpInfo |^insert|^reform||^Q-|TOF||2":/ 21!`35!~# &y#!p * ͜:! z\+-, ,!1Iͻ D+Y >D!1Iͻ 08:#K"M$͘ +BCDEF[HI8KLNP QRSTUWX!$=$~$##[ :1F•,!x *:1_ͪ%:1_ *A&))))+ :1_:1 /21f,ͩ21>2121!C/C*͡!1 *($P()^((B('@(/#(L=(`"(l 71 8|21~ m~!wF b1 8](Z212217!/3*!F#H *2"2:1 :1!121!1n( 4>_!(F#H $>_!~ F#˾_W x~ #x^W #!4"2*.%"22 2<222 22 2!"2"2" 2*2+"26 *2#"26 F#^#V## ^#V## @`0@a{_>G:1x = :@G x BDM*2DMR|^case||2<:22<ɯ!/C*% YN( (!c ( (#OGyH%AV=w=)=+>B2!}ր0>%_(2(. (M9(Jy(!w# 0@R*͢*g*͢* >+7R+*2 ڕ,*2[2"1S1!1~(21<21:1G 8[*1'x % (x:1( 80>21ͬ [1{z0>  :1( y !~(˾F#H !15, !F#H *2+4Õ,:1> :1g( !1I(u!14(oN:*2 *2K2K2*2++ *2+*2"2#"2 *2#*2"2+"2 0t" > 7> p ###7?(#+ 0S> *2 7?z 7*2+> ##>4:b?-* 2+" 2: 2(=* 2#" 2: 2!b(<:b2 2>5:2=(,ͬ! 28#$:   2=:2=!B<:2!`<:`22ɯ ~#(  > 8)T] ~  > 8 > # S2 *2T]  >0~ ~+ S2o<'}͖*2#w"2͖*2+w"2!" 2 *2# > *2 * 2" 2*2+ > *2(Â. ͹ͥ=!`ԇ.:2=̇.͖ U.m" ͡.L,~(6 +#"2ͫ ( (͂.>2 2:`=!B!2܇.m" (~"()~"č"( )~"č": 2t" ̓"č"  (̓"č"(m" )=̓"y++4*2~( (~6 ͧͲ !1F-!2( O#> -!3-O#> --*2"2:2( G;7!3~(G#~ͧ'>21!1/C*͕͡,3O!>21:2:1́(0-͍%:1#>21:1(E:17:1f, 8 ( :2J 21*2+"2~ --x(*2++> ##"2- -*2~(c*2~6 +w~#"2 - x7*2#x8gT]#c> ͑;}0 *2~ # +"2-*2̀"2-s͖:>ͧ- A=7fͦsͦ- #G7w +4!#! ~(:9( ~w#6+6 +6 +6 +T]+y6.O) !15( > ͜):1O*...  y!1(> ͜)]+:1_ -P͜:1 %:\%\ͪ%7j2)Õ,P͜:1 .!/3*<8*2 ' '0/ [2"2#j2)-:] 7!/3**2"2221y21Õ,:1N7:1=!L/C*: 2" 77!1721Õ,!11 :1=!1 !1 * 2R" 2:b7M*,)!)!/)b*]+-<`i/͑ *2#[2RB/͑ *2[2̈́*2[2̈́ /͑ !/3*Õ,{z~# (8:1k!p *(-*2ͮ!" 2-*2"2*24 - 8 *2> 8 *2>7č"(͈"Ē"(̓"č";̓"č";-:b=_!88<_}+[2S24: 2Ú-:b_=!88_Kڰ°[2S2: 2Ú-:b??+ (J ʡ Ͳ-!26 8$:> T]4 +~ 8*2:> F T]0+ :>w :>T] 8S2+x *2:> *2:>T] 8S2#x O7 9w DM*2B`i(#S2 -K2*2 0*2'*2+4Õ,P͜:1 !/3*  RBK'j2)Õ,7!\<2 :1:1:1!<2\ ~21_#~21#~21 P͜:1j2)Õ,!%/C*>ͣ7G!~ w#!~[(x &7212)Õ,#~W( A(N7212)-!"1:1N(>2121:<)!11~(6w>: 2G:1 ͧ:1=Gm" )<ɷm" ;= ͬ2 2t" >GK' x!BG>8 0x+6 :1! 24K>2 2Â. ڥm" ʥ): 2=G: 2V-4:b! 2G: 2w-͡.L,Kq.͹: 2͚Â.͡.L,}+0*2~ x.4=*1ͥ! 2 8$m" ( ~=!B #+"2͹ ( ͡2 ͕,-O!21>2!2~!? +5(#T]#@~ #>2!2~- 3!2yOxG3*2"2*2:1 # x3:():2=(#[2> ((:23 Y:22T] C1'( | } 3 K1#:2=G2'(!?  ͧ- +IR_?8 -v*{ͧ{ :1e> ͧ-:2!B=!`ԇ.:1i:2 1:1N( t" 7ͩ. 8͂.)͡:1> ͧ͂.> ͧ: 2!b .m" (-:1> ͵> ͵-!2~-:2!`̇.*2> > -:1;BDM(+S2S2#"2< 7+#RDM[2N'S2 -`i7B!ͣ:\G:1O(& 08l:8 @8d0`G1 00ROY !<2p#6?>2 6:3(ͱ*:`2 2:b=21:`!1wgN <2ͪ% 7<2ͪ%a_1= *5"1 !"12121!1ͫ(F:b7?ͮ= f,;= W:3(ͱ*]+=2b-:2!32b-m"_A8 [0nˮ )-!1:7(w-!1!4~/w!2ͫ:2!1 !13)!1ͫ:1!1 !18)!3ͫg!b5-:3!\2: 5t" ?- m" (> ͧm" )4I(8 ͔rx=J ?)=:1= t!m" w̓%͜!8z!͒rh!ͥ! 2 t!m" ! ~=!B ͧ~" )ͥIn!n!͔m" ( ;   ;À rÀ t" Ft" 7-(R);!>͒m" 7͗" )> ͧÀ )!:1Ĝ͍%-͍%?͍%C:4(h%f,̓%0(7 07)m" ʽ! ()t" ! (m" )m" ;; {(#~˾b%>1)!T/C*͡(cO![/C*% Q ͟*b%%y( !`36͕,*( 08 0Gx21h%!`3"1>21!2~22~į>2`3Õ,:1;21%!16[(+](.>(5<(<_!`3~#;(;{ #"1!`3"1ɯ21_r%h% 7) 7*1++++"1>>2 .,;:?*=[2h2|21/21\ͪ%< 7ͪ%\ͪ%'0!:1W >~ :1(d/21~ ~ (0˾> #wz ˾~ +~(5 21!!>( ~ 8~ (> #wz#6'21 %:\%!] ˾#:1(-!\ ))鯆7G#^#ͫ* ]>  ͫ* )M*)b*3*: 2_-:=!: *>22:=!: *22:2!` : 2!b:<0?:2_ͫ* _͇*z22:N !!F+z(  ͫ* {!F+ A(=!F+!:R(z_ͫ*#{_-S!b *2zȯGO_O(3'- ( ͻ-{!B<_DWDG > ͻ-'ͻ-( (3 0L@R*͢*g*@y (:1( <͇*{-:` ͢*(> ͢*{=HG!i *:2!3!b S->͢* > ͢* > >>> |^insert|^reform||^Q-|TOF|| ͧ-*2~*2~> !"!"!"!"!" !"m"t"~ #,;/-.?!:  !s/C*% 21N(Q ͟*%07 7W>!`3>_!z(N%:1;%_m"ʆ$%>21:1 *1^"*1^#"1~< :1 !15( !`3"1{կ21r%h%!*6!*wÖ.{:2 /!2į!*~622:22*!*~622:22*%*"%!%"S!"14&/ð>0ɷ(%!:˶#˶<(!()!\!1ͪ%ͪ%\ͪ%212h2|\ͪ%<(x(!'!"(aw:1W 3~ (& ( ($21~ >21:1 ~#\ͪ% A!:w > (| }N(N((6#\ͪ% \ͪ%21>21>21!1!16.m" :1t"  (ݾ8^R8#"|6#+| !"!!!1F%0;:;h%21!1F0G!(^#~#7O~% *T](\O>: S++~08+:0'0_+~08:00W_+0_{21 }(~ (A8G_>8A{<2\>:> +#(]#(j.( (A8i[(C&( > *7ɯ(@. ##(4 (87[(&(~ #~[ #~(A(N(W 21:] (!' 18*2)͵ͱ*M**b*:3(ñ*M* ͱ* )*ͱ*:\@͢*:1 8 >1͢* 0͢*>:͢*!]~ (͢*#>.͢*!e~͢*#)*>[͢*:1͢*b* (0)_! 25‡*4: 2_-:a  ͇* ͇*:`<2 2͜)> :`<2 2: 2_~# ~#G> ͤ)͜)R,q,͖%ͱ*M**28,$*23,-: 2o&3,b*à%ͱ*p ͑ !p *1.: 2GE1–.:1! 2(G#q+(,1–.-21/21͗,:b< :3Wͱ*: 2(:8_K:`<_: 2GJD_}:`W<_:b 8(-: 2GW$K: 2G: 2=W:`<_indSyntaxReformat I/Workin] FileFindChange toDriveOptionsColumnMacroRepeacoun([Q],0-9/*)Kenumbe([N/Q],0-9)Abandoedit(Y/N) FilsizeNNNNNMemorusedNNNNNFreeNNNNN ||__^W-____||^O-dsCR||ESCHelpInfo s$1$*"" !eVDE(M) 2.62 INSTALL (11/87) (c)1987 E.Meyer [Opening !] !l" \<!&\ *&˽aR(>M2!+ !!$$6:# ʁ, !# +!##( K(P"<   "<Á:-!$"P(DK  *$PR!$M(> *$`R!$'` *$`R!$}'] Installing: !& ...Press to see Main Menu  --------------- VINSTALL MENU ---------------(Always include leading zeros.) Byte strings: If fixed length, just enter the necessary number of hex bytes, 2 digits each. If variable length, enter the # of bytes at the "(" prompt, up to the "[max]" value !a}'͓!"&!(T]67!(!#'` Done. USER OPTIONS: Create BAKup files: !&ͪ Default file mode (W/A/N):  Default insert on: ͪ Default ruler on: ͪ Enable hyphenation: ͪ Left margersion Currently "!'" Choose: dit current or ist terminals:  E L  Terminals: press to select from list: !(!#~#Gͺ Y(`(End of list)'`Selected Editing installaI/None):  [Non-ANSI] Cursor position sequence: ͘ Delay after cursor positioning: 0 Insert line [06]: ͦ Delete line [06]: ͦ Ins/del specific to line 1: ͪMemory Mapped Version Terminal ID: !'V ͦ Printer uninit [07]: ͦ Toggle codes 1-4: ͘ Switch codes 1-4: ͘ Toggle 1 on [07]: ͦ Toggle 1 off [07]: ͦ Toggle 2 on [07]: ͦ Toggle 2 off [07]: ͦ Toggle 3 on [07]: ͦ ption configuration ey definitions erminal installation urther patching

rinter installation estore defaults Choose option, ave, or elp:  ͣOET PKFR?S Hàó VINSTALL HELP -- press ^C at shown, then the bytes themselves. Characters: type the single character directly. Text strings: enter text, then to end. For all items you can either press immediately to keep the current value, or enter a new value instead. (Sein col: 0 Right margin col: 0 Page length: 0 Scroll overlap: 0 Show system files: ͪ Fixed drives (A-P): V Ring bell on error: ͪ Use alt video in header: ͪ Code for block marker: 0 Wition - Generic Terminal Version Terminal ID: !'V Viewable columns: 0 Auto wrap at line end: ͪ Viewable lines: ͦ 0ͨ  Extra DELete key: 0 Extra arrow keys u/d/r/l: ͘ Clear to end of line [06]: Viewable columns: 0 Unused columns in RAM: 0 Viewable lines: ͦ 0ͨ  Extra DELete key: 0 Extra arrow keys u/d/r/l: ͘ Terminal init [07]: !='ͦ Terminal uninit [07]: ͦ Turn cursor off [06]:  Toggle 3 off [07]: ͦ Toggle 4 on [07]: ͦ Toggle 4 off [07]: ͦ Switch 1 [07]: ͦ Switch 2 [07]: ͦ Switch 3 [07]: ͦ Switch 4 [07]: ͦm Select <0-9> or ap; or to exit:   any time to abort VINSTALL VINSTALL is menu driven; however, installation functions (Options, Terminal, Printer) require complex data entry: Logical: simply enter "Y" or "N". Numbers: always HEX, usually 2 (sometimes 4) digits 0-F. e VINST.DOC for further explanation of patches and values.)  RESTORE DEFAULTS: This will restore VDE to its original distribution state: default options, terminal, and printer; no function keys, no user patches. Proceed? (Y/N)  Y!F&ldcard character:  Clock speed in MHz: 0 Horizontal scroll delay: 0 Fixed tab display spacing: ͦ 0ͨ  Variable tab columns: ͘4+5# TERMINAL INSTALLATION:  Generic Terminal VersionMemory Mapped V !6'ͦ Terminal init [07]: ͦ Terminal uninit [07]: ͦ Alternate video on [06]: ͦ Alternate video off [06]: ͦ Alt video uses high bit: ͪ Output filter limit: 0 Cursor position mode (Std/Rev/ANSͦ Turn cursor on [06]: ͦ Video RAM start addr:  Z80 video in routine: ͘ Z80 video out routine: ͘ PRINTER INSTALLATION: Printer ID: !}'V Send LF after CR: ͪ Printer initialization [16]:  Zg20 2 New definition: ( edits, saves; use ^P to enter these) Ԣ͓ MACRO KEYS: (b!N(g!M(g bytes free)!O( > 02 ͵! (0((w#͢>8+~ ܕ͕   !>w7 :W:_!O(z(N #= ~(^6#DM!M*BDMb{_:N( :M(s#K!L*T]BBDM&& [Closing !] 2h2|2.2B!&\.:# ʦ, !# :-K(.P(!`"$!'$`(!`"$!}'$!P"$!O($!$".] {$ *Aborted* î *File) *Read *Version  *Write  -k}8k0!wG(4# : "͆8w͆w#[KH!: #*KH :#(B)F#^#V## ^#V## ?: 㯆#O#O  OLMANSI standard P ABondwell 2 P TINS= ERDEC VT52 P KHJERMorrow MDT-20 P TR= ERNEC Starlet 8401PTg**)(S= ERNorthstar Advtg.P ERKaypro II/IV P0 0Osborne 1/4 P0 Osborne Exec P0 N#! Choose o-repeat or uiet if desired:  ͢N(Q +~#8#+b !!O(>ݾ8^R8#"M(|6#+| !"M(!O(! O@O^#($#~~+ ~+~#G~#͢<> FURTHerror* î 7 <(طͺ (.!w# ( 8w#6 #!HH ~Y Nͺ  (Y(N Oq##~͢ͺ  ( ͢w###gʳa{_!&~COMVDEA:@@_@@#7Teletype printerGeneriHJSY Commodore 128 P T)(S= EREpson Geneva PX8PT  S= KayproS= LMOsborne 1/2/4 P T)(S= EROtrona Attache P KU&U S= LMTelevi.0.2˷TRS80-Holmes CPMP ?{???ER PATCHING: You will require DDT or a similar utility. Addresses in this version of the program are: User patch area: *&&-:&_+& Command tables: Basic: *&& ESC: *&& ^Q: *&& ^O: *gͺB8(2%B8(w#:%w###|h}hgͺB8(w# 7?͆؇2f͆O:fA~|O|O0:0 ? ?>2C"$2C"(*g)*F#( g#ͺ!6K:x(!w(Y# c CRT P N ADDS 25 P KkkG4G0SY LMAmstrad / Heath P KHEHEpqSY  II/IV P S= ERKaypro 2/4/10 P B0C0S= ERLearSiegler ADM3P TS= deo 910+ P TG4G0S= ERTRS-80 model 4P P S= Zenith ZT10 P Ts1s0S= vVDE26.DOC$ $Eb!d6 0h*"R(I7·#i7cy@V4 s8 'i:JQrEJ\6p7'AR1ԨQpey0M- h| 9dȀ<6´2!R0^ :HxFM@fk ,7hm7E$ (%0Dt:hyntv 8 AH"-hJ`+(;A硂8r  fɼ2 m ;Z(enW5f> $چAZ*CͱN Cdo|!1)Q;lrS aT2B52fPgEQ!D_Yp>8"  %F&]"5S2}Rza7g12aKrY،548l JԂ0OMNGHXRwq pIxKPYN( (w4-ą=P`Cf2)BjrlqMMcr[.Pp0.&hMz$( B!Icb^GfMH> BUe%+)H Vb27f81JBHw U+p(fPjQU`/)(`F3SD2٩7Z,a(^a$"3:aPPpQ`r/;_؋E|4/IEZk4q-H L_$(srA+ta+z9WrT߮ǰSHŹTUY2ce*([0C9 95&T#^TFI%DWvI"T.#BA?c)U: ZҭL[bI`C 0ϡnAGm`@ Z9K&|-03CT.䜘  cn81V9>,,?,3;TfO]u2q6A ?`,GL|BYcBE㝰,`wF -")a*B!YƅipBE -AGәd4=B2uO|ʴVܹDR+1;8Ư;r,`.8U,EXEIH%$"h%^+@^ppnh fcT(tT AC?M:2PA *"XX^sz^Glq&)?ӄ:0h z^DEV)0BAIA)FiG_n"RMaх@n9C^ou4-d!DW2c86 a(Puɸy\!)BIYSHIj$≡we䨙WMX/C@TaJ9ꝣ lb8+{G8QMT-d 1 t|e[JR8W2k7[1RKXp߲;J4$4z`'&:MQx4b= UupqquӬja, Zd)mRrR4D@7U`z@Pi=XmAx&Aj X;8 ?nJBP%4ܰ\U*IoAhY9!eIFzh.LٛSnբ 4a6Zϙ% im҉IQ/eR)$g@@΀_[RPQ#!N߫2QJ I!ˈm?SJDO#@ wHo ІaARDRA@ hRqډ4En' py[Ij6@ +чK`i>_ru9bZpe`i>!%:pAZ4y%d//r9+׿54 ,AH4r=q!X/5d5r(qD5s ?$'*w|dFwf"{v&8іRr2h3V\V k2co&P`>[1)B -$a-'7 b1"1E)Q 5=8V"B8WQɹ$Rs&R~D-2$I(e2ATEs=:oqx1W'qy&jq꣩9 sr!Q恠eMcEhck5Mj䆈ɛWjM1M$(*99D9&ms[ 915(T#c-(l,jK1vXcL.{3A%U)%Cr@EBG$oYG$ Uy@CrYީHB$1X--9~aú!ͬyJJ qMK lj-1 i?kMKvha5|;}>1 4PrD:a!vZ&H4AqCrS6SGQZ;ND=Y~':[p&ECv`N+S G6O= hHt+1ZZo*[ו|cc!9!'< d2nT&E"RlH ɔooB+pYՓ?U,[$,s$Azmqѧç>3A1!mruW**Ba[ax'Fç7*J4(]RS$S!3.'ccCo;'tK&;*x&PZD…/BNzUrCXꏙž?ԊQ#0*M1CWES>&Aqb[7;e$0S&#C1撐3,$QޢT1xy#:u<-QyQ/̮& UU&D8D?A!m=`u讔2a*bZ6 /zÕNII#A/3xA$X[m !a")2ĂH #9e6sCS#Q%+0'mS]H/$#t(z# *#Q H꾤n4$G:uEa#.O97*D5l4B)dA8B06iMLB3q8*=L_qA$6;m3r_@_0eV1"@2&!D(07Ht;3|m3r_V!1"@Rftv&UK"VLm3r8p"?ksltdX%%3K'D>BF=aP^3s$SWC RtC!D`LPSg &,o;hk IpH")c꓉dO1zW31< RMaN/tQXT&[L.4$P:sM?:0.)1ԐbM7`T:ԍMa."`h$HA-IUOm$41#ԏ1[ax_i1{H WRdA%?pgs-놓&!!// (=bASCVZO(.HeMR.uu\D(*{Q%'*mL9lِ, {$8Ә=%%4!(FՉ4e0 ^8 Lpx q'#ͱ}WW8bg!3/4GDvG4}u%;o3?nBI~4^e;)eU'b^ ooSosOƫoC\ɖ[HV Ю`aӔc`yF$+7?ڟb8Kahli/i##XJ7BKC3(B/y .__Acmrbb;((@'+xf0Uogw`m9D[W՘ԆֳɆ`|9<lTv{WC+`f>*ԡXz襣!a;Xȕ-:;Դ;,y`INf(iSNQr;H%fI%K/<[q2S6>!)ZM7BC-e$4/152Ӗ#MsqX4 BFػU"ZnKpNh[¯VDBާRStQ`Hjt&Ys;a^W"c I35Ec@ҎT[)S3^*v]/1z~B!C 1R;;iۙ3ŻBMM4f{<;9<"g}5'^A/y# Y"Pyx$<i1`7Q‘gAx9,B3QZ~""c.n)ϡOy5:QbjGk7>'4]N4!:|j#D94h0Ԯ<'~)A|7$NdC&M$ԏQ=e9` ƞiCd$We:a ;WBdfș/ 3~!8wřꕮznBm6m+| &p:~#юv ٥{$|fs#/>]?He/&U`H~'og3~^>ihJC&/1sA$1%"T0tH_\uٽ- R?#[T8C7եF!|fV-SBYn+x2(͋:F [扉p YOz.7:ݷ//\<`17yjH Kh+)^0_.%ԒxEI#}Wcr,m|}jd}PohS>&{<>>Î!kna2իئ,Pr&@N%ň7u=h(`rHGha`.(oR0(/e֘&MxA'Dt/a;b)V&SqeDO#7=9YqYH'bTTs_rdȢl,ҝ_G )iݐ&MQAd4 H ">)&BS1M{y!i PVwǐWbPx.a4ż@UZS- u_U#ٰC`y9[cqrnxVmP,,&,bs-f #7@>qFm;l.%9*J   DvKc*T;͒49:)7q,J)g*Q$qSpPnd/fWT$H[rWąYz#5`4":=ݓ YT2A!m.(enoA^0UTռ9g9|81djlA6$c PmLAI Lwh^MZ&)RX1?p*m O[p8'QB}) ;A(saڧ [I3Bä\KX43yJ=ZUT-IOAYs>ҷo,DRN+pe0 TI@(m -TpcnhII;2A"A]n; ]"v:`IpO-*}*}*ptv2 V0O4ب\xD尒1۝%% &j(ۏ(T.1@*;` a[)4'e$g& #Ē3"erH>Z1_+_KEq*ΠWG1 `ZFh} 5BFvE+W3qZSnI~#~*(νR'7[*iCiIAa`RQg((iM"tDA9 8AoTb62ϐda!;A]23Vo7AGqC*=D"H.BY4>~ o=,msHzaDcdHAEf~Dxzqѐ?JyT(Y1|'7bQseTje'KZ<+pC75$3zOb(IC`e!'&"UhUB3|bHXr`ug,V0iʂ1A5k3xt1?$(0G8?eynDyKYs߳i{y{>l{i2 "63/$"Aٝ#וSF?G4AL&&r-,qs25' E#CM#.ͬ^#C!B6@8/Q*JK/rU\9 ##Sj#`(fYA•!DvHP8~*&5Z:H"'@ӡ?_4>A:s#%?ֈkማ:,`66?A::6@m̸i;̚P>OGF$8/bcݒORX4IB@9xW>4/n2gėO,.hᇤ ]5B@,m݁|Q1Ș`L4BA520, F!FőR8[&fLQ 0Nu5{N&NE7M.X6viGT|^v6*"ث=ړB6%1o"\X/VXf)$a(]C"4©(Hj 9rVn4_!qc8 -q(B?ΠRTfvTGY26Qb rALIMH7צos6 VH YFc<싣Ŵ`Pg[ N׆0U )z˩]M!x7i#,%3/d4$Br"$y@cdy>Uڮ+y@Ik?a"h11d` ;+p^u} uٽVto5c%/ef=)ժ}$Q$8үՊoa$f4g@j" KNSn4'!}uE ;-57Q"2{%,nHb5{-0ǡN#sB:) )a|۷`T 2 $W9VJTHՏonݓ &`d 5KxwSBap2\MIɒ6#whEdO` O1zwATSk'dw#8s>Ne. SC)U"qsFMf84*CBa,p:]8 [g-ffhH|s64=0&EYE&EQEO7tlM+B<΁M%22>;L,,aweĂl!4~]]QAWHQ8?SS?-] gY[LF0R֑1wSp $G&LWEn1)̑D?2}>=1vD3A*NPET*.vwB>n84)F)M6Ovn7~t(B04 Gp]|s[딓m>#X4ZcX%@IHK`4Rb#[(^H)S2\9N'=AqZ,2ޭxTtӧW@t268$I:YI^-Lc"Lq$+0-C,N\7HY4Ӓz<`EqW67&L-_<䅖֡R\ ,2vn-{i1I͡bN<4+Ag,";7p.b,jKi#**]#IMU!)77p.4A^Su .-pd6a"A!4K!eC"CLX:`5CmQ + 0! P\ +q+4p=!?^U[¶H]ERatʕ_M0"$bE$Bpt  3"pIk;Ώ   MDD1(Tuns'C-QPSE~[{ 'LUNUMn\g"QE5>#1R~ Y<ԙc_A$Ώ+_oW ~\A8CT]:q'~)42bm| J9qqslj"@HW(҈j/-Me?בC~Je">xICy]6ZMX'>^4mޡ3GE5Q0VDUr,>.2ao H*O$AL8ԍEDU攂^Aojer4X#/X4/+M,et6>c RӺEBLV(RW5!h7l HlV "f2ir/^ (%:o-#HeHW4RqmAO]#VL(M[s]<5 `APLFh tw I.Lyc»Q2<&4+4"aa!a_w9QRBg_]0=j9s`_V;&p!gYHрAnB'h] \@OV@:F_Me4.H܉7  !.5J Ϛ1/cQA㎶9?{zcBKR8a$h tn2xC-9c:7npݣg?' *9c+pYzNpwd9R>9;$;R*3(G&k!t)|M]Qh9?ӯ݉R0AC8-2ax>;(^c+2m'o(L1*{٬:Z9C7b| "[M"WH?y͜uzA/z#'tM`qKSVD$P'cxUyiC@Q3KEiv`Tw5E1AlHGo[eIEE,;xWȗe+&" dQdɩD1ˆ<<{PM`X%@O P (_rjzd@P)ěA)fNQs-I #AlIvWL*y35bG]DLG?w\-UZ3p.5uQPI.Tێ)RQb2}JRZ5,+p"Z!%g(Ro{-d/;8҄KZ_>]~?I(,3^_Ay(͔rOrljxC##,B#KR)[)_B{*%-X68<-Jc7==G2B:&^dG- GEq9I7IB#uxgY42A[ { PB˂q@(e-( (Y-= ĦCףģ3⫈Atެ#('!! "Rl{<2.Azv8A݅hQW"j %t1S)CQbHf)_JF.0oIq2eA0m+v2̻|up@"1(D% \Ξ&mA$m.^vm_g|}w,Kg)5jF.޾v;/`zCþT!i!h5kSl'`4-Bni0Ǝiwbkuo4@1GXܦKO%VI +AKlV"VjOg38Zxh=cNmmt@-V` L_> H W?D,;$_GȇAPM8U~a\IոRo2ERnsCG)t2)|MZ#0noAg*e3ɑH#< [-<"04& ϡNϰ I$fhVCc }$a}~90hڑeY12WnQr~;4¹""ICӡ>XzFQ E=.CRúȏ1qR2)S{/rSqyR:q(Hn:  U^t8AoYPI+ /%lfr IF>s:!-8 ;[_,AYQ@8*E^Elž*㕟&8'03ݯ]#ю@Z!̗IsW%,hB(锷Ӕoi1+L /dAD-T;eFPNK0IvhoNϰSga H$|H!Fgv1d`Tr\Av =HvAf֛t()iĔLv2ir$&p<@nvE!ߤ2"iTgk G~`FvܶϤj""dvlQ0H'^ ϤgfWA,-\$h2aE)QEDgn!bDUQZ,.r[q'#z/?̋cUs{ A=)%B˕G(4]@d!˗JigMqQjP P;(%,b(5s}2(گS Ftuvc*lt(_C*65=}=p{&(.( HC )Aw$]/2 Jj* ?9u"( oaWr݈ElMH,AZA8b@r[O2."dCIf"ZN4>b>96k5iS&&:$CUE0[ zA^r>dB=Jb!J4mL;h(mS!co?YA/@B8G}m4D2M2Y˷ϑ*>A}AtNaK hVtD|.uy@,3kv'ŸG'+x ]BJu^JOe0z-c"K;p W7l &Wz%#DlQAHRgp0[e%"/$R?O(oa`k'côW+t)$S#9{ƣ3uNM/522Z; `rZIEeX4If"PydeL28LEBٍPBPFkŢg,{_Ejo6T,=>l4|#*~[zg88L叹.4tHv1S s?鱩=3MBY˴2yA!#QtZ)TM"QrSL9BH nPƟsT^8EY1Z$)he4#y`q|7n\q!DG0 @7FԄuG[:45100Y@N bbJd(@l׺AqonaHmcg)VdEu_Vc(zBL`|eH\I%xFu}U=Vౄdj'nj q2!,gdeOY[lV>|Q&khsaY[ƑgH1DC8HdWjoDwjԕƉzD$fqfh-{l:IYUcWQ{=QWu% (ʣWRD7cX@iגe ph.h9>; .Е~LyG^Ah)P@Gt DK\^E 0Xb@|-2a$'@Q[ @HPD"EA(T0bAȥdȳ*qON$)`BbCqrbꜰ7TM^!O0B3tӗr(b#ydQO%W, FD=n[W@#+vVINST26.DOC$ $%bI8T By  EԀ*% gSe6MA +v%H &c:Mqr!Da0@2 @n/ 30pa6 3<6N Vi2eDCIBaLZ& b  SɔyH'1pr4C)Y+.OP"&b0&1K i[ML4Ah4G z 'T#qx2CF[DwzeuFtQ-fcE`RMݚZgA)!~B -YߵkLYvXJK&s&IhFPvI8*Tut">⫯n)]ڴw)!,\C50[Od(wuWb!;~D $@ya7P 2# "_m𲳷;@RSz 3&|@e9SrE=kyB35NBJ>a$_vugI dԫ 2 +hJ%ZraO3{xÐs4Q?T/Cfo9Y07*lz2[>*ggʭ t4^2eXjBM &A.M`Z$Gm,Vlkxa9YWʕs$70#Xk|}1x\wy4'b"dr#i-'T_ri֟!lW,"v |Z CXPHv̓,HkU`uH pZN\m04NANuK H iW79l>[c'ih=ua=l2k }-=q_Ɲ$JdMiM\7"dIމPeƀN|#1yw3r5F"(AWjrNQtqYA`愮3IThR%r*0GeS9{\xs$n݋rc>)0̊%yH!Ƭݍd:3" -tᶷMI r1Az/DjXxPY03qcCg*̫i4& cN6n x( CO&Diǝ#" "|u69BrHq00 ),z,t+2^e"v@I2a]!%"A^ACքX=H-mPScTO3pCh  AsP(/6*#-7D($c7بd"GC,6o9u*Ka&a N*irM! D!v/Wp/nf,X9H Wk "S )Q d5@U5 I4*Av`(/ri&5?s=B">nq 'ڗwnY;mPR?7Aw-"EQA(4&=1*uáTkgJ @na 3J9CqYP Q0: C'",T $[*^$na2d'E8§~!!#Q!z ,'D9(ѓ+5*Td"+7Xj`4JbhIՄlK"qxg81U&;w0A0Ms& MC5j7OX<39 )a<qI0V%h,+(=x,*i9I,nW7E<\%gQC@,,mR!t"TcMG8ALB%3^5iXD6h؍ITvUԵQT$$&YWvՖRˇr0f&݈Zz{QYSشZSiڏ9/FjRA5OJA8 <ߨjDhb ;w\tH'dD m)5ꫵ[9_%ʈ;ښ uaigQuB9^IN7ǘ_KlpD !"ʇU|oW|*·-<:Բ!ڶm*݄{4q׌X07?)Key\]~E@nEm}=#1A$cVXƪ/P=E_P=YnU>$ץ0Ci-RNC?,xy˙i;ں!;)' agKQQH_ SLU{-!"rMqԈ[x6Kq8ќn/5 .B1 [K*"X"l3 6 Y[q)X룕3"1oK,#i0-y_'wʃR7}QrFwq`g'h:^9!-4Qb EC|R-[O%p˷ӎ85-7޸Cz'X=_LgG%~6'%# UQlCK9)w  ⹿z2B)Lc>B!Oq?~k%A#*[9#Z\Hn7$pA/ݒXZ<&l19'ҞDAiwC-:]HzeDGt0#%1*ލNN,`_2ȟGa}ʼnw   MRPY=5^jx(diC^K.B_whĠ}fI@AgJ#Dw L[KnXEynyGXeTi;jqQUo~re CocHr0<pD5(l٠4R 0`0<3p1@ص=]\J$*+_N#]ita)2L\F]3)n6!QaSYMF2 )&f +Q+vSk<I#Q\Xm7hsrMwLuEl9}*Ukj $đQӯ G!DI^Os1g'^Kwjg`23TSh1zq*gCy%"fѥ0r9xhgMfiSqڬjٖW ,-tWZOM3K+ "wB8QuJrCK^!F!BACla@Iwڒ1n TtC$*/9SR$!ei)c#ظJs@ GQU=՝K}Ro8RyکZL=P#jҲut9J@ZNqPp1@f=^%lT1l$/%KܻmU1kvcY`"CWiMA,qO0/ !q\~iwL&8,/b^r@/Y&"0""8=xV_~xv"4f 5C4I" "_F umzqLQ3pSq8#$a&%DW u"H$WUh%؆}lѥH%Bq{?{2†H5~>rn%# 3(B,C~[OԒb"ߜAV-[k*$> #*LgN" ,* Rn%:Į P# $_`Gݢc.u-h'#N`Sw+ʹ6}O9FˢÎxM$#$i^&8tvP!F1Wu PJ؍Iж y%Jϒ^Q͛C0Rc!#ʲJ^qQ'^rDY_Tcp] ݰ6ze_-/"WN+:!m o"GA$s 񚂙&GJh1q'``ђ,4$?n޲=y|?6!j+j! fA#GyS < >0>^q97J4P>N.x|qkt $`cؼq#9-'-$qP<`>op7<3R[ ^C`Ti) ؼqM`!)dȮn21'*87 > Ԫ#:TND@>J@Yw;M_wR&i,U+&M3$x#aD1Y+P,wDlZtKNs"¨=2ʖXuҁ%+nQ"p^F@w -F^ DID& Madkeԩ|"hQ!-C43崽s'9GH LyfT?XLt=X*j,J-0^*MzT~%֚@d~prwen@ "ǥ[e^@u81D~[G>'Jl5n!6M? :8Ԍ</*Iw$yJy)X(A*/-X}X¸n!эu2P9Ѽȯ'@=OCO֬B©i{ĠI߀({C*<]d=x-Bn#ߞ趈g~Pm)}HeJz czEn럇ApC=2+L ڭ 3Mb/eIMEzJ&;DՎ ?(6M@Pmfiw<-gxr1iQu*$l>c<*lErgE5i,NSv5uf֩3;m&Ynjk'0U X;2!eӸ!8(3;2}h<3*GNN/L4 t|72CeN#KtP_oJFVќ{_ߖv=Ω'u ,$oHE6"?4]U|G~~@(8U=Y`֭I?r{'޷x?&<;>*0[5ةfP"@oa"'%2x2NMD/Q#qia9y֊;k3edIN!>!!B9QWERK*$WZOCѷbeE""tW토la< BHI#%MZ]!# 8iL0),D4$,F9)~H9#%i9ңجqgW_9w@6*&et"fܼPoc.-3@* gm`U T1РPϩG*.CbߡC^]kG䃚Hms,^a`_t~-4QgREJ3U-taDTI?*0SꟲBCT(Ne t2KXs =wL#D]ke ;]*Gl'#Xj'6l念$p(PXQ]yVRP=uſ!#>O3`APL@S}CℽCwBEr**U&I(g\cBGcd^2N*B >%ͣ,d4 5TCT>Gr35섧њ^H+-eT*bB<Jv-CTdIB]IJRӈ9]%1-iH:.3@{dKC@N*`ߒak/(D;YXc,TrRG,Wk@$;ݭ-p&/đ!,-sew'I5x"IyMO2-r!cgrר QcAMd Ǒ+Fס&Wmu6t@ =QLC D (tF)Mh-.(R@ 'cfXfGFi%`Z+3H`l$ hn ΆOFɐAj!0&CC< !S)푤]*L zp"]ɑpqK+(Z8(DPgGDxB(x 'ȯ`D20i.7Uo KA@R< sd-S([Tm mLXDA#S"J@5P^ QQ @=·sTgo06>j<䑻9aL.,rN|~۬nEq>>@\JR& .liqa1H/8IG\-)\4@`YjCCLjx$LBz rNP)|]fQQ1ގa0,%;NN|eȨ-Dl\9-]d$8q: ¢!ɱg0O1J[/FZ9EU[SATfT4 DOr2=F /0e,,Qo]ևZJuk;wOw`3;S+vXS8+W?ž GE&DHZVҘ i.ns7{!¬ BA^ Ȉp y>C|#dB}4GJl (X6%`ڞX*=aVJ!H}4iyQ]tAUEoR 7U(lK)aA t(TC} f9 j uN!\ʡNqv% p&2ā$$#d &UX#DrT3 w6F52pGb5Ƌt5",t13,uVur := "%/H5iM.DOa2 60T)$!%G]_h,9bT!A~+xX"  -R=R7 nRIuA,55.r[fLS!0--{daN;hBHVPz!ڒ68 P.$Eq\ey}KF4e^qT6N Ointwzg z b0ya,(WS= ]VI+GHHwkȯz #?4tI(D6wg.kMhHۛ=-Q;CWJiG2 1>B!l3Arם! Wexw@83=#eit*Np4m;39to)҃c3dGoi13HSaBvVDE262.UPD$ $Eb!d6  4 ELF* @I7#l|o79A R(@M2L)hb1h4Xa2 ! :PO!*I8TXbTc9LFq@c4TLZl iU,a9NY#%8!ĒRTC% eRi4R,|2Bi]y,`o6%7cay&٢C+Ɍ3.mY8Utsf H<vʅjD1HO| ]UȒB4SUB;:X hYRЀASFŻHreV%̐r;sݗ.e!ziTDgE mO]<FAle.?WT.mn#M&wFiiedn^Q8EeIKQl{s&A}Q ^sfe;<oPiTP1(E#&"'.O%{*#82F$QXF`RSx&O-Ճ'`(BW-(sU_`a'Kf6h<bK,,T;vLx&1'Lh^9QT2G҄2u?T S0(o$ P!:Pn`hOAFa,4X%" uP%6Qa'u%y2@0fn5s5ύHQegM1}h1A pUp !X(yEG cgǟ    N&5wK.Řq?!,1#?ob^P4fDZMT?%B]EdT[ l!eRPL[ 2щYYdY kyRE.$dHbn-gNCaqx8+JAWgd(Y;WN&wT,657V/'r<11a TEGY;:&g:{|T%`Ej*k*Q''а&&'#aN#$2E/mEn> = ^X = ^H or ^S ^Q, top, end of screen [Note: An alternate arrow key set can also be installed.] ^F word right ^R page up ^QR top of file ^QB block start ^A word left ^C page down ^QC end of file tab ESC-I info message ^OD HCR display on/off DELETING: ^G delete char to right ^Y delete line ^QY del to end of ln DEL delete char to left ^QU UNdel line ^Q-DEL " to beg of ln  block start ESC-C copy block ESC-W write block to disk ESC-T [^KK] terminate ESC-D [^KY] delete block ESC-U unmark block FORMATTING and PRINTING: ^OR,L set rt, lft margins ^OC center line  macro programming : ESC-M define macro ESC-K store macro key ESC-!,=,~,# ^W wait (pause) ESC-0..9 use key '{O br/@m`Z[5uihy[bDB"bj!8u V-3d`f;!?Lą^1o&r[F.t:+*֫ci&|aiq!r S0at/o@2rT'@3dw q;&h4t-a)le ^QP place marker ^OW window on/off ^W, shift frame up, down 1/4 screen ^OZ blank screen ^W, shift frame right, left 32 cols ^O make current line top  ^T delete word to right ^U UNdel char FIND and REPLACE: ^QF find string ^QA find and replace string ^Z [^L] repeat find/repl DISK FILES: ESC-N new filename  ^P insert ^-code: ^OX margin release on/off ^OF flush right line ^D,S,T,Y toggles ^B reform paragraph ^OS double space on/off ^Q,W,E,R switches ESC-P print text ^OP pagination on/off ^I hard  QUICK REFERENCE FOR VDE 2.62 [Note: the ^K- and ESC- prefixes are largely interchangeable.] CURSOR AND SCREEN: = ^E = ^D ^Q, start, end of line 2":/ 21!35!~#;&!]1b ͎ D!("(" M+-H H!c1b DDY >D!f1b 08:$K"M@$ DBCUDEFH=IeKLNP QRSTUWOX!$=)%~-%##[ :1k^,!xJ*!J*:1_%:1_ *A&B> 6 #= 'd !1 <212121/21>2121!.͏*!1D *($P()^((B('@(/#(L=(`"(l P^ 8|21~ m~!wF b^ 8](Z21221P@!1v W 0O!"(I!( 4>_!(F#u $>_!~ F#˾_̈́ x~ #x^̈́ #!3"1*.%"121<212121!"1"1"1*1+"16 *1#"16 F#^#V## ^#V## @`0@a{_>G:1+> *1  *1"1*1+9> *1 +*1R"1:bP͙*])! *!/*ͤ*#+1ê-i?`iy/; *1#[1RBm/; *1[1ͱ*1[1ͱ [/; !P/*1^,{z~# (8:1Ĝ!pJ*1))ê-*1J!"1ê-*1"1*1aͪ#!pJ*!J* :1 #͉ ))<:] (́:1 i*:1!02113^,7+͞+7.G%*.<Ͷ-̈́ <pV_ bt s = I   (?:1͙%Ͷ-21:1 Ҫ-:<*͙*Q)@*[[:1))))=+ :1_:1 /21*./,7.=!15#~T]#`(O!14^q{8>2a:12aɯ!=/͏*J% YN( (!c ( (#OGyHJ%Aʃ=ʤ=V=D>B2!}ր0Fu.J%u.̈́(2(. (MO(Jy(!w!.*!F#u *1"1:1 :1!121!1n(BPR+*1J6^,*1[1"1S1!1~(21<21:1G 8[*1Tͥ % ((x:1( 80>21  [1{z0>   :1( y !~(˾F#u !15Y !F#u *x= :@G x BDM*1DM*1*1K1K1*1+++*1+*1"1#"19*1#*1"1+"1(0ͥ" > 7>  ###7?(#+60S> *1 7?z 7*1+> ##>4:b?-*1+"1:1(=*1#"Mê-68 *1>2(8 *1>-Px>21J.6͞" V:1=G:1̓Ͷ-4:b!1G:1ͤͶ-".,x-J:1.".,ͪ+0*1~ -a=*1!168$͞" ( ~=!B>>>>> >> > 21C*͙*]* u*F*u.J%C*u*ͤ*:1 !W1b ̈́ D  !Z1b̈́ DRi?+' S # 0@͞**ͩ**' ' >+ͮ* ͮ*ͮ*6}րJ% > zbk~08 :0 #x0Gx(?(8( 530/0( =>dG0( => 8G0(=(x7! FNy(-B0 ##>1B84 ##NFy(>0}01+a^,:1>  :1g( !u1b(u!14(oN:1_:1=8c8`:1O:1!18˶N(@:1G:10>F>  = *1:1Gj >  :1!1o& ; ! j  ̈́ :1G7nnnnn (.(:1ȯ21ͭ >21:1W :1(>21 !":1W >^ 1:1!b(<:b21>5:1=(,!18#$:1=:1=!B<:1!`<:`21ɯ ~#(  > (8)T]~  > 8 > # S16*1T] >0~ ~+ S1o?i?@}*1#w"1*1+w"1!"1(*1#"1<(-*1~~(˾> #+"1 ( (,.M=!`.:1=.6-͞" ".,~(6 +#"1 ( (@.>21:`=!B!1.3͞" (ͯ"(Vͯ"ľ"( Vͯ"ľ":1ͥ" ʹ"ľ"      (ʹ"ľ"(͞" V=ʹ"ľ"(͹""@(ʹ"ľ"tʹ"ľ"tͪ-:b=_!88<_ͪ+[1S1a:1ͪ-:b_=!88_x[1S1J:1ͪ-:b??21:1(r:17:1/,:8 ( :2{ ~:1?:17͙%C*͙*!i1 ]*7.*.C* u*ͤ* 7* ʹ%217_YN !1&!C8#~=!`.:2~ʆË:JPO!C~(0#+q!IJyH&!C(#P6( @ê-BA=Pͬ͟ê-B#GPw J+aMê-!16(8$:> T]m +~68*1:> F T]i+(:>(:>T]+8S1+x 6*1:>6*1:>T]98S1#0H [1"1#J͛c)ê-:] P!.**1"1*1J60*1(*1+a^,́:1 !.*B RBK(͛c)^,P!\1 :1:1:1!1\ ~21_#~21#~21 ́:1ěc)^,!.͏*>PG!~ w#!~[(x;&P21c)P!1P21&^,7!11=%&:1=!~1 !U1<A)!11~(6w>:1G:1 @:1=G+͞" V<+ɷ͞" t= 21ͥ" >GxT x!BG>" (++͞" V͞" tt {2":1ʶ-+͞" ʲ-ͯ" tX?ͯ" t^!1:1=G:1X͚"(+ͣ> +?ò-*1~*1~> !"!"!"!"!" !"͞"ͥ"~ #,;/-.?!:  !'/͏*J% 211~ wê-:1 !`21!1~ wê-ê-!.͏*2 ^,ö-O!21>2*!2~!? +5(#T]#@~ #>2*!2~ʶ-6L!2yOxGL*1"1*1:1 # xL:*():2=(#[2> ((:2L  Y:22T] C1T*( | } L T]#H&!`1b ( D!>D (P  @ò- Dz܃_?8 ܲ-*1"1Ԯ*{@{  :1•> Ͳ-:1!B=!`.3:1ğ:2 4?:1N( ͥ" p7.*.68.V:1> .> :1!b ͪ-͞" (ͮ-x BOP 9w DM*1B`i(#S1Mê-K1BDM(+S1S1#"1iBP+#RDM[1͇@S1Mê-?`i7B!.͏*>:\G:1O(& 08d:8 @8\0XG^ 00JOY !1p#6?1 6:3(*:b=2^,#~W( A(NP21c)ͪ-!"1:1N(>2121:1= *5"1 !"12121&!1(F:bP?+ = /,t= W:3(*#+=2bê-:1!32bê-͞"_A8 [0nˮ Vò-!1:7(wͪ-!1!4~/w!2:2!x1 !U13A)!1:8 +0x+6 :1!14L5ͥ" X- ͞" (> ͞" V4z(8 ͣx={ XV=:1=+6ڥ!͞" ʤʹ%!8ͫ!ͣ(ʙ!!16ڥ!͞" ?! ~=!B!3>_!z(N #= ~(^6#DM!BDMͪ#{(I: :@s#K!T]BBDMN#!3:1N(Q +~#8#+ͪ#^, !!>ݾ8^R8#"|6#+| !"!!!1FJ%0T:T͙ K1#:2=G2T*(!? y++a*1~( (~6 M!1Fʪ-!2( O#> ʪ-!2ʲ-O#> ʪ-ò-*1"1:2( GtP!2~(G#~@H>21!.͏*^,2O!>21':2:1ͮ((0ͪ-;%:1< :1> > î-!2~²-:1!`.*1> > ̲-:1t21?*1+"1~ ʮ-ò-?x(*1++> ##"1î-6Ͳ-*1~(͜*1~6 +w~#"1 ̮-? x7*1#x8gT]#͜> +tͪ0 *1~ # +"1ò-*1+͹"1ò-ͬ:>1:`!1wgN 1% P1%ʒ_!#! ~(:9( ~w#6+6 +6 +6 +T]+y6.O* !15( > ):1OE*...  y!1(> )#+:1_ ͪ-1́:1  &:\&\%P͛c)^,́:1 .!.*i?8*1>' @1!{1 !U18A)!3ʘ!b5̪-:3!2:121y21&^,:1NP:1=!/͏*:1O P V> ͯ" Vzʟ!ڟ!͞" ( ttñ ͣñ ͥ" Fͥ" p-(RVt">͞" p" V> +ñ V":1;%ê-;%X;%\:4(͙%/,Cʹ%0(p(?60+7V͞" ! (+V+ͥ" %21!1F0G!(^#~#PO~˾(#~˾ē%>1)!/͏*(cO!/͏*J% Q *͓%J%y( !36^,*( 08 0Gx21ʙ%!3"1>21!2~21~>23^,:1T21J%!16[(+](.>(5<(<_!3~#T(T{ #"1!3"1ɯ    21_ͣ%Ù%6PV (P*1++++"1>>2A%:1TJ%_͞"ʷ$J%>21:1( *1^"*1^#"1~< :1 !15( !3"1{կ21ͣ%͙%!*6!*w.{:2 /!1!*~621:12*!*~621:12* &*"%!%"S!"1321 &:\&!] ˾#:1(-!\ !\!1%%\%212h2|\%<&)x)!T!"(aw:1W 3~ (& ( ($21~ >21:1 ~#\% A!:w > (| }KB*1K1 DMB8 ]͙*:`W-ͮ* ä*:1_x0:121:1Ox0_:18 8 x={(<21D21_.*1"1:1_+BJ(R8#"1C1= ./,+". :1=,=,:,:1,,:,%*͙**1,$*1+-:1o&+ͤ*%*(:1Ͳ->21>21>21!1!16_.!1~6C_.!1~6͞" 1:1(+ͥ"  (<ͮ*:1_:3!1W*"1*1*1:*͐~˾ à.........MemoryKeyI/OFindSyntaxReformat I/Workin] FileFindChange toDriveOptionsrfi|^deln|[^wait]||deEO|undl||flsh|za||DeletKEY,Quit P0L0C0" ^W ^Q ^O ^P ^KESCChg (Y/N,*)?RdyINSDS MR BAK6&H>0ɷ(%!:˶#˶<(!()% i*T](\O>: S++~08+:0'0_+~08:00W_+0_{21 }(~ (A8G_>8A{<2\>:> +#(]#(j.( (A8i[(C('( > i*7ɯ(@. ##(4 (87[(('(~(((6#\% \%1* 0*>:*!]~ (*#>.*!e~*#u*>[*:1*ä* (0_)Ү*)_̈́-*1[1"1)> * ; ! ]*V.:1GEV.:1!1(G#7+))+V.&Ͷ-21/21`,:b< :3W*:1(38_x:`<_:1GColumnMacroRepeacoun([Q],0-9/*)Kenumbe([N/Q],0-9)Abandoedit(Y/N) FilsizeNNNNNMemorusedNNNNNFreeNNNNN ||__^W-____||^O-dsCR||ESCHelpInfo |^insert|^reform||^Q-|TOF||~ :1(d/21~ ~ (0˾> #wz ˾~ +~(5 21!!>( ~ 8~ (> #wz#g'1+:`<*1+*"1)_~# ~#G> )) **鯆7G#^#*^#ͮ* ]>  ͮ*Q)͙* *ä**)_v-:=>21:=ȯ21{(:1_*1͐s͠#"1*1+"1 _ͮ**"1*1K1 DM*z(   q-Tq-( (3 0L@͞**ͩ*@y (:1( <ͮ*{v-:` *(> *{=HG*1͆-"1K*1:*( T]͐:1 w͠"1> >>> :1021:1=:1=͞" ( :1!`(":1!b(:1=(:1!bR|^case||2<:22<ɯ!/C*% YN( (!c ( (#OGyH%AV=w=)=+>B2!}ր0>%_(2(. (M9(Jy(!w# 0@R*͢*g*͢* >+7R+*2 ڕ,*2[2"1S1!1~(21<21:1G 8[*1'x % (x:1( 80>21ͬ [1{z0>  :1( y !~(˾F#H !15, !F#H *2+4Õ,:1> :1g( !1I(u!14(oN:*2 *2K2K2*2++ *2+*2"2#"2 *2#*2"2+"2 0t" > 7> p ###7?(#+ 0S> *2 7?z 7*2+> ##>4:b?-* 2+" 2: 2(=* 2#" 2: 2!b(<:b2 2>5:2=(,ͬ! 28#$:] b*:1( ڕ,-% >>>>>> >> > 21Cͱ*M** )*Fͱ*%Cͱ*)*b*:1 !1Iͯ _͘ + !1I_ͯ ͘ +%< !1Iͯ i͘ +!͇* ͇*͇*6}ր%ͯ >ͣ zbk~08 :0 #x0Gx(?(8( 530/0( =>dG0( => 8G0(=(x7! FNy(-B0 ##>1B84 ##NFy(>0}0B> 6 #= 'd !1 <212121/1_:1=8c8`:1O:1!18˶N(@:1G:10>F> = *1:1G= > :1!1o&p ͑ !p =  W :1G7nnnnn (.(:1ȯ21̀ >21:1W :1(>21 !":1W >^ @!1v W 0O!"(I!( 2=:2=!B<:2!`<:`22ɯ ~#(  > 8)T] ~  > 8 > # S2 *2T]  >0~ ~+ S2o<'}͖*2#w"2͖*2+w"2!" 2 *2# > *2 * 2" 2*2+ > *2ÀaH8\e_VDE_2.62__(c)1987_E.Meyer__A:@@_@@#7Generic CRT P N Teletype printer14!116 2%%-21<2\ 2121b22!3:721*5"1:>2":/ 21!`35!~# &y#!p * ͜:! z\+-, ,!1Iͻ D+Y >D!1Iͻ 08:#K"M$͘ +BCDEF[HI8KLNP QRSTUWX!$=$~$##[ :1F•,!x *:1_ͪ%:1_ *A&))))+ :1_:1 /21f,ͩ21>2121!C/C*͡!1 *($P()^((B('@(/#(L=(`"(l 71 8|21~ m~!wF b1 8](Z212217!/3*!F#H *2"2:1 :1!121!1n( 4>_!(F#H $>_!~ F#˾_W x~ #x^W #!4"2*.%"22 2<222 22 2!"2"2" 2*2+"26 *2#"26 F#^#V## ^#V## @`0@a{_>G:1x = :@G x BDM*2DM * 2R" 2:b7M*,)!)!/)b*]+-<`i/͑ *2#[2RB/͑ *2[2̈́*2[2̈́ /͑ !/3*Õ,{z~# (8:1k!p *(-*2ͮ!" 2-*2"2*24 - 8 *2> 8 *2>7    K>2 2Â. ڥm" ʥ): 2=G: 2V-4:b! 2G: 2w-͡.L,Kq.͹: 2͚Â.͡.L,}+0*2~ x.4=*1ͥ! 2 8$m" ( ~=!B #+"2͹ ( ͡2 ͕,-O!21>2!2~!? +5(#T]#@~ #>2!2~- 3!2yOxG3*2"2*2:1 # x3:():2=(#[2> ((:23 Y:22T] C1'( | } 3 K1#:2=G2'(!?  ͧ- +IR_?8 -v*{ͧ{ :1e> ͧ-:2!B=!`ԇ.:1i:2 1:1N( t" 7ͩ. 8͂.)͡:1> ͧ͂.> ͧ: 2!b .m" (-:1> ͵> ͵-!2~-:2!`̇.*2> > -:1;BDM(+S2S2#"2< 7+#RDM[2N'S2 -`i7B!ͣ:\G:1O(& 08l:8 @8d0`G1 00ROY !<2p#6?>2 6:3(ͱ*:`2 2:b=21:`!1wgN <2ͪ% 7<2ͪ%a_1= *5"1 !"12121!1ͫ(F:b7?ͮ= f,;= W:3(ͱ*]+=2b-:2!32b-m"_A8 [0nˮ )-!1:7(w-!1!4~/w!2ͫ:2!1 !13)!1ͫ:1!1 !18)!3ͫg!b5-:3!\2: 5t" ?- m" (> ͧm" )4I(8 ͔rx=J ?)=:1= t!m" w̓%͜!8z!͒rh!ͥ! 2 t!m" ! ~=!B ͧ~" )ͥIn!n!͔m" ( ;(Â. ͹ͥ=!`ԇ.:2=̇.͖ U.m" ͡.L,~(6 +#"2ͫ ( (͂.>2 2:`=!B!2܇.m" (~"()~"č"( )~"č": 2t" ̓"č"  (̓"č"(m" )=̓"y++4*2~( (~6 ͧͲ !1F-!2( O#> -!3-O#> --*2"2:2( G;7!3~(G#~ͧ'>21!1/C*͕͡,3O!>21:2:1́(0-͍%:1#>21:1(E:17:1f, 8 ( :2J 21*2+"2~ --x(*2++> ##"2- -*2~(c*2~6 +w~#"2 - x7*2#x8gT]#c> ͑;}0 *2~ # +"2-*2̀"2-s͖:>ͧ- A=7fͦsͦ- #G7w +4!#! ~(:9( ~w#6+6 +6 +6 +T]+y6.O) !15( > ͜):1O*...  y!1(> ͜)]+:1_ -P͜:1 %:\%\ͪ%7j2)Õ,P͜:1 .!/3*<8*2 ' '0/ [2"2#j2)-:] 7!/3**2"2221y21Õ,:1N7:1=!L/C*: 2" 77!1721Õ,!11 :1=!1 !1;À rÀ t" Ft" 7-(R);!>͒m" 7͗" )> ͧÀ )!:1Ĝ͍%-͍%?͍%C:4(h%f,̓%0(7 07)m" ʽ! ()t" ! (m" )m" ;; {č"(͈"Ē"(̓"č";̓"č";-:b=_!88<_}+[2S24: 2Ú-:b_=!88_Kڰ°[2S2: 2Ú-:b??+ (J ʡ Ͳ-!26 8$:> T]4 +~ 8*2:> F T]0+ :>w :>T] 8S2+x *2:> *2:>T] 8S2#x O7 9w DM*2B`i(#S2 -K2*2 0*2'*2+4Õ,P͜:1 !/3*  RBK'j2)Õ,7!\<2 :1:1:1!<2\ ~21_#~21#~21 P͜:1j2)Õ,!%/C*>ͣ7G!~ w#!~[(x &7212)Õ,#~W( A(N7212)-!"1:1N(>2121:<)!11~(6w>: 2G:1 ͧ:1=Gm" )<ɷm" ;= ͬ2 2t" >GK' x!BG>8 0x+6 :1! 242i":1-m" -~" ;?~" ;ͥ-! 2:1=G:1?i"(r> ͧ-*2~*2~> !"!"!"!"!" !"m"t"~ #,;/-.?!:  !s/C*% 21N(Q ͟*%07 7W>!`3>_!z(N     #= ~(^6#DM!BDMy#{(I: :'s#K!T]BBDMN#!`3:1N(Q +~#8#+y#Õ, !!>ݾ8^R8#"|6#+| !"!!!1F%0;:;h%21!1F0G!(^#~#7O~% *T](\O>: S++~08+:0'0_+~08:00W_+0_{21 }(~ (A8G_>8A{<2\>:> +#(]#(j.( (A8i[(C&( > *7ɯ(@. ##(4 (87[(&(~ #~[ #~(A(N(W 21:] (!' 18*2)͵ͱ*M**b*:3(ñ*M* ͱ* )*ͱ*:\@͢*:1 8 >1͢* 0͢*>:͢*!]~ (͢*#>.͢*!e~͢*#)*>[͢*:1͢*b* (0)_! 25‡*4: 2_-:a  ͇* ͇*:`<2 2͜)> :`<2 2: 2_~# ~#G> ͤ)͜)R,q,͖%ͱ*M**28,$*23,-: 2o&3,b*à%ͱ*p ͑ !p *1.: 2GE1–.:1! 2(G#q+(,1–.-21/21͗,:b< :3Wͱ*: 2(:8_K:`<_: 2GJD_}:`W<_:b 8(-: 2GW$K: 2G: 2=W:`<_indSyntaxReformat I/Workin] FileFindChange toDriveOptionsColumnMacroRepeacoun([Q],0-9/*)Kenumbe([N/Q],0-9)Abandoedit(Y/N) FilsizeNNNNNMemorusedNNNNNFreeNNNNN ||__^W-____||^O-dsCR||ESCHelpInfo (#~˾b%>1)!T/C*͡(cO![/C*% Q ͟*b%%y( !`36͕,*( 08 0Gx21h%!`3"1>21!2~22~į>2`3Õ,:1;21%!16[(+](.>(5<(<_!`3~#;(;{ #"1!`3"1ɯ21_r%h% 7) 7*1++++"1>>2 .,;:?*=[2h2|21/21\ͪ%< 7ͪ%\ͪ%'0!:1W >~ :1(d/21~ ~ (0˾> #wz ˾~ +~(5 21!!>( ~ 8~ (> #wz#6'21 %:\%!] ˾#:1(-!\ ))鯆7G#^#ͫ* ]>  ͫ* )M*)b*3*: 2_-:=!: *>22:=!: *22:2!` : 2!b:<0?:2_ͫ* _͇*z22:N !!F+z(  ͫ* {!F+ A(=!F+!:R(z_ͫ*#{_-S!b *2zȯGO_O(3'- ( ͻ-{!B<_DWDG > ͻ-'ͻ-( (3 0L@R*͢*g*@y (:1( <͇*{-:` ͢*(> ͢*{=HG!i *:2!3!b S->͢* > ͢* > >>> |^insert|^reform||^Q-|TOF||21:1 *1^"*1^#"1~< :1 !15( !`3"1{կ21r%h%!*6!*wÖ.{:2 /!2į!*~622:22*!*~622:22*%*"%!%"S!"14&/ð>0ɷ(%!:˶#˶<(!()!\!1ͪ%ͪ%\ͪ%212h2|\ͪ%<(x(!'!"(aw:1W 3~ (& ( ($21~ >21:1 ~#\ͪ% A!:w > (| }N(N((6#\ͪ% \ͪ%21>21>21!1!16.m" :1t"  (ption configuration ey definitions erminal installation urther patching

rinter installation estore defaults Choose option, ave, or elp:  ͣOET PKFR?S Hàó VINSTALL HELP -- press ^C at shown, then the bytes themselves. Characters: type the single character directly. Text strings: enter text, then to end. For all items you can either press immediately to keep the current value, or enter a new value instead. (Sein col: 0 Right margin col: 0 Page length: 0 Scroll overlap: 0 Show system files: ͪ Fixed drives (A-P): V Ring bell on error: ͪ Use alt video in header: ͪ Code for block marker: 0 Wition - Generic Terminal Version Terminal ID: !'V Viewable columns: 0 Auto wrap at line end: ͪ Viewable lines: ͦ 0ͨ  Extra DELete key: 0 Extra arrow keys u/d/r/l: ͘ Clear to end of line [06]:s$1$*"" !eVDE(M) 2.62 INSTALL (11/87) (c)1987 E.Meyer [Opening !] !l" \<!&\ *&˽aR(>M2!+ !!$$6:# ʁ, !# +!##( K(P"< any time to abort VINSTALL VINSTALL is menu driven; however, installation functions (Options, Terminal, Printer) require complex data entry: Logical: simply enter "Y" or "N". Numbers: always HEX, usually 2 (sometimes 4) digits 0-F. e VINST.DOC for further explanation of patches and values.)  RESTORE DEFAULTS: This will restore VDE to its original distribution state: default options, terminal, and printer; no function keys, no user patches. Proceed? (Y/N)  Y!F&ldcard character:  Clock speed in MHz: 0 Horizontal scroll delay: 0 Fixed tab display spacing: ͦ 0ͨ  Variable tab columns: ͘4+5# TERMINAL INSTALLATION:  Generic Terminal VersionMemory Mapped V !6'ͦ Terminal init [07]: ͦ Terminal uninit [07]: ͦ Alternate video on [06]: ͦ Alternate video off [06]: ͦ Alt video uses high bit: ͪ Output filter limit: 0 Cursor position mode (Std/Rev/ANS"<Á:-!$"P(DK  *$PR!$M(> *$`R!$'` *$`R!$}'] Installing: !& ...Press to see Main Menu  --------------- VINSTALL MENU ---------------(Always include leading zeros.) Byte strings: If fixed length, just enter the necessary number of hex bytes, 2 digits each. If variable length, enter the # of bytes at the "(" prompt, up to the "[max]" value !a}'͓!"&!(T]67!(!#'` Done. USER OPTIONS: Create BAKup files: !&ͪ Default file mode (W/A/N):  Default insert on: ͪ Default ruler on: ͪ Enable hyphenation: ͪ Left margersion Currently "!'" Choose: dit current or ist terminals:  E L  Terminals: press to select from list: !(!#~#Gͺ Y(`(End of list)'`Selected Editing installaI/None):  [Non-ANSI] Cursor position sequence: ͘ Delay after cursor positioning: 0 Insert line [06]: ͦ Delete line [06]: ͦ Ins/del specific to line 1: ͪMemory Mapped Version Terminal ID: !'V     Viewable columns: 0 Unused columns in RAM: 0 Viewable lines: ͦ 0ͨ  Extra DELete key: 0 Extra arrow keys u/d/r/l: ͘ Terminal init [07]: !='ͦ Terminal uninit [07]: ͦ Turn cursor off [06]:  Toggle 3 off [07]: ͦ Toggle 4 on [07]: ͦ Toggle 4 off [07]: ͦ Switch 1 [07]: ͦ Switch 2 [07]: ͦ Switch 3 [07]: ͦ Switch 4 [07]: ͦm Select <0-9> or ap; or to exit:  N#! Choose o-repeat or uiet if desired:  ͢N(Q +~#8#+b !!O(>ݾ8^R8#"M(|6#+| !"M(!O(! O@O^#($#~~+ ~+~#G~#͢<> FURTHerror* î 7 <(طͺ (.!w# ( 8w#6 #!HH ~Y Nͺ  (Y(N Oq##~͢ͺ  ( ͢w###gʳa{_!&~COMVDEA:@@_@@#7Teletype printerGeneriHJSY Commodore 128 P T)(S= EREpson Geneva PX8PT  S= Kayproͦ Turn cursor on [06]: ͦ Video RAM start addr:  Z80 video in routine: ͘ Z80 video out routine: ͘ PRINTER INSTALLATION: Printer ID: !}'V Send LF after CR: ͪ Printer initialization [16]:  Zg20 2 New definition: ( edits, saves; use ^P to enter these) Ԣ͓ MACRO KEYS: (b!N(g!M(g bytes free)!O( > 02 ͵! (0((w#͢>8+~ ܕ͕ER PATCHING: You will require DDT or a similar utility. Addresses in this version of the program are: User patch area: *&&-:&_+& Command tables: Basic: *&& ESC: *&& ^Q: *&& ^O: *gͺB8(2%B8(w#:%w###|h}hgͺB8(w# 7?͆؇2f͆O:fA~|O|O0:0 ? ?>2C"$2C"(*g)*F#( g#ͺ!6K:x(!w(Y# c CRT P N ADDS 25 P KkkG4G0SY LMAmstrad / Heath P KHEHEpqSY  II/IV P S= ERKaypro 2/4/10 P B0C0S= ERLearSiegler ADM3P TS=  ͦ Printer uninit [07]: ͦ Toggle codes 1-4: ͘ Switch codes 1-4: ͘ Toggle 1 on [07]: ͦ Toggle 1 off [07]: ͦ Toggle 2 on [07]: ͦ Toggle 2 off [07]: ͦ Toggle 3 on [07]: ͦ!>w7 :W:_!O(z(N #= ~(^6#DM!M*BDMb{_:N( :M(s#K!L*T]BBDM&& [Closing !] 2h2|2.2B!&\.:# ʦ, !# :-K(.P(!`"$!'$`(!`"$!}'$!P"$!O($!$".] {$ *Aborted* î *File) *Read *Version  *Write  -k}8k0!wG(4# : "͆8w͆w#[KH!: #*KH :#(B)F#^#V## ^#V## ?: 㯆#O#O  OLMANSI standard P ABondwell 2 P TINS= ERDEC VT52 P KHJERMorrow MDT-20 P TR= ERNEC Starlet 8401PTg**)(S= ERNorthstar Advtg.P    S= LMOsborne 1/2/4 P T)(S= EROtrona Attache P KU&U S= LMTelevi.0.2˷TRS80-Holmes CPMP ?{???yer - 11/20/87 There is a bug in the recently released VDE/VDM versions 2.62. Rather than immediately releasing a new VDE.LBR, I am distributing a small set of files that allow you to fix VDE 2.62 yourself. PROBLEM: The reform (^B:021F9000F1C995 :021F9A0020F431 :011FA300C974 :00000001FF :021FC100F1C964 :021FCB0020F400 :011FD400C943 :00000001FF lvd [du:][filename][[m "[] optional EXAMPLES A>vd A>vd my.doc[ A>vd b11:prog.as n "du:filename -fil t edit I drive/use omitted default t curren values I nam omitted yo begi a (a ye unnamed ne file. "[m o m -cdeo 910+ P TG4G0S= ERTRS-80 model 4P P S= Zenith ZT10 P Ts1s0S= ) function doesn't work properly on indented text (left margin greater than 1). Results can be quite unpredictable. SOLUTION: Select the appropriate hex overlay from VDE262FX.LBR, and use MLOAD.COM to fix your copy of VDE or VDM as follows: 8 card i MSDO computers) bu sorry no o 8080/8 systems I i idea fo portabl computer wit limite dis space Th generi versio ca b installe fo an terminal ther i als memory-mappe versio VDM whic offer faste scree hoic o fil modes ca b "W"ordsta document "A"SCI document o "N"ondocument Normall default t "A". I a existin fil i to larg t edi wit VDE yo wil ge "Memor Error" brea u th fil int tw o mor pieces an edi theERKaypro II/IV P0 0Osborne 1/4 P0 Osborne Exec P0  VDE262FXDOCVDE262FXHEXKVDM262FXHEX q VDE262FX.DOC ------------ E. Me A>mload vde262.com,vde262fx.hex or A>mload vdm262.com,vdm262fx.hex --- Eric Meyer, 427 N. Washington, Bloomington IN 47401 ---  displa i you hardwar support it [Se VINSTALL.DO fo details Comment belo i bracket "[] poin ou other optiona use o VINSTALL.] ============================== INTRODUCTIO =============================== VD i invoke fro CP/ separately (Th fil siz limi i typicall abou 55K dependin o you TP size.) VD give yo "statu line a th to o th scree whic include th filenam an mode curso positio (page line column) variou toggle i o (INSert    DoubleSpace MarginRelease) an prefi flag: ------------------------------------------------------------------------------- P0:VDE.DO [ P L 5 C 4 IN D M ESC- help VD 2.6 (c)198 E.Meye ||^O- ds CR||ESC-Hel Info ==================== COMMAN SUMMAR ============================== I CONTRO KEYS singl keystrok commands. C Carriag retur (^M) Mark paragrap end. B Nondestructiv Backspac (^H). TA Har Ta mode Ta (^I) Variabl Ta mode (brea line a presen position. ^ toggl INSER mod o an off. ^ toggl cas (upper/lower o characte a cursor. ^ inser followin contro cod i text. ^ reforma curren paragraph. ^ repea find/replac (Repeat las ^Q o ^ex a curso position. ES Print Prin th fil (o block fro memory. ES Save Sav th curren fil t disk an continu editing. ES eXit Sav th file the Qui t CP/M. ES Quit Abando curren fil an qui t CP/M. ESsplay hel menu. ES Display information fil siz an fre memory. III QUIC COMMANDS firs hi ^Q the th ke shown (ES cancels) ^ Arrows Left/Righ (includin ^S/D g t star o en o line. Up/Dow (includin ^E/X g t to ^ reform||^Q-| TO || ar abbreviation fo Arro Keys up/dn/rt/lf.) Th VD comman se i simila i man respect t WordStar's thoug no identical Ther ar ESC-commands whic mostl correspon t WordSta ^K- (Block commands ^Q-an ^O-commands an o mov t nex stop. Arro keys WordStar ^ up ^ down ^ left ^ right. Alternate configurable defaul ^K,^J,^H,^L. ^ mov t star o nex wor right. ^ mov t star o nex wor left. ^ scrol upwar on screen. ^ scrol downwQ command.) ^ wait (Brie pause usefu durin Macros.) II ESCAP COMMANDS firs hi ESC the th ke shown (ES cancels) ES Arrows Left/Righ (includin ^S/D shif horizontall 3 columns. Up/Dow (includin ^E/X shif verticall  Block Mar th star o Block. ES Terminate Mar th en o Block. ES Unmar Unmar th Block. ES Delete Delet th marke Block. ES Copy Cop th marke Bloc t presen curso position. ES Write Writ th markeo botto o screen. ^ mov t bloc marker. ^ mov t nex plac marker. ^ mov t to o file. ^ mov t en o file. ^ fin nex occurrenc o string. ^ fin an replac strin (global). ^ delet fro c|| pagn| spcg||Unmar Eras Save ^ p dn|^ de wd|^ unde ||DE d BOL || cntr| wndw||Cop Macr eXit ^ r fi|^ de ln|^ wai || de EO |undl|| flsh| za ||Delet Ke Quit ---------------------------------------------------------------the single-control-ke commands Th similaritie ar stron enoug tha WordSta use shoul hav n troubl adaptin t VDE (I fact i yo fin thes instruction to crypti i places i ma hel t loo a WordSta manual.) ========ar on screen. ^ delet characte t th righ o th cursor. DE delet characte t th left [Configurabl alternate.] ^ undelet character. ^ delet wor t righ o cursor. ^ delet curren line. ^ inser carriag retur1/ screen. ES Files Loo a th director o disk. ES Erase Eras dis file. ES Load Loa bran ne fil t begi editing. ES Name Chang th curren filenam (affect Save eXit). ES Read Rea dis fil int t Bloc t dis file. ES Macro Execut strin o command repeatedly. ES Key Stor Macr o functio Ke fo late recall. ES 0.. Us store Key (I macr mode label.) ES !,=,~, Use i Macr programmin (se below). ES Dicurso t en o curren line. ^ DE delet fro curso t beginnin o curren line. ^ undelet line. IV ONSCREE COMMANDS firs hi ^O the th ke shown (ES cancels) ^ Arrow U (includin ^E mak curren lin to o screen.     ^ se righ margi (colum turn of wordwrap/formatting). ^ se lef margin. ^ toggl Margi Releas on/off. ^ toggl Doubl Spacin on/off. ^ cente curren line. ^ alig curren lin flus wit th righ margin. ^i rese o deleted. ESC- mark th beginnin o th block. ESC- terminate th block (ESC- mus b don first.) ESC- unmark th block removin an marker(s set (Thi ca als b don individuall wit an o th characte delet functions.) Q,ESC,^O ^F,^A -VD support thre set o Arro keys whic functio interchangeably Th tw built-i set suppor th WordSta "arro ke diamond ^E,^X,^D,^S an th ANS standar 3- byt sequence (ESC-[- etc) Th thir se ihe hav to horizonta shift won' d this.) Precede b ^O- an U arro ke (excep ANSI make th curren tex lin th to o th screen. Ther ar als tw WOR movemen commands ^ move right t th star o th nex word ^ move leftth cursor ^Q-DE delete th par t th left. Accidentall delete tex ca usuall b recovere (se UNDELETE). DIS OPERATION (ESC-F,E,R -O usin th ESC- command yo wil b aske fo a (optional drive/user an it director wil b shoTh nam canno b blank. I tha fil alread existed BA fil ma b preserved. ESC- NAME you work Thi allow yo t chang th filenam i th heade befor saving Afte nam change BA file ar no preserved. ESC- EXIT politel t toggl displa o har CR on/off. ^ displa rule line. ^ toggl ta mod Hard/Variable. ^ se variabl ta stop. ^ - clea variabl ta stop. ^ toggl paginatio on/off. ^ toggl windowin on/of (se below). ^ Th Bloc operatio command al requir Bloc t b marked an th curso t b outsid th Block: ESC- delete th bloc (includin markers). ESC- copie th bloc (no includin markers t th presen curso location Ther i n Bloc Mov use config-urable se b defaul t ^K,^J,^L,^H Thes key mov th curso up down right an lef respectively. Precede b ^Q- an arro ke (excep ANSI move mor quickly t th to o botto o th screen t th lef o righ en o t t th star o th las (o current word Bot hav maximu movemen o 25 characters. DELET (^G,DEL ^T ^Y,^QY,^Q-DEL -Yo ca delet tex on CHARACTE a time ^ delete t th righ o th cursor an DE t th left [I yo hav nwn I ther i no enoug roo t fi al th file o th screen yo wil se "... a th en t indicat tha ther wer stil more Pres ES t retur t editing [ESC- ca b configure t ignor SYSte files.] ESC- wil eras singl dis CP/M savin you wor first. ESC- jus QUITS Sinc yo wil win u a th CP/ promp wit an unsave wor los forever yo ar prompte t confir thi (Y/N). ESC- abandon th curren fil an LOAD ne on t begi editing. FIND REPLAC temporaril blan th entir screen. =========================== EDITIN COMMAND ============================== BLOC COMMAND (ESC-B,T,U,D,C,W,PB ^QB - Bloc o tex i delimite b tw markers normall ^B whic remai i memor unt command bu yo ca us ESC- followe b ESC- t delet th original. ESC- write th bloc tex t dis file. ESC-P (ESC- wit option print th bloc text. Th ^Q comman move th curso t th Bloc start. CURSO MOVEMEN (,^h line. Precede b ESC- an arro (excep ANSI move th FRAM rathe tha th cursor th tex a whol shift up/dow 1/ screen o right/lef 3 columns whil th curso stay put (I fact vertica shift wil dra th curso alon i t DE key yo ca instal anothe equivalent. Not tha th ordinar B (^H doe no delete. ^ delete a entir WOR t th righ (u t 25 characters). ^ delete th entir curren LINE ^Q delete onl th par o th lin t th righ o  file (N wildcards.) ESC- read i th content o dis file insertin it tex afte th curren curso position. FIL COMMAND (ESC-S,N,Q,X,L -ESC- SAVE you work what' i memor i writte t dis unde th fil nam i th header ( (^QF ^QA ^Z -^Q i th comman t FIN string Th searc proceed fro th curso positio forward an i normall cas sensitive "_ [thi ca b reconfigured function a wildcard i th firs characte i th string upper/lowe c   as wil b ignore i matchin th rest otherwise i wil matc an singl character Contro codes lik ^ fo newline ca b include (wit th ^ prefi wher needed) Examples: Find ^MLABE matche "LABEL a star o lin only; Find 4__0 ES cancel a an time. ^ repeat th las ^Q o ^Q command Fo ^Q thi i simpl repea find fo ^Q yo wil als b aske whethe yo wan t replac th foun string. INSER MOD (^V -^ toggle insertio o an of (whe on th IN ENTER FLUS (^OR,L,X ^OC,F -^O set th RIGH margin an turn O wordwrap formatting an centering Th defaul i colum 1 whic turn OF al formattin functions A th promp "Column: ente th colum numbe (1- 255) o jus hi RETURMISCELLAN (^^,^W,ESC-I -Jus t explai fe miscellaneou functions: ^ (ctl-caret change th cas o th characte a th cursor i i wa letter an move t th next Usefu fo capitalizin strin o lowercas text o vic versa. ^  function i th Prin routin (formfeeds headers start-sto print ar enabled. Whe off th heade wil sa "P L xxxx" showin yo th absolut lin numbe i th file Also printin occur wit n pag break o formfeeds (Thi ca blin bac t th to o th fil i needed (Plac marker ar NO save t disk.) PRINTE CODE (^P -Contro code fo specia effect i printin ca b entere i th tex wit th ^ prefix Thu pressin ^P^ (o ^PH embed ^H etc Sever matche "42201" "47401" etc; Find _wordsta matche "WORDSTAR" "WordStar etc; Find _ matche "_"! ^Q i th globa FIND/REPLAC command I ask fo strin t find an wha t chang i to Th curso wil b place i successio o eac ofla show i th header) I INSER i OFF an existin tex t th righ o th curso i overwritte a yo type I INSER i ON wha yo typ i inserted an existin tex move t th right. LIN SPACIN (^OS -Th ^O comman toggle bet fo th curren curso column I thi valu conflict wit th lef margin th lef margi wil b rese t 1. ^O set th LEF margi i a identica fashion Mus b t lef o th righ margin whic mus hav bee se first Th defaul i 1. wait fo brie tim (abou tw seconds i cloc spee i se properly) Mos usefu i Macr whe yo wan t sto an se somethin fo moment. ESC- display a informatio messag wit th curren fil lengt an memor usage i byte (102 usefu fo printin smal thing righ afte eac othe o th sam sheet or i conjunctio wit th "* option ca prin ou multipl copie o inde cards labels etc.) VD neve send formfee befor printing alig th pape first. [Yo ca standar code are: ^ -backspac -overstrik previou character ^ -har (ASCII ta -printer respon variousl t this ^ -formfee (No recommende whe paginatio (^OP i on) (Th Bloc marker normall ^B canno b embedded an ^ i reservccurrenc o th strin i th file startin a th curren curso position (Yo wil se th promp "Chg? i th header. T chang it pres "Y" anythin els skip t th next T chang al furthe occurrence withou bein asked pres "*" wee singl an doubl lin spacing I doubl spac mode th followin function generat doubl carriag returns CR ^N Wordwrap ^B Yo ca easil mi singl an doubl spacing th Refor functio ^ ca conver betwee th two. MARGINS C ^O temporaril RELEASE th margin (reset the t 1) allowin yo t typ outsid them Us ^O agai t restor th margins. ^O CENTER lin wit respec t th curren margins i set. ^O FLUSHE lin right i th righ margi i set.  1K) Not tha whe ther i les tha 25 byte free respons tim ca ge ver slow. PAGINATIO (^OP -Th ^O comman toggle pagination Whe on th pag lengt determine th pag an lin show i th heade ("P x L xx") an al paganno toggl paginatio o i th pag lengt i 0.] PLAC MARKER (^PZ,^QP -Yo ca se an numbe o temporar plac marker i th tex wit ^P (the wil appea a ^Z) Th ^Q comman move th curso t th nex plac marke i th file cyce fo us a plac marker. Contro code displa o scree a capita letters highlighte i possible VD assume the ar no characters s the ar no counte whe reformattin text. Fo greate convenience yo ca als arrang t hav    singl ^P-cod produc a entir strin o byte fo commonl use effects VD support subse o WordStar' printe installation seve definabl codes fou toggles fou switches Th Printe Installatio i VINSTAL allow yo t choos wha cud wa t d thi woul be: ^P-ESC,U,1,underline text,^P-ESC,U,0 Th sophisticate wa woul b t us VINSTAL t defin thos string a th ^ toggle s tha al you' nee woul be: ^PS,underline text,^PS PRINTIN (ESC-P -Th ESC- commang number wil prin a th to righ o eac pag nea th margin (Maximu lengt i 5 characters us a empt string "" t ge numbere page wit n heade text.) Th las thre option (@,#,"" ar NO allowe i paginatio i of (^OP) o ering: full-scree editin bloc operation use are support wordwra an reforma macr program dis fil operations margins tabs spacin fin an replac WordSta compatibility man prin feature undelet abilit configz) wit VDE onl th blin o a eye 0. sec Thi eas o movemen actuall change th wa us a editor. VD i designe fo Z8 CP/ 2. an 3. systems i shoul als wor wit ful equivalent (e HD6418 CPU ZRDOS an emulation (e ZM A>vd [du:][filename][[m "[] optional EXAMPLES A>vd A>vd my.doc[ A>vd b11:prog.as n "du:filename -fil t edit I drive/use omitted default t curren values I nam omitted yo begi a (a ye unnamed ne file. "[m o m -code yo wan t use an instal th actua contro sequence you printe needs Th default are: toggle ^D ^S ^Y ^ switche ^Q ^W ^E ^R (I WordSta thes toggle ar Doublestrike Underline Ribbon an Super- script bu yo ca mak t Print th fil fro memory Yo wil b aske fo se o "Options:" a whic poin yo ma ente on o mor o th following i an order: PAUSE fo you keystrok befor eac pag (shee feed). print onl th currentl marke BLOCK.  i "B"loc prin wa chosen. Exampl 1 Options @6#1*2"Instructions page"P wil prin ou pag si o th fil twice wit th heade shown pausin befor eac pag unti yo pres ke (othe tha ESC). Exampl 2 Options B^ wil prin ou thurabl options VD i versatile it pur ASCI mod an definabl macro mak i a idea programmer' editor it ful formattin an printin feature als mak i a efficien wor processor VD i bi spartan bu i ha on grea advantag 8 card i MSDO computers) bu sorry no o 8080/8 systems I i idea fo portabl computer wit limite dis space Th generi versio ca b installe fo an terminal ther i als memory-mappe versio VDM whic offer faste scree hoic o fil modes ca b "W"ordsta document "A"SCI document o "N"ondocument Normall default t "A". I a existin fil i to larg t edi wit VDE yo wil ge "Memor Error" brea u th fil int tw o mor pieces an edi thehe anythin yo like. "Toggles ar goo fo feature lik underlin tha ar turne o an off "Switches ar bette fo varyin parameter lik characte pitch. Example you printe use ESC-U- (an 0 t tur underlinin o (an off) Th crFILTER contro character ^ t tex "^X". *n print th jo ou n TIME (nn=1..255). @n begin printin A pag nn. #n print onl (u to TOTA o n pages. "... use th quote strin a HEADER Th string followe immediatel b th paVDE26.DOC --------- Instruction fo Vide Displa Editor: VDE VD 2.6 (07/87) (c)1987 E Meyer ============================================================================== VD i small fast powerfu tex edito fo CP/ computers off ove mor cumbersom programs speed VD i writte i Z8 assembler it' jus 12K wit n overlays i compresse th entir fil (u t 60 o more int memory Findin strin a th en o 50 fil take m 13. se wit WordSta (a 8MH displa i you hardwar support it [Se VINSTALL.DO fo details Comment belo i bracket "[] poin ou other optiona use o VINSTALL.] ============================== INTRODUCTIO =============================== VD i invoke fro CP/ separately (Th fil siz limi i typicall abou 55K dependin o you TP size.) VD give yo "statu line a th to o th scree whic include th filenam an mode curso positio (page line column) variou toggle i o (INSert    DoubleSpace MarginRelease) an prefi flag: ------------------------------------------------------------------------------- P0:VDE.DO [ P L 5 C 4 IN D M ESC- help VD 2.6 (c)198 E.Meye ||Ctl-O- ds CR||ESC-Hel Info an " ar abbreviation fo Arro Keys up/dn/rt/lf.) Th VD comman se i simila i man respect t WordStar's thoug no identical Ther ar ESC-commands whic mostl Nondestructiv Backspac (Ctl-H). TA Har Ta mode Ta (Ctl-I) Variabl Ta mode mov t nex stop. Arro keys WordStar Ctl- up Ctl- down Ctl- left Ctl- right. Alternate configurable defaul Ctl-K,Ctl-J,Ctl-H,Ctl-L. Ctl- mov t characte a cursor. Ctl- inser followin contro cod i text. Ctl- reforma curren paragraph. Ctl- repea find/replac (Repeat las Ctl-Q o Ctl-Q command.) Ctl- wait (Brie pause usefu durin Macros.) II ESCAP COMMANDS fi Save Sav th curren fil t disk an continu editing. ES eXit Sav th file the Qui t CP/M. ES Quit Abando curren fil an qui t CP/M. ES Block Mar th star o Block. ES Terminate Mar th en o Block III QUIC COMMANDS firs hi Ctl-Q the th ke shown (ES cancels) Ctl- Arrows Left/Righ (includin Ctl-S/D g t star o en o line. Up/Dow (includin Ctl-E/X g t to o botto o screen. Ctl- mov t bloc marker. Ctl-l- p up|DE d lf|Ctl-P place|| place| replc|| pagn| spcg||Unmar Eras Save Ctl- p dn|Ctl- de wd|Ctl- unde ||DE d BOL || cntr| wndw||Cop Macr eXit Ctl- r fi|Ctl- de ln|Ctl- wai || de EO |undl|| flsh| za ||Delet Ke correspon t WordSta Ctl-K- (Block commands Ctl-Q-an Ctl-O-commands an othe single-control-ke commands Th similaritie ar stron enoug tha WordSta use shoul hav n troubl adaptin t VDE (I fact i yo fin thes instruction  star o nex wor right. Ctl- mov t star o nex wor left. Ctl- scrol upwar on screen. Ctl- scrol downwar on screen. Ctl- delet characte t th righ o th cursor. DE delet characte t th left [Configurabl alternars hi ESC the th ke shown (ES cancels) ES Arrows Left/Righ (includin Ctl-S/D shif horizontall 3 columns. Up/Dow (includin Ctl-E/X shif verticall 1/ screen. ES Files Loo a th director o disk. ES Erase Era. ES Unmar Unmar th Block. ES Delete Delet th marke Block. ES Copy Cop th marke Bloc t presen curso position. ES Write Writ th marke Bloc t dis file. ES Macro Execut strin o command repeatedly. mov t nex plac marker. Ctl- mov t to o file. Ctl- mov t en o file. Ctl- fin nex occurrenc o string. Ctl- fin an replac strin (global). Ctl- delet fro curso t en o curren line. Ctl- DE    delet fro curso t beginnin o curren line. Ctl- undelet line. IV ONSCREE COMMANDS firs hi Ctl-O the th ke shown (ES cancels) Ctl- Arrow U (includin Ctl-E mak curren lin to o screen. Ctl- se righ marse below). Ctl- temporaril blan th entir screen. =========================== EDITIN COMMAND ============================== BLOC COMMAND (ESC-B,T,U,D,C,W,PB Ctl-QB - Bloc o tex i delimite b tw markers normall Ctl-B whi Ther i n Bloc Mov command bu yo ca us ESC- followe b ESC- t delet th original. ESC- write th bloc tex t dis file. ESC-P (ESC- wit option print th bloc text. Th Ctl-Q comman move th curso t th Bloc start.  th to o botto o th screen t th lef o righ en o th line. Precede b ESC- an arro (excep ANSI move th FRAM rathe tha th cursor th tex a whol shift up/dow 1/ screen o right/lef 3 columns whil th curso stayE a time Ctl- delete t th righ o th cursor an DE t th left [I yo hav n DE key yo ca instal anothe equivalent. Not tha th ordinar B (Ctl-H doe no delete. Ctl- delete a entir WOR t th righ (u t 25 characteS t retur t editing [ESC- ca b configure t ignor SYSte files.] ESC- wil eras singl dis file (N wildcards.) ESC- read i th content o dis file insertin it tex afte th curren curso position. FIL COMMAND (ESC-S,gi (colum turn of wordwrap/formatting). Ctl- se lef margin. Ctl- toggl Margi Releas on/off. Ctl- toggl Doubl Spacin on/off. Ctl- cente curren line. Ctl- alig curren lin flus wit th righ margin. Ctl- c remai i memor unti rese o deleted. ESC- mark th beginnin o th block. ESC- terminate th block (ESC- mus b don first.) ESC- unmark th block removin an marker(s set (Thi ca als b don individuall wit an o th charac CURSO MOVEMEN (,Ctl-Q,ESC,Ctl-O Ctl-F,Ctl-A -VD support thre set o Arro keys whic functio interchangeably Th tw built-i set suppor th WordSta "arro ke diamond Ctl-E,Ctl-X,Ctl-D,Ctl-S an th ANS standar put (I fact vertica shift wil dra th curso alon i the hav to horizonta shift won' d this.) Precede b Ctl-O- an U arro ke (excep ANSI make th curren tex lin th to o th screen. Ther ar als tw WOR movemen commars). Ctl- delete th entir curren LINE Ctl-Q delete onl th par o th lin t th righ o th cursor Ctl-Q-DE delete th par t th left. Accidentall delete tex ca usuall b recovere (se UNDELETE). DIS OPERATION (ESC-F,E,R -N,Q,X,L -ESC- SAVE you work what' i memor i writte t dis unde th fil nam i th header (Th nam canno b blank. I tha fil alread existed BA fil ma b preserved. ESC- NAME you work Thi allow yo t chang th filenam toggl displa o har CR on/off. Ctl- displa rule line. Ctl- toggl ta mod Hard/Variable. Ctl- se variabl ta stop. Ctl- - clea variabl ta stop. Ctl- toggl paginatio on/off. Ctl- toggl windowin on/of (te delet functions.) Th Bloc operatio command al requir Bloc t b marked an th curso t b outsid th Block: ESC- delete th bloc (includin markers). ESC- copie th bloc (no includin markers t th presen curso location  3-byt sequence (ESC-[- etc) Th thir se i use config-urable se b defaul t Ctl-K,Ctl-J,Ctl-L,Ctl-H Thes key mov th curso up down right an lef respectively. Precede b Ctl-Q- an arro ke (excep ANSI move mor quickly tnds Ctl- move right t th star o th nex word Ctl- move left t th star o th las (o current word Bot hav maximu movemen o 25 characters. DELET (Ctl-G,DEL Ctl-T Ctl-Y,Ctl-QY,Ctl-Q-DEL -Yo ca delet tex on CHARACTO usin th ESC- command yo wil b aske fo a (optional drive/user an it director wil b shown I ther i no enoug roo t fi al th file o th screen yo wil se "... a th en t indicat tha ther wer stil more Pres E i th heade befor saving Afte nam change BA file ar no preserved. ESC- EXIT politel t CP/M savin you wor first. ESC- jus QUITS Sinc yo wil win u a th CP/ promp wit an unsave wor los forever yo ar prompte t    confir thi (Y/N). ESC- abandon th curren fil an LOAD ne on t begi editing. FIND REPLAC (Ctl-QF Ctl-QA Ctl-Z -Ctl-Q i th comman t FIN string Th searc proceed fro th curso positio forward an i normall cas sen FIND/REPLAC command I ask fo strin t find an wha t chang i to Th curso wil b place i successio o eac occurrenc o th strin i th file startin a th curren curso position (Yo wil se th promp "Chg? i th headritte a yo type I INSER i ON wha yo typ i inserted an existin tex move t th right. LIN SPACIN (Ctl-OS -Th Ctl-O comman toggle betwee singl an doubl lin spacing I doubl spac mode th followin function generat do th lef margi wil b rese t 1. Ctl-O set th LEF margi i a identica fashion Mus b t lef o th righ margin whic mus hav bee se first Th defaul i 1. Ctl-O temporaril RELEASE th margin (reset the t 1) allowin yo ti cloc spee i se properly) Mos usefu i Macr whe yo wan t sto an se somethin fo moment. ESC- display a informatio messag wit th curren fil lengt an memor usage i byte (102 1K) Not tha whe ther i les tharigh afte eac othe o th sam sheet or i conjunctio wit th "* option ca prin ou multipl copie o inde cards labels etc.) VD neve send formfee befor printing alig th pape first. [Yo canno toggl paginatio o i th psitive "_ [thi ca b reconfigured function a wildcard i th firs characte i th string upper/lowe cas wil b ignore i matchin th rest otherwise i wil matc an singl character Contro codes lik Ctl- fo newline ca ber. T chang it pres "Y" anythin els skip t th next T chang al furthe occurrence withou bein asked pres "*" ES cancel a an time. Ctl- repeat th las Ctl-Q o Ctl-Q command Fo Ctl-Q thi i simpl repea find fo Cubl carriag returns CR Ctl-N Wordwrap Ctl-B Yo ca easil mi singl an doubl spacing th Refor functio Ctl- ca conver betwee th two. MARGINS CENTER FLUS (Ctl-OR,L,X Ctl-OC,F -Ctl-O set th RIGH margin an turn O wordw typ outsid them Us Ctl-O agai t restor th margins. Ctl-O CENTER lin wit respec t th curren margins i set. Ctl-O FLUSHE lin right i th righ margi i set. MISCELLAN (Ctl-Ctl-,Ctl-W,ESC-I -Jus t explai fe miscel 25 byte free respons tim ca ge ver slow. PAGINATIO (Ctl-OP -Th Ctl-O comman toggle pagination Whe on th pag lengt determine th pag an lin show i th heade ("P x L xx") an al pag function i th Prin routin (ag lengt i 0.] PLAC MARKER (Ctl-PZ,Ctl-QP -Yo ca se an numbe o temporar plac marker i th tex wit Ctl-P (the wil appea a Ctl-Z) Th Ctl-Q comman move th curso t th nex plac marke i th file cyclin bac t th to include (wit th Ctl- prefi wher needed) Examples: Find Ctl-MLABE matche "LABEL a star o lin only; Find 4__0 matche "42201" "47401" etc; Find _wordsta matche "WORDSTAR" "WordStar etc; Find _ matche "_"! Ctl-Q i th globatl-Q yo wil als b aske whethe yo wan t replac th foun string. INSER MOD (Ctl-V -Ctl- toggle insertio o an of (whe on th IN fla show i th header) I INSER i OFF an existin tex t th righ o th curso i overwrap formatting an centering Th defaul i colum 1 whic turn OF al formattin functions A th promp "Column: ente th colum numbe (1-255) o jus hi RETUR fo th curren curso column I thi valu conflict wit th lef marginlaneou functions: Ctl-Ctl- (ctl-caret change th cas o th characte a th cursor i i wa letter an move t th next Usefu fo capitalizin strin o lowercas text o vic versa. Ctl- wait fo brie tim (abou tw seconds formfeeds headers start-sto print ar enabled. Whe off th heade wil sa "P L xxxx" showin yo th absolut lin numbe i th file Also printin occur wit n pag break o formfeeds (Thi ca b usefu fo printin smal thing  o th fil i needed (Plac marker ar NO save t disk.) PRINTE CODE (Ctl-P -Contro code fo specia effect i printin ca b entere i th tex wit th Ctl- prefix Thu pressin Ctl-PCtl- (o Ctl-PH embed Ctl-H etc Severa    QUICK REFERENCE FOR VDE 2.62 [Note: the ^K- and ESC- prefixes are largely interchangeable.] CURSOR AND SCREEN: = ^E = ^D ^Q, start, end of line = ^X = ^H or ^S ^Q, top, end of screen [Note: An alternate arrow key set can also be installed.] ^F word right ^R page up ^QR top of file ^QB block start ^A word left ^C page down ^QC end of file tab ESC-I info message ^OD HCR display on/off DELETING: ^G delete char to right ^Y delete line ^QY del to end of ln DEL delete char to left ^QU UNdel line ^Q-DEL " to beg of ln  block start ESC-C copy block ESC-W write block to disk ESC-T [^KK] terminate ESC-D [^KY] delete block ESC-U unmark block FORMATTING and PRINTING: ^OR,L set rt, lft margins ^OC center line  macro programming : ESC-M define macro ESC-K store macro key ESC-!,=,~,# ^W wait (pause) ESC-0..9 use key VDE26.DOÍ -------- InstructionfoVideDisplaEditor VDEVD͠2.6(07/87 (c)1987EMeye ==le ^QP place marker ^OW window on/off ^W, shift frame up, down 1/4 screen ^OZ blank screen ^W, shift frame right, left 32 cols ^O make current line top  ^T delete word to right ^U UNdel char FIND and REPLACE: ^QF find string ^QA find and replace string ^Z [^L] repeat find/repl DISK FILES: ESC-N new filename  ^P insert ^-code: ^OX margin release on/off ^OF flush right line ^D,S,T,Y toggles ^B reform paragraph ^OS double space on/off ^Q,W,E,R switches ESC-P print text ^OP pagination on/off ^I hard =========================================================================== VDŠismallfastpowerfutexeditofoCP/͠computersoffering -- full-screeeditin砠blocoperation󠠠usearesuppor wordwraan   reformamacrprogram󠠠disfiloperation marginstabsspacin砠finanreplac堠WordStacompatibilit manprinfeature󠠠undeletabilitconfigurabloption VDŠiversatileitpurASCIɠmoThieasomovemenactuallchangethwaɠusaeditor VDŠidesignefoZ8CP/͠2.an3.systemsishoulalswor렍 witfulequivalent(eHD6418CPUZRDOSanemulation(eZ8cardi MSDOӠcomputers)busorrynooptiona EXAMPLESA>vd堠A>vdmy.doc[A>vdb11:prog.as "du:filenamefilteditIdrive/useomitteddefaulttcurren valuesInamomittedyobegia(ayeunnamednefile "[mo򠢠mcho (INSertDoubleSpaceMarginRelease)anprefiflag ------------------------------------------------------------------------------ P0:VDE.DOà[P砱L5C4INӠDӠMҠESC-Ƞhel VDŠ2.6(c)198E.MeyeeletKeQui ------------------------------------------------------------------------------ IyotypESC-HyowilalsgebriemenothvariouVDŠ commandsThmenulikalcommanpromptanerromessagesappear tempohesinstructiontocryptii placesimaheltlooaWordStamanual. ============================COMMANĠSUMMAR٠============================= ICONTRO̠KEYSsinglkeystrokcommands CҠCarriagretur(^M)Madandefinablmacromakia ideaprogrammer'editoritfulformattinanprintinfeaturealsmak堍 iaefficienworprocessorVDŠibispartanbuihaongrea advantagovemorcumbersomprogramsspeedVDŠiwrito8080/8systemsIiideafoportabl堍 computerwitlimitedisspaceThgeneriversiocabinstallefo anterminaltherialsmemory-mappeversioVDMwhicofferfaste screedisplaiyouhardwarsupportit[Seicofilmodescab"W"ordstadocument"A"SCIɠ documento"N"ondocumentNormalldefaultt"A" IaexistinfilitolargtediwitVDEyowilge"Memor Error"breauthfilinttwomorpiecesanedi||^OĠdsCR||ESCHelInf an"arabbreviationfoArroKeysup/dn/rt/lf. ThVDŠcommanseisimilaimanrespecttWordStar'sthougno identicalTherarESCrkparagrapend BӠNondestructivBackspac(^H) TA HarTamodeTa(^I)VariablTamodemovtnexstop ArrokeysWordStar^Šup^ؠdown^Ӡleft^Ġright AlternateconfigurabledefaulteiZ8 assemblerit'jus12Kwitnoverlaysicompressethentirfil(u t60ˠomoreintmemoryFindinstrinatheno50ˠfiltake m13.sewitWordSta(a8MHz)witVDEonlthblinoaeye0. secVINSTALL.DOàfodetails Commentbeloibracket"[]poinouotheroptionauseoVINSTALL. ==============================INTRODUCTIOΠ============================== VDŠiinvokefroCP/MA>vd{du:}{filename}{[m"{}theseparately (Thfilsizlimiitypicallabou55KdependinoyouTPsize. VDŠgiveyo"statulineathtoothscreewhicincludeth堍 filenamanmodecursopositio(pagelinecolumn)varioutoggleiorel|Ԡrulr||TermiFileLoa ^Ҡpup|DE̠dlf|^Pڠplace||Рplace|replc||Рpagn|Ӡspcg||UnmarErasSav ^àpdn|^Ԡdewd|^ՠunde||DE̠dBOLՠ||àcntr|נwndw||CopMacreXi ^ڠrfi|^٠deln|^נwai||٠deEO̠|undl||Ơflsh|ڠza||DcommandswhicmostlcorrespontWordSta^K (Blockcommands^Qan^Ocommandsanothesingle-control-kecommands ThsimilaritiearstronenougthaWordStauseshoulhavntroubl堍 adaptintVDE(Ifactiyofint^K,^J,^H,^L ^Ơmovtstaronexworright ^movtstaronexworleft ^Ҡscrolupwaronscreen ^àscroldownwaronscreen ^Ǡdeletcharactetthrighothcursor DE̠deletch   aractetthleft[Configurablalternate.ݍ ^ՠundeletcharacter ^Ԡdeletwortrighocursor ^٠deletcurrenline ^Πinsercarriagretur(brealineapresenposition ^֠togglINSERԠmodn ESàƠFilesLooathdirectorodisk ESàŠEraseErasdisfile ESà̠LoadLoabrannefiltbegiediting ESàΠNameChangthcurrenfilenam(affectSaveeXit) ESàҠReadàCopyCopthmarkeBloctpresencursoposition ESàנWriteWritthmarkeBloctdisfile ESà͠MacroExecutstrinocommandrepeatedly ESàˠKeyStorMacrofunctioKefolateРmovtnexplacmarker ^ѠҠmovttoofile ^Ѡàmovtenofile ^ѠƠfinnexoccurrencostring ^Ѡfinanreplacstrin(global) ^Ѡ٠deletfrocursotenocurrenline righmargin ^ϠĠtoggldisplaoharCRon/off ^ϠԠdisplaruleline ^Ϡ֠toggltamodHard/Variable ^Ϡsevariabltastop ^Ϡcleavariabltastop ^ϠРtogglpaginatioon/offr(sset(Thicaals bdonindividuallwitanothcharactedeletfunctions. ThBlocoperatiocommandalrequirBloctbmarkedan䠍 thcursotboutsidthBlock ESC-Ġdeletethbloc(incloanoff ^ޠtogglcas(upper/lowerocharacteacursor ^Рinserfollowincontrocoditext ^ reformacurrenparagraph ^ڠrepeafind/replac(Repeatlas^QƠo^Qcommand. ^נwait(BriepReadisfilinttexacursoposition ESàРPrintPrinthfil(oblockfromemory ESàӠSaveSavthcurrenfiltdiskancontinuediting ESàؠeXitSavthfiletheQuitCP/M ESàѠQurecall ESà0..UsstoreKey(Imacrmodelabel. ESà!,=,~,UseiMacrprogrammin(sebelow) ESàȠDisplayhelmenu ESàɠDisplayinformationfilsizanfrememory IIIQUICˠCOMM^ѠDE̠deletfrocursotbeginninocurrenline ^Ѡՠundeletline IVONSCREEΠCOMMANDSfirshi^Othethkeshown(ESàcancels ^ϠArrowU(includin^Emakcurrenlintooscreen ^ϠҠ ^Ϡנtogglwindowinon/of(sebelow) ^Ϡڠtemporarilblanthentirscreen ===========================EDITINǠCOMMANDӠ============================= BLOCˠCOMMANDӠ(ESC-B,T,U,D,C,W,PB^QBBlocotexidelimiudinmarkers) ESC-àcopiethbloc(noincludinmarkerstthpresencurso locationTherinBlocMovcommandbuyocausESC-àfollowe䠍 bESC-Ġtdeletthoriginal ESC-נwritethbloctextauseusefudurinMacros. IIESCAPŠCOMMANDSfirshiESCthethkeshown(ESàcancels ESàArrowsLeft/Righ(includin^S/Dshifhorizontall3columns Up/Dow(includin^E/Xshifverticall1/screeitAbandocurrenfilanquitCP/M ESà BlockMarthstaroBlock ESàԠTerminateMarthenoBlock ESàՠUnmar렠UnmarthBlock ESàĠDeleteDeletthmarkeBlock ESàANDSfirshi^Qthethkeshown(ESàcancels ^ѠArrowsLeft/Righ(includin^S/Dgtstaroenoline Up/Dow(includin^E/Xgttoobottooscreen ^Ѡ movtblocmarker ^Ѡserighmargi(columturnofwordwrap/formatting) ^Ϡ̠selefmargin ^ϠؠtogglMargiReleason/off ^ϠӠtogglDoublSpacinon/off ^Ϡàcentecurrenline ^ϠƠaligcurrenlinfluswitthtebtw markersnormall^Bwhicremaiimemoruntireseodeleted ESC- markthbeginninothblock ESC-Ԡterminatethblock(ESC- musbdonfirst. ESC-ՠunmarkthblockremovinanmarkedisfile ESC-P (ESC-Рwit optionprintthbloctext Th^Q commanmovethcursotthBlocstart CURSOҠMOVEMENԠ(,^Q,ESC,^O^F,^AVDŠsupportthre堍 setoArrokeyswhicfunct   iointerchangeablyThtwbuilt-iset supporthWordSta"arrokediamond^E,^X,^D,^SanthANSɠ standar3-bytsequence(ESC-[-etc)Ththirseiuseconfig urablesebdefault^K,^J,^L,^HTheskeymovwon'dthis. Precedeb^O-anUРarroke(excepANSImakethcurren texlinthtoothscreen TheraralstwWORĠmovemencommands^Ơmoverighttth堍 starothnexword^movelefttparoth堍 lintthrighothcursor^Q-DE̠deletethpartthleft Accidentalldeletetexcausuallbrecovere(seUNDELETE) DISˠOPERATIONӠ(ESC-F,E,ROusinthESC-Ơcommandyowilbaske䠍 foC-ӠSAVEӠyouworkwhat'imemori writtetdisundethfilnamithheader(Thnamcannob堍 blank.IthafilalreadexistedBAˠfilmabpreserved ESC-ΠNAMEӠyouworkThiallowyotchangthtioforwardaninormallcas堍 sensitive"_[thicabreconfiguredݠfunctionawildcardi栍 thfirscharacteithstringupper/lowecaswilbignorei matchinthrestotherwiseiwilmatcansinglcharssiooeac蠍 occurrencothstrinithfilestartinathcurrencurso position(Yowilsethpromp"Chg?ithheader.Tchangit pres"Y"anythinelsskiptthnextTchangalfurthe occurrethcursoup downrightanlefrespectively Precedeb^Q-anarroke(excepANSImovemorquicklyt thtoobottoothscreentthleforighenothline PrecedebESC-anarro(excethstarothlas(o currentwordBothavmaximumovemeno25characters DELETŠ(^G,DEL^T^Y,^QY,^Q-DELYocadelettexonCHARACTEҠa᠍ time^ǠdeletetthrighothcursoranDE̠tthleft[Iyoa(optionaldrive/useranitdirectorwilbshownIther堍 inoenougrootfialthfileothscreenyowilse"... athentindicatthatherwerstilmorePresESàtreturt editing[ESC-Ơcafilenamith堍 headebeforsavingAftenamchangeBAˠfilearnopreserved ESC-ؠEXITӠpoliteltCP/Msavinyouworfirst ESC-ѠjusQUITSSincyowilwinuathCP/͠prompwitan unsavewoacterContro젍 codeslik^͠fonewlinecabinclude(witth^Рprefiwher堍 needed)Examples Find^MLABE̠matche"LABELastarolinonly Find4__0matche"42201""47401"etc ncewithoubeinaskedpres"*"ESàcancelaantime ^ڠrepeatthlas^QƠo^QcommandFo^QƠthiisimpl᠍ repeafindfo^Qyowilalsbaskewhetheyowantreplac堍 thfounstring INSERԠMODŠpANSImovethFRAMŠrathetha thcursorthtexawholshiftup/dow1/screenoright/lef 3columnswhilthcursostayput(Ifactverticashiftwil젍 drathcursoalonithehavtohorizontashift havnDE̠keyyocainstalanotheequivalent.ݠNotthath堍 ordinarBӠ(^Hdoenodelete ^ԠdeleteaentirWORĠtthrigh(ut25characters) ^٠deletethentircurrenLINE^Q٠deleteonlthbconfiguretignorSYStefiles.ݍ ESC-Šwilerassingldisfile(Nwildcards. ESC-Ҡreadithcontentodisfileinsertinittexafte thcurrencursoposition FILŠCOMMANDӠ(ESC-S,N,Q,X,LESrlosforeveryoarpromptetconfirthi(Y/N) ESC-̠abandonthcurrenfilanLOADӠneontbegiediting FINDREPLACŠ(^QF^QA^Z^QƠithcommantFINĠstringTh堍 searcproceedfrothcursoposiFind_wordsta򠠠matche"WORDSTAR""WordStaretc Find_ߠmatche"_" ^QithglobaFIND/REPLACŠcommandIaskfostrintfind anwhatchangitoThcursowilbplaceisucce(^V^֠toggleinsertiooanof(wheonthINӠfla砍 showithheader)IINSERԠiOFFanexistintextthrigho栍 thcursoioverwritteayotypeIINSERԠiONwhayotypi insertedanexistintex   movetthright LINŠSPACINǠ(^OSTh^OӠcommantogglebetweesinglandoubllin堍 spacingIdoublspacmodethfollowinfunctiongeneratdoubl堍 carriagreturnsCR^NWordwrap^BYocaeasilmisinglanԠmargiiaidenticafashionMusbtlefo栍 thrighmarginwhicmushavbeesefirstThdefauli1 ^OؠtemporarilRELEASEӠthmargin(resetthet1)allowinyo ttypoutsidthemUs^Oؠagaitreproperly)MosusefuiMacrwheyowantstoansesomethin砍 fomoment ESC-ɠdisplayainformatiomessagwitthcurrenfillengtan䠍 memorusageibyte(1021K)Notthawhetherilestha25foprintinsmalthingrigh afteeacotheothsamsheetoriconjunctiowitth"* optioncaprinoumultiplcopieoindecardslabelsetc. VDŠnevesendformfeebeforprintingaligthpapefirst^P^Ƞ(o^PH embed^HetcSeverastandarcodeare ^Ƞbackspac堭overstrikprevioucharacte ^ɠhar(ASCIIta⠭printerresponvariousltthi ^̠formfee䠠(Norecommendewhepaginatiosevedefinabl堍 codesfoutogglesfouswitchesThPrinteInstallatioiVINSTAL̠ allowyotchooswhacodeyowantuseaninstalthactua젍 controsequenceyouprinteneedsThdefaultare togg䠍 doublspacingthReforfunctio^ caconverbetweethtwo MARGINSCENTERFLUSȠ(^OR,L,X^OC,F^OҠsetthRIGHԠmarginan䠍 turnOΠwordwrapformattingancenteringThdefaulicolum1 whicturnOFƠalstorthmargins ^OàCENTERӠlinwitrespectthcurrenmarginsiset ^OƠFLUSHEӠlinrightithrighmargiiset MISCELLAN٠(^^,^W,ESC-IJustexplaifemiscellaneoufunctions ^ޠ(ctl-caret bytefreeresponstimcageverslow PAGINATIOΠ(^OPTh^OРcommantogglepaginationWheonthpag堍 lengtdeterminethpaganlinshowithheade("PxLxx") analpagfunctionithPrinroutin [Yocannotogglpaginatiooithpaglengti0. PLACŠMARKERӠ(^PZ,^QPYocaseannumbeotemporarplacmarker ithtexwit^Pڠ(thewilappeaa^Z)Th^QРcommanmoveth堍 cursotthnex(^OPion (ThBlocmarkernormall^Bcannobembeddedan^ڠireservefo usaplacmarker.Controcodedisplaoscreeacapita젍 lettershighlighteipossibleVDŠassumethearnocharacterss thle^D^S^Y^Ԡswitche^Q^W^E^ҍ (IWordStathestogglearDoublestrikeUnderlineRibbonanSuper scriptbuyocamaktheanythinyolike."Togglesargoofo featurelikunderlinthaarturneoformattinfunctionsAthpromp"Column:ente thcolumnumbe(1-255)ojushiRETURΠfothcurrencurso columnIthivaluconflictwitthlefmarginthlefmargi wilbreset1 ^O̠setthLEFchangethcasothcharacteathcursorii waletteranmovetthnextUsefufocapitalizinstrino栍 lowercastextovicversa ^נwaitfobrietim(aboutwsecondsiclocspeeise (formfeedsheadersstart stoprintarenabled Wheoffthheadewilsa"P砰Lxxxx"showinyoth堍 absolutlinnumbeithfileAlsoprintinoccurwitnpag堍 breakoformfeeds(Thicabusefuplacmarkeithfilecyclinbactthtoo栍 thfilineeded(PlacmarkerarNOԠsavetdisk. PRINTEҠCODEӠ(^PControcodefospeciaeffectiprintincab堍 entereithtexwitth^РprefixThupressinearnocountewhereformattintext Fogreateconvenienceyocaalsarrangthavsingl^P codproducaentirstrinobytefocommonluseeffectsVDŠ supportsubseoWordStar'printeinstallationanoff"Switchesarbette fovaryinparameterlikcharactepitch ExampleyouprinteuseESC-U-(an0tturunderlinino (anoff)Thcrudwatdthiwoulbe ^P-ESC,U,1,underline   text,^P-ESC,U, ThsophisticatewawoulbtusVINSTAL̠tdefinthosstringa th^Ӡtogglesthaalyou'neewoulbe ^PS,underlinetext,^P PRINTINǠ(ESC-PThESC-РcommanPrintthfilfromnaHEADERThstringfollowe䠍 immediatelbthpagnumberwilprinathtorighoeacpag堍 neathmargin(Maximulengti5charactersusaemptstring ""tgenumberepagewitnheadetext.  ofekeystrokesdependinoyouBIOS) RULEҠLINŠ(^OTThelyoaligtexproperly^OԠdisplay"rule linebelothheaderTyp^OԠagaitremovit Ieaccolumyowilseonoseverasymbols"[tua^ɠ(ASCIɠTAB)whethethioverwriteanexistintexdepend othINSERԠtoggleHarTabdisplabdefaulafixeintervalo栍 screecolumns[Thiireconfigurablt2416etc.ݍ IVariablTamodethTingowitanoVDE'deletcommandsIƠthcursohano yebeemoveaway^ՠundeleteoncharacter^Qՠdoewholline RestrictionsundeletonlworkwitESC-Ġithcursowa adjacentthblocdeletedanrensectionotexwithifileo evebetweedifferenfilesTypin^OנagairemovethWindow (NoteWindowinionlsupportefoscreeno1omorlines. Th^Oڠcommantemporarilzap(blanksthentirscreemoryYowil젍 baskefoseo"Options:"awhicpoinyomaenteonomor堍 othfollowingianorder РPAUSEӠfoyoukeystrokbeforeacpag(sheefeed)  printonlthcurrentlmarkeThlasthreoption(@,#,""arNOԠalloweipaginatioiof栍 (^OP)oi"B"locprinwachosen Exampl1Options@6#1*2"Instructionspage"Ѝ wilprinoupagsiothfiltwicewitthheadeshownpa]designat堍 thcurrenmargins".indicateareaoutsidthcurrenmargins"- withithemAlsotastoparmarkebeithe"T(Variableo"I (Hard)Examples ("Amode[-----T-----T-----------T---------akemovethcursotthnex variabltastopExistintexinooverwrittenspacearaddea thenolinaneededUteightastopmabsewit^O anclearewit^O-thdefaultaricolumn515imaworimperfectliDE̠habee useseveratimeisequence Furtheusaftealdeletetexirecoverewilproducjun렍 (usuallduplicateotexabovthcursorwhicisometimeuseful) WINDOWZAР(^OWengoofo avoidinCRԠburn-inojusprotectinworfropryineyeofingers RestorthscreebpressinESC(NoteiWindowinwaieffect antexithwindowilblost. WORDWRAPREFORMAԠ(^B^ODWORDWBLOCK ޠFILTERӠcontrocharacter^ؠttex"^X" *nprintthjoounTIMEӠ(nn=1..255) @nbeginprintinAԠpagnn #nprintonl(utoTOTA̠onpages "...usethquotestriusin砍 beforeacpaguntiyopreske(othethaESC) Exampl2OptionsBލ wilprinouthcurrenmarkeBlockwitcontrofiltering YocaaborprintinaantimwitESà(thimatakmoment-----]....... ("NmodeI.......I.......I.......I.......I.......I...... TABӠ(^I^OV,^O+,^O-TherartwTamodesVariablanHardth^O֠ commantogglebetweethemIHarTamodthTakeproducea ac35an55 [Thesarreconfigurable.ݠYocaalwaygeHarTabtypin^PI UNDELETŠ(^U^QUThundeletfunctioncabuse(repeatedli栍 necessarytrecovereasonablamounotexdeleteeitheb overtyp^OZTh^OנcommancreateWindoithbottohal栍 othscreenwhicretaincopothfiltexstartinath堍 currenlineEditincontinuenormallithtohalothscreen ThiiusefufocomparindiffeRAРiautomatiwhenevethrigh margiisetAntexenterewilbformattewhilyotypetth堍 currenmargisettings ^ REFORMATӠfrothlinthcursoiontthenothpara graphaccordintth   currenmargisettinganlinspacing(Thu ^ iusenoonltreshapparagrapafteeditingbualst changitmarginanlinspacing. Thenoparagrapimarkeb"HARĠCR"whicoccurwhe yoerwisinvisibleca bcausetdisplaa"ExampletypinESC-K-wil젍 storthlasMacruseaKe0anicabrecalleanreusea anfuturacr(ESC-MstriniemptyusinESC-ˠwildeletKe definitionUsindefineKebringitstrinintthMacrbuffer TryintusaundefineKeresultiaerror Therar50bytetotaavailablfoal1presthRETURΠkey(ThiiCҠimmediatelfollowincharacte otext.Icontrastwhewordwraoccuryoge"SOFԠCR(whici actuallCҠwitspacbeforit)YocachangharCҠint᠍ sofoneovicveistrinoVDŠcommandantexthatonc堍 definedcabrepeateautomaticallyWheyotypESC-͠yowilb堍 askefothstringthe"Repeacount"Usuallyowilsimpltyp堍 numbefothrepeacoun(0-9o"*likFino Reformatardesignetgeneraterrorathenothfilstha᠍ globa("*"MacrcontaininthewilhalthereOtheglobaMacro maneetbabortemanually VDŠturnINSERԠOFƠbeforrunninamplomacroCayofigurouwhaidoes (Answer.eliehfdnehtmehftsignikaeliftu sesehtneranstnemmollekallitI ^QR,^QF,(,CR,^G,ESC-B,^QF,),CR,^G,ESC-T,^QC,CR,ESC-C,ESC-č timsimplbtypinESC-0 OrdinarilyKeyoperatjuslikthoriginaMacrothewilas렍 fo"RepeacountwheexecutedIyowantsuppresthi(givin砍 somethinmorlik"functiokey"thaonlexecuteoncekeysan12byt堍 limifoanonKey(VDE'owinpulinwilonlaccep6bytes buVINSTAL̠cahandlutthful128. BesidesimplstorinMacrosherarsomusefufunctioKeys 1Storindifferenrsabdeletinoaddinspacathenoth堍 lineHittinRETURΠalshardensofCRThdistinctiobetwee haransofCRionlimportanwheusin^ treformat ^OĠtoggleDISPLA٠OƠHARĠCRsHarCRsothfo"global-actuall25 times)Yowilsethresultathmacrexecutesanyocaabor iaantimbpressinESC (Iyoarsuryoknowhayou'rdoingyocaspeeuMacr executiobspecifyinmacrosthathsam堍 sequencwilalwayhavthsameffect Iordetincludaninpulineditincharacter(BSCҠetci macroyomusprefithewit^P(NOTETmaktheeasiet reaanunderstOnscreeyowilseeQRQF(MG[BQF)MG[TQCM[C[č VDŠMacroarverpowerfutoolsparticularlgivetheiprogra abilitanstoragofunctiokeys MACRϠKE٠(ESC-KUt1Macrocabstore(0..9)benterintheyoca typ"N(foNrepeatbeforstorinthkenumberExampleESC-K-N storeMacriKeaonce-onlfunctiokeySimilarlyoca makiQUIEԠonce-onlkewit"QinsteadeESC-K-Q-0 IthMsetomargin(efoquotes)foexample ^OL,12,CR,^OR,66,Cҍ 2Typinanfrequentlrepeatephrase"ESC-6imucmor堍 convenientha"WorlWidWidgetInc(N.A.)" [VINSTAL̠allowyo   tinstaldefaulseomacrKeysThu VDŠcabcustomizefoantasksucathformattinrequirement ospecializewritinoprogramminlanguages. MACRϠPROGRAMMINǠ(ESC-0..9ESC-!,=,~,#VDŠhaseveracommandwthen(aborts) ESC-anESC-~followebcharacteanthelabe0..(o "[","]")arconditionajumpsthejumtthalabeIƠthcharacte athcursopositiodoe(ofo"~"doesn'tmatcthaspecified g Macrprogramarstorejuslikanothemacrstrin(usuall wit"N"repeacount)Iyoprograiaendlesloopyowila sompoinhavtaborwitESCDon'makmacrprogram"Q"uie untiyou'rsDŠnotpreservBAˠfiles.ݍ LeVDE'filesizlimitencouragyotbreaworuintfile o50ˠolesslargefilemakinefficienusofloppdisks FILŠMODEӠI"Ao"NmodeVDŠreadanwritetexastandarli thdefauloption(marginetcseuwhenefililoaded Typicall"Aifoworprocessinan"Nifoprogramsetc DEFAULTӠFORFilI/ϠMargin󠠠Tab󠠠HarCҠdisp "W"ordstadocumenɠFILEӠTh"A"SCII-documenfilformausesincVDŠ 2.50talloaccuratformattinanWordStacompatibilitydistin guishebetweeHARĠanSOFԠCR(seWORDWRAP)Consequentlyiyo ediaASCIɠfilcreatebotheshic蠍 functioonliMacrstringangivyocontroovethexecutio omacroallowinreaprogramming ESC-0..9wheiMacrofunctioa"labels0..9Thehavn effectbucab"jumpedtbothecomESC-anESC-~followebcharacteanthe">o"<"ar堍 searcloopsThewilcontinutmovthcursorigh(ofo"<" leftalonathcharacteathcursodoe(ofo"~"doesn't matchountithurthework Exampleyocafinthstarothnexsentencwitthmacro ESC~.>,^D,ESC=_ ==========================GENERA̠INFORMATIOΠ=========================== DISˠSPACŠVDŠisn'disk-ASCIɠ 7-bicharactersformaacceptebvirtuallalsoftwar(includin砍 WordStar'Non-Documenmode)I"WmodeVDŠreadanwriteWordSta DocumenfilesWordStaDocumenfilcabreaintVDŠperfectly excWORDSTAҠACTIVŠVARIABLŠO΍ "A"SCIɠdocumenASCIɠACTIVŠVARIABLŠO΍ "N"on-documenASCIɠDISABLEĠHARĠOFƍ Thfilmodoptiocabspecifiealonwitthfilenamaoftwar(includinearlieversion oVDE)imaappeatbfuloharCRsmakinteximpossiblt reformatTherartweaswaytsolvthiproblemfirstyoca us^Qtfin"^M"anselectivelreplacthewitmands ESC-followeb0..isimpl"jumpinstructioncausinmacr executiotresumwitthcommanfollowinthlabeESC-0..9Atw epeciacasesESC-!۠jumptthbeginninothMacroanESC-!ݠ jumptbeginninoenothfile ESC-#followeb0..9iuset"chaintanothemacrkeyI thiwayocabuilustringlongethath65/128-bytlimioan onkeyIdoeno"callthkeytherinreturninboundiyoruouodisspacejusinser anothedis(alwaykeeblanFORMATTEĠdisaround)Alternatively yocausthESC-ƠanESC-Šcommandtpurgunneedefiles[I栍 yohavsmaldisksyocaalsinstalVepthaanrighjustificatiowilblostVDŠ"Wfilcab堍 reaintWordStaaDocumenfilnearlperfectlyyocaeasil toucuthoccasionaglitch Th"Nan"AmodebotproducASCIɠfilesandiffeonan VDŠfilfunctiopromptallowinyotmiWordStaanASCIɠdis렍 fileaneededYocaalschangthcurrenmodwitthESC-Π functiobenterinnemod(eg"[W"witowithoufilename NOTŠOΠASCI^M"Alterna tivelythfollowinMacr(besstoreaQuiemacrKeydoegoo䠍 joo"softeninupparagraph ^QS,^X,ESC=_],ESC=CR],^S,^V_^V,^D,ESC! HYPHENATIOΠVDŠcan'hyphenatebuidoerecogniz   hyphenithtext treatinthealegitimatplactbrealine(Siyou'rtypin砍 lonworclostthmarginyocatyphyphewheryou'lik堍 thwortbbroken.IVDŠitryintreformaanfindhyphen Thbeswatrestoritnormaibblankinanrestorinth堍 scree(^OZ,ESC) KEYBOARĠBUFFEҠVDŠ2.hafastescrollingalsoinobufferitow keyboarinputThimeanthacharactertypewilnlongetgeanothescodeintthstrin砍 itselfyomusprecediwit^Р(thiinclude^P) Examplestfinlinbeginninwit"*(fin"CR,*"typ ^QF,^P-CR,*,CR NotgethiintMacrwitScrolU𠠠^נESCcasinsensitivsearches morfreRAMwidevarietoterminalsfastescrolling keyboarbufferimprovementtVINSTALL *************************************************************** ***HEؠoverlaysspeciadocumentationiyowish ThanktthmanuseroVDŠwhosfeedbachaletimprovement anbufixeithpastAnswertcommoquestions (1SourccodtVDŠ2.xinoavailablathitimestallVDE/͠beforusinitVDŠcanob堍 installefoAN٠terminaliimproperlinstalledthdisplamab᠍ messbutherarnothesideffectsVD͠requirecomputewit蠍 memory-mappevideoiimproperlinstalledimacrasscreefunctionsmorscree sizesupportedWordStafilmodeplacmarkers^OZ blocprintlargemacrkeysVINSTAL̠terminamenu 2.(3/87Usearesupportvariabltabsdoublspacingsearc*ThVDŠeditoanitdocumentatioar堠**** ****(c)198EMeyeralrightreserved**** ****Thiprogramabfreeldistributedbunosol**** ****foprofiwithouwrittepermissioo (2AMSDOӠversiooVDŠmabavailabllatei1987 Direcproblereportansuggestiontmathaddresbelow includstampereturenvelopforeplidesired EriMeye 42NWaVINST26.DOÍ ---------- [SupplementVDE.DOC InstuctionfoVINSTAL̠2.6(07/87 InstallatioUtilitfoVideDisph MosusershoulbabltinstalVDŠsimplbgointthTermina젍 Installatioanchoosinthisoptiotselecfromenoterminal alreadbuilintVINSTALLThlisinoexhaustivebuiincludemos basitype   sfoexampleth"LearSiegleADM3datshouldwelenougo QumeWyseFreedoanmanotheterminalsawelamancomputerstha emulataADMterminalChecyoumanuatsewhetheyoumachin堍 emulateonothmenuocnumbeoUseOptionaffectinthoperatiooVDŠtha yocaselecomodiftsuiyoutasteandefaulseoMacrKeys ThdefaulprinteinstallatioibasiTeletyp(nspeciacode enabled)VDŠassumeonlthathA>vinst2vde2 anselectinthvalueyowantchangeIyohavtdmanua젍 installatiooVDŠfoyoucomputeryomawantcreata"installatio filewhicyocaus(angivtotherstsupplementhbuilt-i terminbspecifieothcommanlineeg A>vinst2vdm2mykeys.vd Therarals"printefilesotyp".VDP"whicstoryouprinte installatiodataanworthsamway A>vinst2vdm2okidata.vdNot堍 thaAL̠thnumbeentriVINSTAL̠iHEXADECIMALyowilfingoo䠍 ASCII/base-conversiocharhelpfulVINSTAL̠can'checfoillegavalues bcarefuwhayoenter Whafollowimordetaileexplanatiooinstallaasafe"Ntsavdisspace DefaulfilmodW/A/ΠWhicoththrefilmode"W","A","N describeiVDE.DOàdyowanathdefault Defaulinsero(Y/NDyowanthINSERԠtoggltstarouOΠ wheomecloseOncyohavVDŠbasicall workingyomawantgthrougthdetailediprocedurtfintun堍 thingsthbettethinstallationthfastethdisplawilwork InstallinVDŠfoyoucomputeshoulnobdifficulprinterespondnormalltBackspac(i栍 ^PȠiused)LinefeedanFormfeedYowilprobablwantredthiss yowilhavaccestyouprinter'speciafeatures ============================RUNNINǠVINSTAL̠==============alisoVINSTALLThiidonbspecifyinanothefilename A>vinst2vde2termname{.vde VINSTAL̠willoaanus(ocreatethfilTERMNAME.VDŠ(o.VDM)an䠍 updatiawelaVDE.CO͠wheyoexitThinstallat (Noyocan'specifmorthaonsupplementafilaonce.Thversio numberoVDE/MVINSTALLananothefilemus"agreeoyowilge aerrorThmatcneenobexactathermabnereleasoVDŠ withoumodifyitioitemsi abouthsamordeaithVINSTAL̠procedureMospeoplwilbusin砍 VDEyocatrtusVD͠insteaiyohavmemormappevidewith(1 higbithacabusethighlighanprovidcursor(2aabsolutfirsenterinVDE Defaulruleo(Y/NDyowanthRulelin(^OTtstarou OΠwhefirsenterinVDE LefanRighmargicolumn(00-FFDefaulmargisettingfo "W/AmodesSebotttentireldtIyofin䠍 thaiwaspleasconsidedroppinmnotwitthdetailowhawa requiredsthafuturversionoVINSTAL̠cabimproved TerminainstallationwhilnecessaryionlonparoVINSTALL Therarals============== VINSTAL̠SYNTAXA>vinstal{d:}vdename{.com{instfil"{}"=optiona TypicallyyocausVINST2tmodifVDE26.CO͠(ocoursefeefre堍 trenamthesfilemorconvenientlysimplbtyping iofiliver smallcontaininjusterminaparameter(nuseoptionsetc) Iialspossibltcreat"kefilesoVDŠmacrkedefinitions Thesworjusthsamwayexcepthemushavfiletypo".VDK"an䠍 thimusnthinstallatioareas VINSTAL̠ilargelself-documentinganstepyothrougeacite individuallyIthiiyoufirstimrunninthprogramtakadvantag堍 oit"Helpoptiobeforyostarinfosombasiinstructions addresaoabov3000hThadvantageoVD͠oveVDŠarfastescree updateanlittlmorfrememory USEҠOPTIONӍ CreatBAKufile(Y/NShoulbackufilbmadwheyoedi aexistinfileChoos"Ytplisablwordwraanreformatting Paglengt(00-FFSethnumbeotexlinetprinopage (Doenoincludanothe򠳠linefoheaderiused.Settint disablepaginatioentirely Scroloverla(00-l   inesThiithnumbeolineoverlabetwee screenwhescrollinwit^R/^CThsmallerthlargethscroll Shosystefile(Y/NDyowanfilewitthSYSteattribut堍 tshoithVDŠdirectordisplay rminabeltrinwhe VDŠerromessagdisplays Alternatvideiheade(Y/NDyowanthheadermessageset㠍 tappeaicontrastinvidemod(iinstalled) Blocmarcharacte(00-7FUsuall^ (02)ee scrollinthcurrenlinanscrollinthresothscreenwhe workinbeyonthrighscreeedgeThaveragvalui80adjusu odowayolike(VD͠isfasthavaluo0irecommended. HarTaEntethwidtoyouscreei columnsThnormavalui50foa80-columscreen Screeline(04-FFEntethnumbeolineoyouscreen Normall18fo24-linscreens DELetcharacte(00-7FVDŠalhere.ThdefauliCP/͠^K,^J,^Lenterea0B0A0CFF(I栍 yohavANSɠstandararrokeysyocasealthestFF. TerminainituniniEntethcodeyowansentinitializ堍 youscreeoentrintVDEantuExampleESC-Ԡi(02)1B54Iyouterminacan'dthi thezeriou(00) Alternatvideon/of栭Entethcode(#),bytetturyou favoritvideattribut(einversedimoanoffThiwilbuse䠍 foconFixedrive(A-PThiletyospecifthauttwCP/͠logica젍 drivearnonremovablmedi(haroRA͠disk)sVDŠwon'resethe beforwritintthemspeedinusomsystemsEntetwdrivefro "At"P"tbuiyoneet imbethacodiyoufilefoanreaso(egZCPR3yocachang堍 thitsomothe(otherwisunusedASCIɠcodesuca0(^@) Wildcarcharacte򠭠Normall"_"thiithcharactethawilb堍 udisplaspacin砠ThideterminehoanactuaTab(^I iyoutexwildisplayUsuall08thicabmad020410o anothepoweotwoOthevaluewilproducerratiresults Variabltastop󠭠Enteliswayaccept7ƠadeletkeyI栍 youkeyboarcan'generatthiyocainstalaalternatvaluher堍 (example1Ơenable^ߠoaOsborn1)IyohavDE̠keyyoca leavthiathdefaulvalueFƠfo"noused" ninitializoexitithfor (obytes),bytesExample^ڠi(01)1AMinimallybotsetocode shoulcleathscreen TERMINA̠INSTALLATIOΠ(GeneriVDŠonly Autowraalinen(Y/NUsuallYesamosterminaltrocodean(optionallythheadeanmessagesIyou terminahanattributeszerthesou(00) Ushigbifoaltvide(Y/NIfinsteadyouterminaneed thhigbiseocharactertputheialternatleaveitheblankente"@"(Thdefauli"@@"o noneiyohavRA͠drivC:ente"C@".Cautionnaminflopp drivhercacausseriouBDOӠerroroCP/͠systems Rinbeloerro(Y/NDyowanyouteseawildcariFINĠstringsChangiyowish ClocspeeiMH(01-FFSethitreflecyouCPՠclocspeed mosZ8computerar4.MH(us4here) Horizontascroldela(01-FFThiadjustthdelabetwoutvariabltasto columnsiascendinorder(Colum0ithleftmost. TERMINA̠INSTALLATIOΠ(Botversions TerminaIĠIdentifthterminayoarinstalling(1characters Viewablscreecolumn(28-FFArrowupdownrightlef(00-7FEntethASCIɠcodegenerate䠍 byouterminaarrokeyithiorderonbyteachIgnorparity UsvaluoFƠtmea"noused"(WordStaarrowanBӠneenob堍 redefinewradow tthnexlinwhecharacteiprinteathrighedgoth堍 screenIyourdiscardcharacterinsteadsethitNo Cleatenolin堭Entethcodetcleatthenothline a(#),bytesvideozerth堍 abovstringouansaYehereotherwiseNo Consolfilte(7D-FFThiithhighesASCIɠcodthawilb堍 sentthscreenNormall7Fiyouterminacan'displacode7Ơ o7Š(DE̠antilde   )lowethit7Šo7DCharacterfiltereou wildisplaa"?" Cursopositioninmod(S/R/A/NThitellVDŠhoyoutermina젍 cabmadtputhcursoaangiverow/columothscreen "S"tandaefttwleabytesthetwrow/columoffsets MosterminalusESC,=,20h+row,20h+colo1B3D2020Iyohavonl onleabyteente0fothsecondIƠYOՠCHOSŠ"N"theyomus entetw2-bytsequenceinsteadfirserminalcadthis ExampleoaADM3-stylterminalESC-Šo(02)1B4insertline whilESC-Ҡo(02)1B5deletelineFosomterminalsyohavt specifwhiclinitbinserted/deletedithicaseenteth堍 hav80(128byteoRA͠pelinebuonl sho50(80othemStherwoulb30unusecolumns Cursoon/of栭Entethcode(#),bytetturthregulaCP/͠ cursooanoffsiwon'appeaothVDŠscreenIfoeacroutineanyomus preservalthCPՠregistersanenwitRETYoshoulfinth堍 assemblecodtdthiiyouterminamanualtconverithex eitheloouthhevalueiZ8referencbookoustrin(#),bytetsentthprinte afteeacprinjobtrestorprintetdesirestatoexit Toggleanswitche󠭠Thesarth^P-codethawilbusetcal젍 upredefinesequencesTherarfoutogglesthefour䠽leadibyte(s)robytecolumbyt(default "R"everse䠽leadibyte(s)columbyterobyt "A"NSɠst䠽ANSɠstandarsequence"ESC[rr;ccH "N"on堠nabsolutcursoaddressinsupporte onthomthcursortheon堍 tmovirightIeitheionlonbyteente0fothsecond Typicavaluearhome=1Ehright=0Chwhicwoulmak1E000C00 Delaaftecursopositionin(00-FFNormall00Somssequencefolin報(thseconscreeline)Iyouterminacan'd thiaallzerthesou(00) Ins/despecifitlin報UsuallNosetYeonlithins/de젍 sequenceyoinstalleabovarfolin報onlyryocan'd thizertheou(00)anthcursowilremaivisiblathuppe corneothscreen VideRA͠star(3000-FFFFEntethstartinaddresoyouvide memoryafouhedigits Videin/oucDDԠo ASM/MAàtwritanassemblthcodtheform PRINTEҠINSTALLATIO΍ PrinteIĠIdentifthprinteyoarinstalling(1characters SenLƠafteCҠ(Y/NNormallYesBuwitsomprinterswhic蠍 maswitches Thdefault(^D,^S,^Y,^T^Q,^W,^E,^RarchosefoWordStacompat ibilitybucabchangeiyowant(Avoi^B,^H,^I,^J,^L,^M,^Z whicarusefoothepurposes. Codefotoggle(on/offEntethCursopositioninsequenc堭Thiithactuasequencuset addresthcursorIƠYOՠCHOSŠ"Aaboveyocaskithientirely IƠYOՠCHOSŠ"So"R"theenteth4-bytsequencfoaddressinth堍 cursotthtollo terminalrequirdelahertaccompliscursomovementadjusthi valuupwardanecessary InsertDeletlin堭Sequencethawilcausthcurrencursolin堍 tbdeletedonelininsertethereMostathethageneral TERMINA̠INSTALLATIOΠ(Memory-mappeVD͠only UnusecolumnoRA͠(00-FFEntethnumbeounusebytei videRA͠betweethenoonvisibllinanthstarothnext Examplemancomputerod堭IyouvideRA͠iithordinarbano栍 memor(egaF000)jusente"C9her(that'REԠinstruction) Otherwiseyowilneethmachine-languagcodtswitcvidememor ianoutTherar1byteavailablnufacturtheiowLƠoreceivinCRyowilwanNhere PrinteinitializatioEntestrinocod(#),bytetsent thprintebeforeacprinjobtsemarginsprinmodeetc PrinteuniniEnteanothesactuacode(#),bytetsen䠍 tfhprinteoencounterineacothfoutogglcodedefine䠍 abovefirstturfeaturontheoff Codefoswitche󠭠Entethactuacode(#),bytetsentth堍 printeoenco   unterineacothfouswitchedefineabove MACRϠKEYӍ VINSTAL̠giveyothabilittexaminanchangthdefaulseo栍 macrKeyiVDE(AnKeydefinewitESC-ˠwhilrunninVDŠ overridthdefaults.VINSTALsselecthnumbeothKeyo wistredefinethetypithnedefinitionmucayowouli VDEAlthsamruleappl(buVINSTAL̠wilacceplongekeysu t12bytes)Ithnedefinitioitolontfiretosmall yocaalsusut3extrbytebeforitThiithPrinSwitc蠍 codareayomustheavoiusinthfouSwitccodes VINSTAL̠alstellyothaddresseothcommantableiVDE/M Yomafi"keycodes80-84ith堍 tablesthesmeaDE̠antharrokeyshoweveinstalled. Don'trtchangthESCprefit^KtmakVDŠmor"WordStar like"Iwiltakyowhiltlocatalthoccurrencesanleav堍  =========================GOINǠBEYONĠVINSTAL̠========================== Iyoucomputerequirespeciaadditionacodeanyoknohot usaassembleryomawantmakaoverlatadthicodtVDE (Yomaals thicodjusensurethait'iSoromod(whiciwhaVINSTAL̠ise ufor)ansetthcursoanDE̠kedefinitionproperly TherianotheproblemthVDŠcastogglcomman(^^hatb堍 changedaiwilconflicwitogiveyodisplamuclikthis MACRϠKEYS(01Cbytefree<---notfrebyte(ut01F500 <0>< <1><<---"<>flameanempt <2>< <3>^C^נ<---niwilb堍 rejected FURTHEҠUSEҠPATCHINǍ ThaddresothUsePatcarewilbgivetyobVINSTALL ThismalregioiVDŠcabusetinstalanextrpatccodyo need(Exampleiyouvidein/ouronthiusefuiyoneetgianchangVDŠcommanke thaconflictwityoucomputer'firmwareTherarfoucomman䠍 tablesbasicESC^Qan^OEaciliso3-bytentrieswit᠍ onbytkeycodethetwyowitsomprettconfusinpairocommand(e^KؠeXit^K^ؠ shifscreedown) RESTORŠDEFAULTӍ Thioptioiprovideitheventhasomeonhasmuckeuyou copoVDŠthayocan'sorouwhat'wrongfinthitheasieswatinstalothedatasucath堍 VidIN/OUԠroutinefothVD͠TerminaInstallation.Writthoverla filegeneratHEؠfilwityouassemblerthemergiwitVDE.CO͠ usinMLOAĠosimilautility(BsnothSoroarrokeys(Osomothe computersyocan'generat^ޠfrothkeyboaraall.Nothoth堍 overlafindthaddresothmaicommanmen(althmenaddressear堍 storea0108-010FiVDE.COMalternativelyyocormamacrke <4>< <5>WorlWidWidgetInc<---"flameanno-rpke <6>< <7>^QR^[B^QC^[T^[à<---"flameanquieke <8>< <9>< Thiiprettstraightforwardyojuutinewon'fiint1bytes yocajumtthUsePatcareanpumorcodthere.Thiith堍 ONL٠sucareavailableaVDŠusealavailablmemorafteitow codfoeditintextNoteiyofinthUsePatcabytaddress(Examplesyowilfinth堍 ^ԠcommananthESàprefiithbasitableth^Oؠcommanappear ith^Ϡtablea^X.FinthproblekeycodeanusDDԠoanothe utilittchangit(YowilalssethThishoulreturVDŠ tnearlthstatiwadistributeinalUseOptionrestoret theidefaultsTerminaInstallatiosetGeneri(oOsbornExec) printesetbasiTeletypenMacrKeysnUsePatccode urthcodfits! ExamplethfollowinoverlaaddspeciacodfothNEàStarlet thUsePatcareawheriiimmediatelexecutewheVDŠicalleup ThStarlehadifferenterminaemulationankedefinitionsmoso栍ageVINSTAL̠ttel젍 yowhatheare)addthappropriatoffse(determinthiyourself)an䠍 thechangethcommanketsomethinelse ;NEC840PatcfoVDŠ2.(808mnemonics or砠0100蠠;AbeginninoVDE   .COM jm0248蠠jumtUsePatcare or砠0248蠠;AUsePatcarea mv頠c,08蠠sescreemode mv頠e,81蠠Sorocwraonfnkeyoffet rsmv頠m,0C蠠changit^̠instea jm0480蠠;JumtVDŠStarpoin datad⠠4,7Fh,0,;Dattse"DELkeaDE̠(7F en YocaalsadcodlikthitVDE.CO͠usinth"acommanten VDE262.UPD ---------- Update Information - VDE 2.62 E. Meyer - 11/87 This is an addendum to VDE26.DOC and VINST26.DOC, des ^L = ^Z (repeat find) Most importantly, for frequent Wordstar users, all the ESC commands can now be accessed with ^K instead: ^KS, ^KX etc instead of ESC-S, ESC-X. New synonyms have also been defined for block operations: calspeciaBIOӍ mv頠c,4E蠠secursokeys mv頠e,tmappecode rscalspeciaBIOӍ mv頠c,4D蠠sedefinablkey lx頠d,datᠠusindatte assemblemnemonicidebugginutilitlikDDԠoSID EriMeyer42NWashingtonBloomingtoIΠ4740--CIӠ[74415,1305 ============================================================================= cribing changes made in version 2.62. Please read it! QUICK SUMMARY: VDE/VDM 2.62 provide increased compatibility with the Wordstar command set. Details follow. VDE/VDM: 1. THE COMMAND SET HAS BEEN MODIFIED to be more Wordstar co ^KK = ESC-T (end block) ^KY = ESC-D (delete block) Note that, as special cases, the following VDE functions continue to require the ESC- prefix, and will NOT work with ^K instead: ESC-M = MACRO belo rscalspeciaBIOӍ lhl0108蠠geaddresomaicommanmen lx頠d,6*offseo^ޠ(thimachange da䠠䠠pointoffendin^ޠcod mpatible. The keys ^J,^K,^L may still be installed as CP/M arrow keys. IF they are NOT so installed, they will function as Wordstar synonyms for VDE commands: ^J = ESC-H (help) ^K- = ESC- (block prefix)  ESC-K = KEY define (note ^KK is End Block!) ESC-# = use KEY 2. As a side effect, it was necessary to redefine the Window Shift commands (formerly ESC-). These now use a new prefix, ^W: ^W- = shift window up/down/right/left Note that ^W still has the function Wait when used in a Macro. 3. There is a new command ^OH to toggle the status of Hyphenation. The default is still set with VINSTALL. 4. There is a new Print option. The "W"ordstar file mode now undoes justification (removes soft spaces in text) when reading in a file. Left margins are retained. This was always the intent, but it didn't work -- the spaces were left in and hardened. 8. The original INSEReo RAM to be 128 bytes. VINSTALL: Illegal hex digits (like X,Y,Z) are now rejected. NOTE ON MACROS: The explanation of macro use in VDE.DOC is admittedly scanty. Here is a further example of use of jumps, for those who need it. This mgoto label2 ; or a Return MSDOS NOTE: An IBM PC version of VDE may be available in the near future. VDE261.UPD ---------- Update Information  comes upon a hyphen at the end of a line, it can't be sure whether it should be removed in joining the next line of text. Earlier versions of VDE would halt with an Error at this point, forcing you to make a manual adjustment and hit ^B again. Now After your choice, reformatting will proceed automatically. VINSTALL: 1. In the User Option list there is a new choice: "Enable Hyphenation?". Select "Y" to allow reformat (^B) to recognize hyphens as word breaks, or "N" to avoid messing w: "=nn" will cause the page numbering to begin at "nn". Example: "@12=40#4" will print out pages 12-15, but number them as 40-43. Useful for coordinating page numbers across multiple files. 5. There is no longer a help prompt "ESC-H=help" iT status will be restored after running a Macro. (It is still turned off when the macro begins.) VDE: Commodore 128 users with RGB monitors can now use colors for high- lighting. A problem which caused the highlight color to propagate all ovacro moves the cursor to the start of the current sentence: ESC~.1, ^S, ESC1, ESC~.<, ESC2, ^D, ESC=_2, ESC=^M2 You could write this out in pseudo-code as: If not "." goto label1 Left ;mo- VDE 2.61 E. Meyer - 8/87 QUICK SUMMARY: VDE/VDM 2.61 fix several bugs in release 2.60, and provide the following new features: * improved hyphenation in text reformatting * new , instead, you will be asked "Chg? (Y/N)". You have three choices: Press "Y" to remove both the hyphen and the space after it; "N" to leave the hyphen in, but remove the space after it; "ESC" to leave both the hypith them entirely. 2. The following terminals have been added to the VINSTALL menu: TRS80-Holmes CPM (VDM) Northstar Advantage (VDE) Let me know if there are any problems with these; TRS80 people especially have n the header. 6. When in "W"ordstar file mode, the Print function will now ignore dot commands (lines beginning with a "."). They don't set anything in VDE, but they won't print out either. If you want to print them switch to "A" mode. 7er the screen with the cursor, due to an idiosyncrasy of C128 video, is fixed. VDM: The memory mapped version can be used on a wider variety of computers, including the Exidy Sorcerer. It no longer requires the logical width of lines in vidve left if already on period label1: While not "." go Left ;move left to previous period label2: Right ;now move back right If " " goto label2 ; as long as you see a space If "^M" terminals on the VINSTALL menu VDE.COM is still only 12K. Details of changes in version 2.61 follow. VDE/VDM: VDE can recognize a hyphen ("-") as a legitimate place to break a word in reformatting. Consequently, when VDE is reformatting andhen and the space. Typically you would choose "Y" if it was a "soft" hyphen, that you entered in order to get a wordbreak ("ter-minal"); "N" if it is a "hard" hyphen that is actually part of a word ("vis-a-vis"); or "ESC" if it is a punctuation mark.  been having difficulty in the past. VDE 2.6 BUG FIXES: 1. The cursor is no longer misplaced after entering a control code with ^P at a string prompt in VDM. 2. The User Options to default to INSERT ON and RULER ON now work properl   y. (Insert didn't work; Ruler messed up the screen count.) 3. Global replace (^QA) no longer fails to halt under certain unusual circumstances. (Many thanks to Ed Garcia for noticing this!) MSDOS NOTE: I have confirmed that VDE work Ctl- i reserve fo us a plac marker. Contro code displa o scree a capita letters highlighte i possible VD assume the ar no characters s the ar no counte whe reformattin text. Fo greate convenience yo ca als arbon an Super- script bu yo ca mak the anythin yo like. "Toggles ar goo fo feature lik underlin tha ar turne o an off "Switches ar bette fo varyin parameter lik characte pitch. Example you printe use ESC-U- (an 0hee feed). print onl th currentl marke BLOCK. Ctl- FILTER contro character Ctl- t tex "Ctl-X". *n print th jo ou n TIME (nn=1..255). @n begin printin A pag nn. #n print onl (u to TOTA o n pages. "... use th quots very well under a CP/M emulator on an MSDOS system. (Z80 emulation required; install for whatever terminal emulation you are using. Avoid specifying user numbers.) VDM, unfortunately, will not work: its video RAM routines can't handle the structrang t hav singl Ctl-P-cod produc a entir strin o byte fo commonl use effects VD support subse o WordStar' printe installation seve definabl codes fou toggles fou switches Th Printe Installatio i VINSTAL allow y t tur underlinin o (an off) Th crud wa t d thi woul be: Ctl-P-ESC,U,1,underline text,Ctl-P-ESC,U,0 Th sophisticate wa woul b t us VINSTAL t defin thos string a th Ctl- toggle s tha al you' nee woul be: Ctl-PS,unde strin a HEADER Th string followe immediatel b th pag number wil prin a th to righ o eac pag nea th margin (Maximu lengt i 5 characters us a empt string "" t ge numbere page wit n heade text.) Th las thrure of IBM video memory. ----- Eric Meyer, 427 N. Washington, Bloomington IN 47401 ----- are using. Avoid specifying user numbers.) VDM, unfortunately, will not work: its video RAM routines can't handle the struct standar code are: Ctl- -backspac -overstrik previou character Ctl- -har (ASCII ta -printer respon variousl t this Ctl- -formfee (No recommende whe paginatio (Ctl-OP i on) (Th Bloc marker normall Ctl-B canno b embedded ano t choos wha code yo wan t use an instal th actua contro sequence you printe needs Th default are: toggle Ctl-D Ctl-S Ctl-Y Ctl- switche Ctl-Q Ctl-W Ctl-E Ctl-R (I WordSta thes toggle ar Doublestrike Underline Riberline text,Ctl-PS PRINTIN (ESC-P -Th ESC- comman Print th fil fro memory Yo wil b aske fo se o "Options:" a whic poin yo ma ente on o mor o th following i an order: PAUSE fo you keystrok befor eac pag (se option (@,#,"" ar NO allowe i paginatio i of (Ctl-OP) o i "B"loc prin wa chosen. Exampl 1 Options @6#1*2"Instructions page"P wil prin ou pag si o th fil twice wit th heade shown pausin befor eac pag unti yo pr   es ke (othe tha ESC). Exampl 2 Options BCtl- wil prin ou th curren marke Block wit contro filtering. Yo ca abor printin a an tim wit ES (thi ma tak moment o fe keystrokes dependin o you BIOS). RULE LIN (Cttl-O- -Ther ar tw Ta modes Variabl an Hard th Ctl-O comman toggle betwee them I Har Ta mod th Ta ke produce a actua Ctl- (ASCI TAB) whethe thi overwrite an existin tex depend o th INSER toggle Har Tab displa  curren marke Block wit contro filtering. Yo ca abor printin a an tim wit ES (thi ma tak moment o fe keystrokes dependin o you BIOS). RULE LIN (^OT -T hel yo alig tex properly ^O display "rule line belo  Har Ta mod th Ta ke produce a actua ^ (ASCI TAB) whethe thi overwrite an existin tex depend o th INSER toggle Har Tab displa b defaul a fixe interval o scree columns [Thi i reconfigurabl t 2 4 16 etc.] I wit an o VDE' delet commands I th curso ha no ye bee move away ^ undelete on character ^Q doe whol line. Restrictions undelet onl work wit ESC- i th curso wa adjacen t th bloc deleted an i ma wor imperfectleren files Typin ^O agai remove th Window (Note Windowin i onl supporte fo screen o 1 o mor lines.) Th ^O comman temporaril zap (blanks th entir screen goo fo avoidin CR burn-in o jus protectin wor fro pryin eyl-OT -T hel yo alig tex properly Ctl-O display "rule line belo th header Typ Ctl-O agai t remov it. I eac colum yo wil se on o severa symbols "[] designat th curren margins ". indicate area outsid th curren mab defaul a fixe interval o scree columns [Thi i reconfigurabl t 2 4 16 etc.] I Variabl Ta mode th Ta ke move th curso t th nex variabl ta stop Existin tex i no overwritten space ar adde a th en o lin a th header Typ ^O agai t remov it. I eac colum yo wil se on o severa symbols "[] designat th curren margins ". indicate area outsid th curren margins "- withi them Also ta stop ar marke b eithe "T (Variable o "Variabl Ta mode th Ta ke move th curso t th nex variabl ta stop Existin tex i no overwritten space ar adde a th en o lin a needed U t eigh ta stop ma b se wit ^O an cleare wit ^O- th default ar i colu i DE ha bee use severa time i sequence. Furthe us afte al delete tex i recovere wil produc jun (usuall duplicate o tex abov th cursor whic i sometime useful). WINDOW ZA (^OW ^OZ -Th ^O comman create Windo ie o fingers Restor th scree b pressin ESC (Note i Windowin wa i effect an tex i th windo wil b lost.) WORDWRAP REFORMA (^B ^OD -WORDWRA i automati wheneve th righ margi i set An tex entere wil b formatte whrgins "- withi them Also ta stop ar marke b eithe "T (Variable o "I (Hard) Examples: ("A mode [-----T-----T-----------T--------------]........ ("N mode I.......I.......I.......I.......I.......I....... TAB (Ctl-I Ctl-OV,Ctl-O+,C needed U t eigh ta stop ma b se wit Ctl-O an cleare wit Ctl-O- th default ar i column 5 15 35 an 55 [Thes ar reconfigurable. Yo ca alway ge Har Ta b typin Ctl-PI. UNDELET (Ctl-U Ctl-QU -Th undelet functioI (Hard) Examples: ("A mode [-----T-----T-----------T--------------]........ ("N mode I.......I.......I.......I.......I.......I....... TAB (^I ^OV,^O+,^O- -Ther ar tw Ta modes Variabl an Hard th ^O comman toggle betwee them Imn 5 15 35 an 55 [Thes ar reconfigurable. Yo ca alway ge Har Ta b typin ^PI. UNDELET (^U ^QU -Th undelet function ca b use (repeatedl i necessary t recove reasonabl amoun o tex delete eithe b overtyping o  th botto hal o th screen whic retain cop o th fil tex startin a th curren line Editin continue normall i th to hal o th screen Thi i usefu fo comparin differen section o tex withi file o eve betwee diffil yo type t th curren margi settings. ^ REFORMAT fro th lin th curso i on t th en o th para-graph accordin t th curren margi setting an lin spacing (Thu ^ i use no onl t reshap paragrap afte editing bu a   ls t chang it margin an lin spacing.) Th en o paragrap i marke b "HAR CR" whic occur whe yo pres th RETUR key (Thi i C immediatel followin characte o text. I contrast whe wordwra occur yo ge "SOF CR== MACRO ================================== MACR (ESC-M - "macro i strin o VD command an tex that onc defined ca b repeate automatically Whe yo typ ESC- yo wil b aske fo th string the "Repea count" Usuall yo w Man command (lik Fin o Reformat ar designe t generat error a th en o th fil s tha globa ("*" Macr containin the wil hal there Othe globa Macro ma nee t b aborte manually. VD turn INSER OF befor runnin mswer .eli eh f dn eh t meh f tsi gnika eli f tu sesehtnera n stnemmo ll eka lli tI) ^QR,^QF,(,CR,^G,ESC-B,^QF,),CR,^G,ESC-T,^QC,CR,ESC-C,ESC-D Onscree yo wil see QRQF(MG[BQF)MG[TQCM[C[D VD Macro ar ver powerfu tools executed I yo wan t suppres thi (givin somethin mor lik "functio key" tha onl execute once yo ca typ "N (fo N repeat befor storin th ke number Example ESC-K-N- store Macr i Ke a once- onl functio key Sim usefu functio Keys: 1 Storin differen set o margin (e fo quotes) fo example ^OL,12,CR,^OR,66,CR 2 Typin an frequentl repeate phrase "ESC-6 i muc mor convenien tha "Worl Wid Widget Inc (N.A.)". [VINSTAL allow yo t in (whic i actuall C wit spac befor it) Yo ca chang har C int sof one o vic versa b deletin o addin spac a th en o th line Hittin RETUR als harden sof CR Th distinctio betwee har an sof CR i onl il simpl typ numbe fo th repea coun (0-9 o "* fo "global --actuall 25 times) Yo wil se th result a th macr executes an yo ca abor i a an tim b pressin ESC. (I yo ar sur yo kno wha you'r doing yo ca speacro s tha th sam sequenc wil alway hav th sam effect. I orde t includ an inpu lin editin character (BS C etc i macro yo mus prefi the wit ^P (NOTE T mak the easie t rea an understand Macr listing wil b  particularl give thei progra abilit an storag o functio keys. MACR KE (ESC-K -U t 1 Macro ca b store (0..9) b enterin the wit th ESC- command the usin ESC- t sav them The ca the b recalle an use simpl b tilarl yo ca mak i QUIE once-onl ke wit "Q instead e ESC-K-Q-0. I th Macr (ESC-M strin i empty usin ESC- wil delet Ke definition Usin define Ke bring it strin int th Macr buffer Tryin t us a undefine Ke stal defaul se o macr Keys Thu VD ca b customize fo an task suc a th formattin requirement o specialize writin o programmin languages.] MACR PROGRAMMIN (ESC-0..9 ESC-!,=,~,# -VD ha severa command whic functio onimportan whe usin ^ t reformat. ^O toggle DISPLA O HAR CRs Har CRs otherwis invisible ca b cause t displa a "< character Thi ca b useful som ma fin i distracting s i turn off. ===============================e u Macr executio b specifyin "Quiet mode pres "Q befor th repea count Onl th heade wil b update a th Macr runs.) Macro als sto an tim a erro occurs th erro messag wil b visible an ca b cleare b pressin ESCgive her a the function no a the ar type in ^ prefixe a neede ar NO shown Key-stroke ar separate b dashe o comma fo clarity an "_ mean spac o blank.) Her i a exampl o macro Ca yo figur ou wha i does (Anypin ESC-<#> Example typin ESC-K- wil stor th las Macr use a Ke 0 an i ca b recalle an reuse a an futur tim simpl b typin ESC-0. Ordinarily Key operat jus lik th origina Macro the wil as fo "Repea count wheresult i a error. Ther ar 50 byte tota availabl fo al 1 keys an 12 byt limi fo an on Key (VDE' ow inpu lin wil onl accep 6 bytes bu VINSTAL ca handl u t th ful 128.) Beside simpl storin Macros her ar soml i Macr string an giv yo contro ove th executio o macro allowin rea programming. ESC-0..9 whe i Macro functio a "labels 0..9 The hav n effect bu ca b "jumped t b othe commands. ESC- followe b 0.. i simp   l "jump instruction causin macr executio t resum wit th comman followin th labe ESC-0..9 A tw epecia cases ESC-! jump t th beginnin o th Macro an ESC-! jump t th en (aborts). ESC- an ESC-~ followe b characte thi wa yo ca buil u string longe tha th 65/128-byt limi o an on key I doe no "call th key ther i n returning. Macr program ar store jus lik an othe macr strin (usuall wit "N" repea count) I yo progra i a iles [I yo hav smal disks yo ca als instal VD no t preserv BA files.] Le VDE' filesiz limit encourag yo t brea wor u int file o 50 o less large file mak inefficien us o flopp disks. FIL MODE -I "A o "N moe onl i th defaul option (margin etc se u whe ne fil i loaded Typicall "A i fo wor processin an "N i fo programs etc. DEFAULT FOR Fil I/ Margin Tab Har C disp. "W"ordsta documen WORDSTA ACTIV VARIABL ON "A"SC betwee HAR an SOF CR (se WORDWRAP) Consequently i yo edi a ASCI fil create b othe softwar (includin earlie version o VDE) i ma appea t b ful o har CRs makin tex impossibl t reformat Ther ar tw eas way t sn. I VD i tryin t reforma an find hyphe a th en o line i wil qui wit a error Yo mus joi th line (an delet th hyphen i desired manually the pres ^ again. INSTALLATIO -VD ca b "installed fo differen termian the labe 0.. (o "[","]") ar conditiona jumps the jum t tha labe I th characte a th curso positio doe (o fo "~" doesn't matc tha specified. ESC- an ESC-~ followe b characte an the "> o "<" ar searc loopsendles loop yo wil a som poin hav t abor wit ESC Don' mak macr program "Q"uie unti you'r sur the work. Example yo ca fin th star o th nex sentenc wit th macro: ESC~.>,^D,ESC=_> ========================== GENERA Ide VD read an write tex a standar ASCI 7- bi characters forma accepte b virtuall al softwar (includin WordStar' Non-Documen mode) I "W mode VD read an write WordSta Documen files WordSta Documen fil ca b rea inI documen ASCI ACTIV VARIABL ON "N"on-documen ASCI DISABLE HAR OFF Th fil mod optio ca b specifie alon wit th filenam a an VD fil functio prompt allowin yo t mi WordSta an ASCI dis file a needed Yo ca als changolv thi problem first yo ca us ^Q t fin "^M" an selectivel replac the wit ^M" Alterna-tively th followin Macr (bes store a Quie macr Key doe goo jo o "softenin up paragraph: ^QS,^X,ESC=_],ESC=CR],^S,^V_^V,^D,ESnals printers et (a wel a variou use preferences usin th VINSTAL program Se VINSTALL.DO fo furthe details. INTERRUPTIO -I VD get interrupte b messag fro som othe softwar (BIO error residen utilities etc) i ma l The wil continu t mov th curso righ (o fo "<" left a lon a th characte a th curso doe (o fo "~" doesn't match o unti th beginnin o en o th file. ESC-# followe b 0..9 i use t "chain t anothe macr key I NFORMATIO ============================ DIS SPAC -VD isn' disk-bound i yo ru ou o dis space jus inser anothe dis (alway kee blan FORMATTE dis around) Alternatively yo ca us th ESC- an ESC- command t purg unneede ft VD perfectly excep tha an righ justificatio wil b lost VD "W fil ca b rea int WordSta a Documen fil nearl perfectly yo ca easil touc u th occasiona glitch. Th "N an "A mode bot produc ASCI files an diff th curren mod wit th ESC- functio b enterin ne mod (eg "[W" wit o withou filename. NOT O ASCI FILE -Th "A"SCII-documen fil forma use sinc VD 2.50 t allo accurat formattin an WordSta compatibility distin-guisheC![ HYPHENATIO -VD can' hyphenate bu i doe recogniz hyphen i th text treatin the a legitimat plac t brea line (S i you'r typin lon wor clos t th margin yo ca typ hyphe wher you' lik th wor t b brokeos contro o th screen Th bes wa t restor i t norma i b blankin an restorin th scree (^OZ,ESC). KEYBOAR BUFFE -VD 2. ha faste scrolling also i no buffer it ow keyboar input Thi mean tha character type wil n    longe b los eve o terminal wit ver slo displays I yo lea o on ke fo som tim yo ma manag t fil th buffer an key ma b lost. STRIN INPU -Whe confronte wit promp lik "Find:" yo ar expecte t typ i strinP-CR,CR. WORDSTA COMPATIBILIT -Th fe difference betwee th VD an WordSta comman set ar ofte du t th fac tha VD reserve ^J,^K,^ a th standar CP/ arro keys Excep th ^K-prefix mos ar minor: COMMO FUNCTIO W VD NOTES ============================ MESSAGE ================================= PROMPT requirin use input: "Abando edit? -confir ("Y/N" Qui request. "Chg? -decid ("Y/N/*" whethe t chang strin (ES quits). "Rdy -pres an ke t prin nex th file block o ke strin won' fi i RAM. "Key -a illega comman ke sequenc wa pressed. "I/O -fil no found dis full empty/invali drive etc. "Reformat -hyphe a en o line o wor to long. "Find -th searc strin wa no foun i paralle Osborn version VDE-OS. 1986 Th unifie VDE/ versio 2.00 wit it generi termina installation B versio 2.32 improvement ha included macros directory undelete lef margin wor functions globa replace tighte compress header ruler memor us message blan filenam allowed ^ inpu abort ^O cas insensitiv searches mor fre RAM wide variet o terminals faste scrolling keyboar buffer improvement t VINSTALL. ********************************** (u t 6 characters) Durin thi process yo ca correc mistake wit DEL BS o an lef arrow o ^ wil delet th whol entry hi C whe finished Yo ca als abor th entir curren operatio wit ^U Not tha t ge an o thes cod ------------------------------------------------- Rep Find/Replac ^ ^Z Partia Scrol U ^ ESC Bloc En ^K ESC-T Delet Bloc ^K ESC-D Mov Bloc ^K ---Mus Cop the Delete. Hid Bloc ^K ESCpag (ES quits). "Repea count: -ente (optiona "Q and repea coun fo Macro. "Ke number: -ente (optiona "N/Q and ke numbe fo Key. Al othe prompt -ente argument(s fo th comman (se STRIN INPUT). INFORMATIONA messages: "I/ Wd. "Syntax - macr programmin comman wa misused. ================================ HISTOR ================================== 1984 VD bega a m se o improvement o th tin (4k VD memory-mappe edito b Frit Schneide (1982) a ion man usefu printin options mor versatil installatio wit VINSTALL. 1987 Recen revisions beside smal fixes ad th following: 2. (1/87 -Improve scrollin an scree functions mor scree size supported WordSta fil mode plac ****************************** **** Th VD edito an it documentatio ar ***** **** (c)198 E Meyer al right reserved ***** **** Thi progra ma b freel distributed bu no sol ***** **** fo profi withou writte permissio o th ae int th strin itself yo mus preced i wit ^ (thi include ^P). Examples t fin lin beginnin wit "* (fin "CR,*" type ^QF,^P-CR,*,CR. No t ge thi int Macr wit ESC-M yo woul hav t typ (whew) ESC-M,^QF,^PP,^P-CR,*,^- Actuall unmark block. Eras Dis Fil ^K ESC-E Se Plac Mar ^K0.. ^P No individuall numbered. G T Plac Mar ^Q0.. ^Q Cyclic. VariTa Set,Clea ^OI,^O ^O+,^O- Not tha VD doe no recogniz WordSta "do commands i text. ====orking -dis I/ o printin i progress. ERRO messages pres ES t continue "Error alon mean th comman use jus won' wor i thi situation (Example bloc comman wa use wit n bloc marked. Mor specifi error are: "Memory -adapte b Georg Peac (1984 fo th Osborn Executive (Ther ar othe descendent o VDO includin Jame Whorton' VDO25 wit rathe differen features.) 1985 Th firs termina adaptation VDE-P fo th Epso PX-8 Ongoin improvement alsmarkers ^OZ bloc print large macr keys VINSTAL termina menu. 2. (3/87 -Use are support variabl tabs doubl spacing searc wildcards mor standar bloc functions improve format-ting man addition t VINSTALL. 2. (7/87 -Improveuthor ***** **************************************************************** Pleas d no circulat VD i an incomplet o modifie form o withou th abov copyrigh notice Yo ma includ addition o you ow (*.VF files HE overlays s   pecia documentation i yo wish. Thank t th man user o VD whos feedbac ha le t improvement an bu fixe i th past Answer t commo questions: (1 Sourc cod t VD 2.x i no availabl a thi time. (2 A MSDO versio o VD mae u fo ver basi Generi Terminal an VD i se u fo a Osborn Executive I yo us anothe computer/terminal yo wil probabl nee t re-"install VDE/ befor usin it VD ca no b installe fo AN terminal i improperl installe terminals a wel a man computers tha emulat a ADM terminal Chec you manua t se whethe you machin emulate on o th menu o come close Onc yo hav VD basicall working yo ma wan t g throug th detaile di procedurl se o Macr Keys. Th defaul printe installatio i basi Teletyp (n specia code enabled) VD assume onl tha th printe respond normall t Backspac (i ^P i used) Linefeed an Formfeed Yo wil probabl wan t red this s yallatio file whic yo ca us (an giv t others t supplemen th built-i termina lis o VINSTALL Thi i don b specifyin anothe filename: A>vinst2 vde2 termname{.vde} VINSTAL wil loa an us (o create th fil TERMNAME.VD (o . vdm2 okidata.vdp (No yo can' specif mor tha on supplementa fil a once. Th versio number o VDE/M VINSTALL an an othe file mus "agree o yo wil ge a error Th matc nee no b exact a ther ma b ne releas o VD w b availabl late i 1987. Direc proble report an suggestion t m a th addres below includ stampe retur envelop fo repl i desired. Eri Meyer 42 N Washington Bloomington I 4740 CompuServ [74415,1305] ===============d th displa ma b mess bu ther ar n othe sid effects VD require compute wit memory-mappe video i improperl installed i ma crash. Mos user shoul b abl t instal VD simpl b goin t th Termina Installatio an cho t fin tun things th bette th installation th faste th displa wil work. Installin VD fo you compute shoul no b difficult I yo fin tha i was pleas conside droppin m not wit th detail o wha wa required s thao wil hav acces t you printer' specia features. ============================ RUNNIN VINSTAL ============================= VINSTAL SYNTAX A>vinstal [d:]vdename[.com [instfil "[]"=optional Typically yo ca us VINST2 t modifVDM) an updat i a wel a VDE.CO whe yo exit Th installatio fil i ver small containin jus termina parameter (n use options etc). I i als possibl t creat "ke files o VD macr ke definitions Thes wor jus th sam withou modifyin th installatio areas. VINSTAL i largel self-documenting an step yo throug eac ite individually I thi i you firs tim runnin th program tak advantag o it "Help optio befor yo star in fo som basi in=============================================================== VINST26.DOC ----------- [Supplemen t VDE.DOC] Instuction fo VINSTAL 2.6 (07/87) Installatio Utilit fo Vide Displa Editor (c)198 E Meyer A distributed VD i sosin th is optio t selec fro men o terminal alread buil int VINSTALL Th lis i no exhaustive bu i include mos basi types fo example th "LearSiegle ADM3 dat shoul d wel enoug o Qume Wyse Freedo an man othe futur version o VINSTAL ca b improved. Termina installation whil necessary i onl on par o VINSTALL Ther ar als numbe o Use Option affectin th operatio o VD tha yo ca selec o modif t sui you taste an defau VDE26.CO (o course fee fre t renam thes file mor conveniently simpl b typing: A>vinst2 vde26 an selectin th value yo wan t change I yo hav t d manua installatio o VD fo you computer yo ma wan t creat a "instay excep the mus hav filetyp o ".VDK" an thi mus b specifie o th comman line eg: A>vinst2 vdm2 mykeys.vdk Ther ar als "printe files o typ ".VDP" whic stor you printe installatio data an wor th sam way: A>vinst2structions Not tha AL th numbe entr i VINSTAL i HEXADECIMAL yo wil fin goo ASCII/base-conversio char helpful VINSTAL can' chec fo illega values b carefu wha yo enter! Wha follow i mor detaile explanatio o insta   llatio items i abou th sam orde a i th VINSTAL procedure Mos peopl wil b usin VDE yo ca tr t us VD instea i yo hav memor mappe vide with (1 hig bi tha ca b use t highligh an provid cursor (2 a absolut(Y/N -D yo wan th Rule lin (^OT t star ou O whe firs enterin VDE? Lef an Righ margi column (00-FF -Defaul margi setting fo "W/A modes Se bot t t entirel disabl wordwra an reformatting. Pag lengt (00-FF -Se th RA disk) s VD won' rese the befor writin t them speedin u som systems Ente tw drive fro "A t "P" t leav eithe blank ente "@" (Th defaul i "@@" o none i yo hav RA driv C: ente "C@". Caution namin floppr characte -Normall "_" thi i th characte tha wil b use a wildcar i FIN strings Chang i yo wish. Cloc spee i MH (01-FF -Se thi t reflec you CP cloc speed mos Z8 computer ar 4. MH (us 4 here). Horizonta scros o u t variabl ta sto columns i ascendin order (Colum 0 i th leftmost.) TERMINA INSTALLATIO (Bot versions) Termina I -Identif th termina yo ar installing (1 characters) Viewabl scree column (28-FF -Ente th widt  generate b you termina arro key i thi order on byt each Ignor parity Us valu o F t mea "no used" (WordSta arrow an B nee no b redefine here. Th defaul i CP/ ^K,^J,^L entere a 0B0A0CFF (I yo hav ANS stand addres a o abov 3000h Th advantage o VD ove VD ar faste scree update an littl mor fre memory. USE OPTIONS Creat BAKu file (Y/N -Shoul backu fil b mad whe yo edi a existin file Choos "Y t pla safe "N  numbe o tex line t prin o page (Doe no includ anothe line fo header i used. Settin t disable paginatio entirely. Scrol overla (00-lines -Thi i th numbe o line overla betwee screen whe scrollin wit ^R/^C  driv her ca caus seriou BDO error o CP/ systems. Rin bel o erro (Y/N -D yo wan you termina bel t rin whe VD erro messag displays? Alternat vide i heade (Y/N -D yo wan th header messages et t appea i l dela (01-FF -Thi adjust th dela betwee scrollin th curren lin an scrollin th res o th screen whe workin beyon th righ scree edge Th averag valu i 80 adjus u o dow a yo like (VD i s fas tha valu o 0 io you scree i columns Th norma valu i 50 fo a 80-colum screen. Scree line (04-FF -Ente th numbe o line o you screen Normall 18 fo 24-lin screens. DELet characte (00-7F -VD alway accept 7 a delet key I you kar arro keys yo ca se al thes t FF.) Termina init unini -Ente th code yo wan sen t initializ you scree o entr int VDE an t uninitializ o exit i th for ( o bytes),bytes Example ^ i (01)1A Minimally bot set t sav dis space. Defaul fil mod W/A/ -Whic o th thre fil mode "W","A","N describe i VDE.DO d yo wan a th default? Defaul inser o (Y/N -D yo wan th INSER toggl t star ou O whe firs enterin VDE? Defaul rule o Th smaller th large th scroll. Sho syste file (Y/N -D yo wan file wit th SYSte attribut t sho i th VD director display? Fixe drive (A-P -Thi let yo specif tha u t tw CP/ logica drive ar nonremovabl medi (har ocontrastin vide mod (i installed)? Bloc mar characte (00-7F -Usuall ^ (02) bu i yo nee t imbe tha cod i you file fo an reaso (eg ZCPR3 yo ca chang thi t som othe (otherwis unused ASCI code suc a 0 (^@). Wildca recommended.) Har Ta displa spacin -Thi determine ho an actua Tab (^I i you tex wil display Usuall 08 thi ca b mad 02 04 10 o an othe powe o two Othe value wil produc errati results. Variabl ta stop -Ente lieyboar can' generat thi yo ca instal a alternat valu her (example 1 enable ^ o a Osborn 1) I yo hav DE key yo ca leav thi a th defaul value F fo "no used". Arrow up down right lef (00-7F -Ente th ASCI codeo code shoul clea th screen. TERMINA INSTALLATIO (Generi VD only) Autowra a lin en (Y/N -Usuall Yes a mos terminal wra dow t th nex lin whe characte i printe a th righ edg o th screen I your discard characte   r instead se thi t No. Clea t en o lin -Ente th code t clea t th en o th line a (#),bytes Example ESC- i (02)1B54 I you termina can' d thi the zer i ou (00). Alternat vide on/of -Ente th code (#),byte t tutermina can' displa code 7 o 7 (DE an tilde) lowe thi t 7 o 7D Character filtere ou wil displa a "?". Curso positionin mod (S/R/A/N -Thi tell VD ho you termina ca b mad t pu th curso a an give row/colum o s Mos terminal us ESC,=,20h+row,20h+col o 1B3D2020 I yo hav onl on lea byte ente 0 fo th second I YO CHOS "N" the yo mus ente tw 2-byt sequence instead firs on t hom th cursor the on t mov i right I eithe - o (02)1B5 delete line Fo som terminals yo hav t specif whic lin i t b inserted/deleted i thi case ente th sequence fo lin (th secon scree line) I you termina can' d thi a all zer thes ou (00). Ins/de sr th regula CP/ curso o an off s i won' appea o th VD screen I yo can' d thi zer the ou (00) an th curso wil remai visibl a th uppe corne o th screen. Vide RA star (3000-FFFF -Ente th startin addres o you referenc book o us DD o ASM/MA t writ an assembl th cod t he form. PRINTE INSTALLATION Printe I -Identif th printe yo ar installing (1 characters) Sen L afte C (Y/N -Normall Yes Bu wit som printers whic manufactr you favorit vide attribut (e inverse dim o an off Thi wil b use fo contro code an (optionally th heade an messages I you termina ha n attributes zer thes ou (00). Us hig bi fo alt vide (Y/N -If instead youth screen: "S"tandar leadi byte(s) ro byte colum byt (default) "R"everse leadi byte(s) colum byte ro byte "A"NS st ANS standar sequence "ESC[rr;ccH" "N"on n absolut curso addressin supported Curso positionin sequenc i onl on byte ente 0 fo th second Typica value ar home=1Eh right=0Ch whic woul mak 1E000C00. Dela afte curso positionin (00-FF -Normall 00 Som slo terminal requir dela her t accomplis curso movement adjus thi vapecifi t lin -Usuall No se t Ye onl i th ins/de sequence yo installe abov ar fo lin only rathe tha general. TERMINA INSTALLATIO (Memory-mappe VD only) Unuse column o RA (00-FF -Ente th numbe o unuse byte i vi vide memory a fou he digits. Vide in/ou cod -I you vide RA i i th ordinar ban o memor (eg a F000) jus ente "C9 her (that' RE instruction) Otherwise yo wil nee th machine-languag cod t switc vide memor i anur thei ow L o receivin CR yo wil wan N here. Printe initializatio -Ente strin o cod (#),byte t sen t th printe befor eac prin job t se margins prin mode etc. Printe unini -Ente anothe strin (#),byte t sen  termina need th hig bi se o character t pu the i alternat video zer th abov string ou an sa Ye here otherwise No. Consol filte (7D-FF -Thi i th highes ASCI cod tha wil b sen t th screen Normall 7F i you -Thi i th actua sequenc use t addres th cursor I YO CHOS "A above yo ca ski thi entirely I YO CHOS "S o "R" the ente th 4-byt sequenc fo addressin th curso t th to left tw lea bytes the tw row/colum offsetlu upward a necessary. Insert Delet lin -Sequence tha wil caus th curren curso lin t b deleted o ne lin inserte there Mos terminal ca d this Example o a ADM3-styl terminal ESC- o (02)1B4 insert line whil ESCde RA betwee th en o on visibl lin an th star o th next Example man computer hav 80 (128 byte o RA pe line bu onl sho 50 (80 o them S ther woul b 30 unuse columns. Curso on/of -Ente th code (#),byte t tu out Ther ar 1 byte availabl fo eac routine an yo mus preserv al th CP registers an en wit RET Yo shoul fin th assemble cod t d thi i you termina manual t conver i t hex eithe loo u th he value i Z8t th printe afte eac prin job t restor printe t desire stat o exit. Toggle an switche -Thes ar th ^P-code tha wil b use t cal u predefine sequences Ther ar fou toggles the fou switches Th default (^D,^S,^Y,^T    ^Q,^W,^E,^R ar chose fo WordSta compat-ibility bu ca b change i yo want (Avoi ^B,^H,^I,^J,^L,^M,^Z whic ar use fo othe purposes.) Code fo toggle (on/off -Ente th actua code (#),byte t sen t fh printe o encounterin 500) <0><> <1>< <----"<> fla mean empty <2><> <3>^C^ <----norma macr key <4><> <5>Worl Wid Widget Inc <----" fla mean no-rp key <6><> <7>^QR^[B^QC^[T^[ <----" fla mean quie key <8><> <9><> Thi i prett straigh1 bytes yo ca jum t th Use Patc are an pu mor cod there. Thi i th ONL suc are available a VD use al availabl memor afte it ow cod fo editin text Note i yo fin th Use Patc are to small yo ca als us u ti i th basi table th ^O comman appear i th ^ table a ^X. Fin th proble keycode an us DD o anothe utilit t chang it (Yo wil als se th "keycodes 80-84 i th tables thes mea DE an th arro keys howeve instal Installatio se t Generi (o Osborn Exec) printe se t basi Teletype n Macr Keys n Use Patc code. ========================= GOIN BEYON VINSTAL =========================== I you compute require specia additiona code an whe VD i calle up Th Starle ha differen termina emulation an ke definitions mos o thi cod jus ensure tha it' i Soro mod (whic i wha VINSTAL i se u for) an set th curso an DE ke definition properly. Ther i  eac o th fou toggl code define above firs t tur featur on the off. Code fo switche -Ente th actua code (#),byte t sen t th printe o encounterin eac o th fou switche define above. MACR KEYS VINSTAL give yo tforward yo jus selec th numbe o th Ke yo wis t redefine the typ i th ne definition muc a yo woul i VDE Al th sam rule appl (bu VINSTAL wil accep longe keys u t 12 bytes) I th ne definitio i to lon t fi 3 extr byte befor it Thi i th Prin Switc cod area yo mus the avoi usin th fou Switc codes. VINSTAL als tell yo th addresse o th comman table i VDE/M Yo ma fin thi usefu i yo nee t g i an chang VD comled.) Don' tr t chang th ESC-prefi t ^K-t mak VD mor "WordStar-like" I wil tak yo whil t locat al th occurrences an leav yo wit som prett confusin pair o command (e ^K eXit ^K^ shif scree down). RESTOR D yo kno ho t us a assembler yo ma wan t mak a overla t ad thi cod t VDE (Yo ma als fin thi th easies wa t instal othe data suc a th VidIN/OU routine fo th VD Termina Installation. Writ th overla file genanothe problem th VD cas toggl comman (^^ ha t b changed a i wil conflic wit on o th Soro arro keys (O som othe computers yo can' generat ^ fro th keyboar a all. Not ho th overla find th addres o th mai cth abilit t examin an chang th defaul se o macr Key i VDE (An Key define wit ESC- whil runnin VD overrid th defaults. VINSTAL give yo displa muc lik this: MACR KEYS (01C byte free <----not fre byte (u t 01F  i wil b rejected. FURTHE USE PATCHING Th addres o th Use Patc are wil b give t yo b VINSTALL Thi smal regio i VD ca b use t instal an extr patc cod yo need (Example i you vide in/ou routine won' fi int man ke tha conflict wit you computer' firmware Ther ar fou comman tables basic ESC ^Q an ^O Eac i lis o 3-byt entries wit on byt keycode the tw byt address (Examples yo wil fin th ^ comman an th ES prefEFAULTS Thi optio i provide i th even tha someon ha s mucke u you cop o VD tha yo can' sor ou what' wrong Thi shoul retur VD t nearl th stat i wa distribute in al Use Option restore t thei defaults Terminaerat HE fil wit you assembler the merg i wit VDE.CO usin MLOA o simila utility (B sur th cod fits!) Example th followin overla add specia cod fo th NE Starle t th Use Patc area wher i i immediatel executeomman men (al th men addresse ar store a 0108- 010F i VDE.COM alternatively yo ca ge VINSTAL t tel yo wha the are) add th appropriat offse (determin thi yourself) an the change th comman ke t somethin else. ;NEC8   40 Patc fo VD 2. (808 mnemonics) or 0100 ;A beginnin o VDE.COM, jm 0248 jum t Use Patc area or 0248 ;A Use Patc area, mv c,08 se scree mode: mv e,81 Soroc wra on fnkey off etc rs cal specia BIOS mv c,4Emnemonic i debuggin utilit lik DD o SID. Eri Meyer 42 N Washington Bloomingto I 4740 ---CI [74415,1305] ============================================================================== n ca b use (repeatedl i necessary t recove reasonabl amoun o tex delete eithe b overtyping o wit an o VDE' delet commands I th curso ha no ye bee move away Ctl- undelete on character Ctl-Q doe whol line. Rmall i th to hal o th screen Thi i usefu fo comparin differen section o tex withi file o eve betwee differen files Typin Ctl-O agai remove th Window (Note Windowin i onl supporte fo screen o 1 o mor lines.)  para-graph accordin t th curren margi setting an lin spacing (Thu Ctl- i use no onl t reshap paragrap afte editing bu als t chang it margin an lin spacing.) Th en o paragrap i marke b "HAR CR" whic occur ca b cause t displa a "< character Thi ca b useful som ma fin i distracting s i turn off. ================================= MACRO ================================== MACR (ESC-M - "macro i strin o VD command  se curso keys: mv e, t mappe codes rs cal specia BIOS mv c,4D se definabl key: lx d,dat usin dat below rs cal specia BIOS lhl 0108 ge addres o mai comman menu lx d,6* offse o ^ (thi ma change) estrictions undelet onl work wit ESC- i th curso wa adjacen t th bloc deleted an i ma wor imperfectl i DE ha bee use severa time i sequence. Furthe us afte al delete tex i recovere wil produc jun (usuall dupli Th Ctl-O comman temporaril zap (blanks th entir screen goo fo avoidin CR burn-in o jus protectin wor fro pryin eye o fingers Restor th scree b pressin ESC (Note i Windowin wa i effect an tex i th windo wil b whe yo pres th RETUR key (Thi i C immediatel followin characte o text. I contrast whe wordwra occur yo ge "SOF CR (whic i actuall C wit spac befor it) Yo ca chang har C int sof one o vic versaan tex that onc defined ca b repeate automatically Whe yo typ ESC- yo wil b aske fo th string the "Repea count" Usuall yo wil simpl typ numbe fo th repea coun (0-9 o "* fo "global --actuall 25 times) Yo w da poin t offendin ^ code mv m,0C chang i t ^ instead jm 0480 ;Jum t VD Star point data d 4,7Fh,0, ;Dat t se "DEL ke a DE (7F) end Yo ca als ad cod lik thi t VDE.CO usin th "a comman t ente assemble cate o tex abov th cursor whic i sometime useful). WINDOW ZA (Ctl-OW Ctl-OZ -Th Ctl-O comman create Windo i th botto hal o th screen whic retain cop o th fil tex startin a th curren line Editin continue nor lost.) WORDWRAP REFORMA (Ctl-B Ctl-OD -WORDWRA i automati wheneve th righ margi i set An tex entere wil b formatte whil yo type t th curren margi settings. Ctl- REFORMAT fro th lin th curso i on t th en o th b deletin o addin spac a th en o th line Hittin RETUR als harden sof CR Th distinctio betwee har an sof CR i onl importan whe usin Ctl- t reformat. Ctl-O toggle DISPLA O HAR CRs Har CRs otherwis invisibleil se th result a th macr executes an yo ca abor i a an tim b pressin ESC. (I yo ar sur yo kno wha you'r doing yo ca spee u Macr executio b specifyin "Quiet mode pres "Q befor th repea count Onl th heade    wil b update a th Macr runs.) Macro als sto an tim a erro occurs th erro messag wil b visible an ca b cleare b pressin ESC Man command (lik Fin o Reformat ar designe t generat error a th en o th fil s thy-stroke ar separate b dashe o comma fo clarity an "_ mean spac o blank.) Her i a exampl o macro Ca yo figur ou wha i does (Answer .eli eh f dn eh t meh f tsi gnika eli f tu sesehtnera n stnemmo ll 0 an i ca b recalle an reuse a an futur tim simpl b typin ESC-0. Ordinarily Key operat jus lik th origina Macro the wil as fo "Repea count whe executed I yo wan t suppres thi (givin somethin mor lik "funct 12 byt limi fo an on Key (VDE' ow inpu lin wil onl accep 6 bytes bu VINSTAL ca handl u t th ful 128.) Beside simpl storin Macros her ar som usefu functio Keys: 1 Storin differen set o margin (e fo quotes)  o macro allowin rea programming. ESC-0..9 whe i Macro functio a "labels 0..9 The hav n effect bu ca b "jumped t b othe commands. ESC- followe b 0.. i simpl "jump instruction causin macr executio t resum witrso righ (o fo "<" left a lon a th characte a th curso doe (o fo "[squiggle]" doesn't match o unti th beginnin o en o th file. ESC-# followe b 0..9 i use t "chain t anothe macr key I thi wa yo ca buil ua globa ("*" Macr containin the wil hal there Othe globa Macro ma nee t b aborte manually. VD turn INSER OF befor runnin macro s tha th sam sequenc wil alway hav th sam effect. I orde t includ an inpu lin eka lli tI) Ctl-QR,Ctl-QF,(,CR,Ctl-G,ESC-B,Ctl-QF,),CR,Ctl-G,ESC-T,Ctl-QC,CR,ESC-C,ESC-D Onscree yo wil see QRQF(MG[BQF)MG[TQCM[C[D VD Macro ar ver powerfu tools particularl give thei progra abilit an storag o functio keys. Mio key" tha onl execute once yo ca typ "N (fo N repeat befor storin th ke number Example ESC-K-N- store Macr i Ke a once- onl functio key Similarl yo ca mak i QUIE once-onl ke wit "Q instead e ESC-K-Q-0.fo example Ctl- OL,12,CR,Ctl-OR,66,CR 2 Typin an frequentl repeate phrase "ESC-6 i muc mor convenien tha "Worl Wid Widget Inc (N.A.)". [VINSTAL allow yo t instal defaul se o macr Keys Thu VD ca b customize fo an  th comman followin th labe ESC-0..9 A tw epecia cases ESC-! jump t th beginnin o th Macro an ESC-! jump t th en (aborts). ESC- an ESC-[squiggle] followe b characte an the labe 0.. (o "[","]") ar conditiona  string longe tha th 65/128-byt limi o an on key I doe no "call th key ther i n returning. Macr program ar store jus lik an othe macr strin (usuall wit "N" repea count) I yo progra i a endles loop yo wil a s editin character (BS C etc i macro yo mus prefi the wit Ctl-P (NOTE T mak the easie t rea an understand Macr listing wil b give her a the function no a the ar type in Ctl- prefixe a neede ar NO shown KeACR KE (ESC-K -U t 1 Macro ca b store (0..9) b enterin the wit th ESC- command the usin ESC- t sav them The ca the b recalle an use simpl b typin ESC-<#> Example typin ESC-K- wil stor th las Macr use a Ke I th Macr (ESC-M strin i empty usin ESC- wil delet Ke definition Usin define Ke bring it strin int th Macr buffer Tryin t us a undefine Ke result i a error. Ther ar 50 byte tota availabl fo al 1 keys antask suc a th formattin requirement o specialize writin o programmin languages.] MACR PROGRAMMIN (ESC-0..9 ESC-!,=,[squiggle],# -VD ha severa command whic functio onl i Macr string an giv yo contro ove th executio jumps the jum t tha labe I th characte a th curso positio doe (o fo "[squiggle]" doesn't matc tha specified. ESC- an ESC-[squiggle] followe b characte an the "> o "<" ar searc loops The wil continu t mov th cuom poin hav t abor wit ESC Don' mak macr program "Q"uie unti you'r sur the work. Example yo ca fin th star o th nex sentenc wit th macro: ESC[squiggle].>,Ctl-D,ESC=_> ========================== GENERA INFORMATIO ====   ======================== DIS SPAC -VD isn' disk-bound i yo ru ou o dis space jus inser anothe dis (alway kee blan FORMATTE dis around) Alternatively yo ca us th ESC- an ESC- command t purg unneede files [I yo hy excep tha an righ justificatio wil b lost VD "W fil ca b rea int WordSta a Documen fil nearl perfectly yo ca easil touc u th occasiona glitch. Th "N an "A mode bot produc ASCI files an diffe onl i th od wit th ESC- functio b enterin ne mod (eg "[W" wit o withou filename. NOT O ASCI FILE -Th "A"SCII-documen fil forma use sinc VD 2.50 t allo accurat formattin an WordSta compatibility distin-guishe betwee HARCtl-V,Ctl-D,ESC![ HYPHENATIO -VD can' hyphenate bu i doe recogniz hyphen i th text treatin the a legitimat plac t brea line (S i you'r typin lon wor clos t th margin yo ca typ hyphe wher you' lik th wors etc) i ma los contro o th screen Th bes wa t restor i t norma i b blankin an restorin th scree (Ctl- OZ,ESC). KEYBOAR BUFFE -VD 2. ha faste scrolling also i no buffer it ow keyboar input Thi mean tha chara t ge an o thes code int th strin itself yo mus preced i wit Ctl- (thi include Ctl-P). Examples t fin lin beginnin wit "* (fin "CR,*" type Ctl-QF,Ctl-P-CR,*,CR. No t ge thi int Macr wit ESC-M yo woul hav tav smal disks yo ca als instal VD no t preserv BA files.] Le VDE' filesiz limit encourag yo t brea wor u int file o 50 o less large file mak inefficien us o flopp disks. FIL MODE -I "A o "N mode VD read adefaul option (margin etc se u whe ne fil i loaded Typicall "A i fo wor processin an "N i fo programs etc. DEFAULT FOR Fil I/ Margin Tab Har C disp. "W"ordsta documen WORDSTA ACTIV VARIABL ON "A"SCI documen ASC an SOF CR (se WORDWRAP) Consequently i yo edi a ASCI fil create b othe softwar (includin earlie version o VDE) i ma appea t b ful o har CRs makin tex impossibl t reformat Ther ar tw eas way t solv thi probl t b broken. I VD i tryin t reforma an find hyphe a th en o line i wil qui wit a error Yo mus joi th line (an delet th hyphen i desired manually the pres Ctl- again. INSTALLATIO -VD ca b "installed foacter type wil n longe b los eve o terminal wit ver slo displays I yo lea o on ke fo som tim yo ma manag t fil th buffer an key ma b lost. STRIN INPU -Whe confronte wit promp lik "Find:" yo ar expecte t typ (whew) ESC-M,Ctl-QF,Ctl-PP,Ctl-P-CR,*,Ctl-P-CR,CR. WORDSTA COMPATIBILIT -Th fe difference betwee th VD an WordSta comman set ar ofte du t th fac tha VD reserve Ctl-J,Ctl-K,Ctl- a th standar CP/ arro keys Excep thn write tex a standar ASCI 7-bi characters forma accepte b virtuall al softwar (includin WordStar' Non-Documen mode) I "W mode VD read an write WordSta Documen files WordSta Documen fil ca b rea int VD perfectlI ACTIV VARIABL ON "N"on-documen ASCI DISABLE HAR OFF Th fil mod optio ca b specifie alon wit th filenam a an VD fil functio prompt allowin yo t mi WordSta an ASCI dis file a needed Yo ca als chang th curren mem first yo ca us Ctl-Q t fin "Ctl-M" an selectivel replac the wit Ctl-M" Alterna-tively th followin Macr (bes store a Quie macr Key doe goo jo o "softenin up paragraph: Ctl-QS,Ctl-X,ESC=_],ESC=CR],Ctl-S,Ctl-V_ differen terminals printers et (a wel a variou use preferences usin th VINSTAL program Se VINSTALL.DO fo furthe details. INTERRUPTIO -I VD get interrupte b messag fro som othe softwar (BIO error residen utilitie typ i strin (u t 6 characters) Durin thi process yo ca correc mistake wit DEL BS o an lef arrow o Ctl- wil delet th whol entry hi C whe finished Yo ca als abor th entir curren operatio wit Ctl- U Not th Ctl-K-prefix mos ar minor: COMMO FUNCTIO W VD NOTES ------------------------------------------------- Rep Find/Replac Ctl- Ctl-Z Partia Scrol U Ctl- ESC Bloc En Ctl-K ESC-T Delet     Bloc Ctl-K ESC-D Mov Bloc Ctl-K ---Mus Cop the Delete. Hid Bloc Ctl-K ESC- Actuall unmark block. Eras Dis Fil Ctl-K ESC-E Se Plac Mar Ctl-K0.. Ctl-P No individuall numbered. G T Plac Mar Ctl-Q0.. Ctl-Q Cyclic. VariTa SKey. Al othe prompt -ente argument(s fo th comman (se STRIN INPUT). INFORMATIONA messages: "I/ Working -dis I/ o printin i progress. ERRO messages pres ES t continue "Error alon mean th comman use jus won' wor i 4 VD bega a m se o improvement o th tin (4k VD memory-mappe edito b Frit Schneide (1982) a adapte b Georg Peac (1984 fo th Osborn Executive (Ther ar othe descendent o VDO includin Jame Whorton' VDO25 wit rathe: 2. (1/87 -Improve scrollin an scree functions mor scree size supported WordSta fil mode plac markers Ctl-OZ bloc print large macr keys VINSTAL termina menu. 2. (3/87 -Use are support variabl tabs doubl spacing searc**** **** Thi progra ma b freel distributed bu no sol ***** **** fo profi withou writte permissio o th author ***** **************************************************************** Pleas d no circulat VD i an incomplet o m fo repl i desired. Eri Meyer 42 N Washington Bloomington I 4740 CompuServ [74415,1305] ============================================================================== VINST26.DOC ----------- [Supplemen t VDE.DOC] Instuctionet,Clea Ctl-OI,Ctl-O Ctl-O+,Ctl-O- Not tha VD doe no recogniz WordSta "do commands i text. ================================ MESSAGE ================================= PROMPT requirin use input: "Abando edit? -confir ("Y/N" Qthi situation (Example bloc comman wa use wit n bloc marked. Mor specifi error are: "Memory -th file block o ke strin won' fi i RAM. "Key -a illega comman ke sequenc wa pressed. "I/O -fil no found dis full empty/ differen features.) 1985 Th firs termina adaptation VDE-P fo th Epso PX-8 Ongoin improvement als i paralle Osborn version VDE-OS. 1986 Th unifie VDE/ versio 2.00 wit it generi termina installation B versio 2.32 improv wildcards mor standar bloc functions improve format-ting man addition t VINSTALL. 2. (7/87 -Improve header ruler memor us message blan filenam allowed Ctl- inpu abort Ctl-O cas insensitiv searches mor fre RAM wide odifie form o withou th abov copyrigh notice Yo ma includ addition o you ow (*.VF files HE overlays specia documentation i yo wish. Thank t th man user o VD whos feedbac ha le t improvement an bu fixe i th pa fo VINSTAL 2.6 (07/87) Installatio Utilit fo Vide Displa Editor (c)198 E Meyer A distributed VD i se u fo ver basi Generi Terminal an VD i se u fo a Osborn Executive I yo us anothe computer/terminal yo wilui request. "Chg? -decid ("Y/N/*" whethe t chang strin (ES quits). "Rdy -pres an ke t prin nex pag (ES quits). "Repea count: -ente (optiona "Q and repea coun fo Macro. "Ke number: -ente (optiona "N/Q and ke numbe fo invali drive etc. "Reformat -hyphe a en o line o wor to long. "Find -th searc strin wa no found. "Syntax - macr programmin comman wa misused. ================================ HISTOR ================================== 198ement ha included macros directory undelete lef margin wor functions globa replace tighte compression man usefu printin options mor versatil installatio wit VINSTALL. 1987 Recen revisions beside smal fixes ad th following variet o terminals faste scrolling keyboar buffer improvement t VINSTALL. **************************************************************** **** Th VD edito an it documentatio ar ***** **** (c)198 E Meyer al right reserved *st Answer t commo questions: (1 Sourc cod t VD 2.x i no availabl a thi time. (2 A MSDO versio o VD ma b availabl late i 1987. Direc proble report an suggestion t m a th addres below includ stampe retur envelop probabl nee t re-"install VDE/ befor usin it VD ca no b installe fo AN terminal i improperl installed th displa ma b mess bu ther ar n othe sid effects VD require compute wit memory-mappe video i improper    l installed i ma crash. Mos user shoul b abl t instal VD simpl b goin t th Termina Installatio an choosin th is optio t selec fro men o terminal alread buil int VINSTALL Th lis i no exhaustive bu i include b difficult I yo fin tha i was pleas conside droppin m not wit th detail o wha wa required s tha futur version o VINSTAL ca b improved. Termina installation whil necessary i onl on par o VINSTALL Ther ar ========== VINSTAL SYNTAX A>vinstal [d:]vdename[.com [instfil "[]"=optional Typically yo ca us VINST2 t modif VDE26.CO (o course fee fre t renam thes file mor conveniently simpl b typing: A>vinst2 vde26 an selectin th (n use options etc). I i als possibl t creat "ke files o VD macr ke definitions Thes wor jus th sam way excep the mus hav filetyp o ".VDK" an thi mus b specifie o th comman line eg: A>vinst2 vdm2 mykeys.vdky I thi i you firs tim runnin th program tak advantag o it "Help optio befor yo star in fo som basi instructions Not tha AL th numbe entr i VINSTAL i HEXADECIMAL yo wil fin goo ASCII/base-conversio char helpfkeys: mv e, t mappe codes rs cal specia BIOS mv c,4D se definabl key: lx d,dat usin dat below rs , mv c,08 se scree mode: mv e,81 Soroc wra on fnkey off etc rs cal specia BIOS mv c,4E se curso  mos basi types fo example th "LearSiegle ADM3 dat shoul d wel enoug o Qume Wyse Freedo an man othe terminals a wel a man computers tha emulat a ADM terminal Chec you manua t se whethe you machin emulate onals numbe o Use Option affectin th operatio o VD tha yo ca selec o modif t sui you taste an defaul se o Macr Keys. Th defaul printe installatio i basi Teletyp (n specia code enabled) VD assume onl tha th  value yo wan t change I yo hav t d manua installatio o VD fo you computer yo ma wan t creat a "installatio file whic yo ca us (an giv t others t supplemen th built-i termina lis o VINSTALL Thi i don b s Ther ar als "printe files o typ ".VDP" whic stor you printe installatio data an wor th sam way: A>vinst2 vdm2 okidata.vdp (No yo can' specif mor tha on supplementa fil a once. Th versio number o VDE/M VINSTALL aul VINSTAL can' chec fo illega values b carefu wha yo enter! Wha follow i mor detaile explanatio o installatio items i abou th sam orde a i th VINSTAL procedure Mos peopl wil b usin VDE yo ca tr t us VD inD 2. (808 mnemonics) or 0100 ;A beginnin o VDE.COM, jm 0248 jum t Use Patc area or 0248 ;A Use Patc aread th appropriat offse (determin thi yourself) an the change th comman ke t somethin else. ;NEC840 Patc fo V o th menu o come close Onc yo hav VD basicall working yo ma wan t g throug th detaile di procedur t fin tun things th bette th installation th faste th displa wil work. Installin VD fo you compute shoul noprinte respond normall t Backspac (i Ctl-P i used) Linefeed an Formfeed Yo wil probabl wan t red this s yo wil hav acces t you printer' specia features. ============================ RUNNIN VINSTAL ===================pecifyin anothe filename: A>vinst2 vde2 termname{.vde} VINSTAL wil loa an us (o create th fil TERMNAME.VD (o .VDM) an updat i a wel a VDE.CO whe yo exit Th installatio fil i ver small containin jus termina parametern an othe file mus "agree o yo wil ge a error Th matc nee no b exact a ther ma b ne releas o VD withou modifyin th installatio areas. VINSTAL i largel self-documenting an step yo throug eac ite individuallpoin t offendin Ctl-Ctl- code mv m,0C chang i t Ctl- instead jm 0480 ;Jum t VD Star point data d 4,7Fh,0, cal specia BIOS lhl 0108 ge addres o mai comman menu lx d,6* offse o Ctl-Ctl- (thi ma change) da  th men addresse ar store a 0108- 010F i VDE.COM alternatively yo ca ge VINSTAL t tel yo wha the are) ad yo can' generat Ctl-Ctl- fro th keyboar a all. Not ho th overla find th addres o th mai comman men (al!   s toggl comman (Ctl-Ctl- ha t b changed a i wil conflic wit on o th Soro arro keys (O som othe computers i wha VINSTAL i se u for) an set th curso an DE ke definition properly. Ther i anothe problem th VD caassembler yo ma wan t mak a overla t ad thi cod t VDE (Yo ma als fin thi th easies wa t instal othe d BEYON VINSTAL =========================== I you compute require specia additiona code an yo kno ho t us a i t Ctl-K-t mak VD mor "WordStar-like" I wil tak yo whil t locat al th occurrences an leav yo wit som th "keycodes 80-84 i th tables thes mea DE an th arro keys howeve installed.) Don' tr t chang th ESC-prefd area yo mus the avoi usin th fou Switc codes. VINSTAL als tell yo th addresse o th comman table i VDE/ote i yo fin th Use Patc are to small yo ca als us u t 3 extr byte befor it Thi i th Prin Switc co t redefine the typ i th ne definition muc a yo woul i VDE Al th sam rule appl (bu VINSTAL wil accep l <----" fla mean quie key <8><> <9><> Thi i prett straightforward yo jus selec th numbe o th Ke yo wis e off. Code fo switche -Ente th actua code (#),byte t sen t th printe o encounterin eac o th fou switche(#),byte t sen t fh printe o encounterin eac o th fou toggl code define above firs t tur featur on th Starle ha differen termina emulation an ke definitions mos o thi cod jus ensure tha it' i Soro mod (whicrla add specia cod fo th NE Starle t th Use Patc area wher i i immediatel execute whe VD i calle up Th (o Osborn Exec) printe se t basi Teletype n Macr Keys n Use Patc code. ========================= GOIN t nearl th stat i wa distribute in al Use Option restore t thei defaults Termina Installatio se t Generiar i th Ctl- table a Ctl-X. Fin th proble keycode an us DD o anothe utilit t chang it (Yo wil als se tw byt address (Examples yo wil fin th Ctl- comman an th ES prefi i th basi table th Ctl-O comman appeor cod there. Thi i th ONL suc are available a VD use al availabl memor afte it ow cod fo editin text Nod yo need (Example i you vide in/ou routine won' fi int 1 bytes yo ca jum t th Use Patc are an pu mma macr key <4><> <5>Worl Wid Widget Inc <----" fla mean no-rp key <6><> <7>Ctl-QRCtl-[BCtl-QCCtl-[TCtl-[01C byte free <----not fre byte (u t 01F 500) <0><> <1>< <----"<> fla mean empty <2><> <3>Ctl-CCtl- <----nor,Ctl-H,Ctl-I,Ctl-J,Ctl-L,Ctl-M,Ctl-Z whic ar use fo othe purposes.) Code fo toggle (on/off -Ente th actua code l-S,Ctl-Y,Ctl-T Ctl-Q,Ctl-W,Ctl-E,Ctl-R ar chose fo WordSta compat-ibility bu ca b change i yo want (Avoi Ctl-B assembler the merg i wit VDE.CO usin MLOA o simila utility (B sur th cod fits!) Example th followin oveata suc a th VidIN/OU routine fo th VD Termina Installation. Writ th overla file generat HE fil wit youvide i th even tha someon ha s mucke u you cop o VD tha yo can' sor ou what' wrong Thi shoul retur VDō prett confusin pair o command (e Ctl-K eXit Ctl-KCtl- shif scree down). RESTOR DEFAULTS Thi optio i proTher ar fou comman tables basic ESC Ctl-Q an Ctl-O Eac i lis o 3-byt entries wit on byt keycode the M Yo ma fin thi usefu i yo nee t g i an chang VD comman ke tha conflict wit you computer' firmware es o th Use Patc are wil b give t yo b VINSTALL Thi smal regio i VD ca b use t instal an extr patc conge keys u t 12 bytes) I th ne definitio i to lon t fi i wil b rejected. FURTHE USE PATCHING Th addr Key define wit ESC- whil runnin VD overrid th defaults. VINSTAL give yo displa muc lik this: MACR KEYS ( define above. MACR KEYS VINSTAL give yo th abilit t examin an chang th defaul se o macr Key i VDE (An-code tha wil b use t cal u predefine sequences Ther ar fou toggles the fou switches Th default (Ctl-D,Ct t th printe afte eac prin job t restor printe t desire stat o exit. Toggle an switche -Thes ar th Ctl-P!    t th printe befor eac prin job t se margins prin mode etc. Printe unini -Ente anothe strin (#),byte t senctur thei ow L o receivin CR yo wil wan N here. Printe initializatio -Ente strin o cod (#),byte t senjus ente "C9 her (that' RE instruction) Otherwise yo wil nee th machine-languag cod t switc vide memor i u vide memory a fou he digits. Vide in/ou cod -I you vide RA i i th ordinar ban o memor (eg a F000)  general. TERMINA INSTALLATIO (Memory-mappe VD only) Unuse column o RA (00-FF -Ente th numbe o unuse byte i specifi t lin -Usuall No se t Ye onl i th ins/de sequence yo installe abov ar fo lin only rathe tha curso positionin (00-FF -Normall 00 Som slo terminal requir dela her t accomplis curso movement adjus thi i onl on byte ente 0 fo th second Typica value ar home=1Eh right=0Ch whic woul mak 1E000C00. Dela afte "A"NS st ANS standar sequence "ESC[rr;ccH" "N"on n absolut curso addressin supported Curso positionin sequenc th screen: "S"tandar leadi byte(s) ro byte colum byt (default) "R"everse leadi byte(s) colum byte ro byte ade an messages I you termina ha n attributes zer thes ou (00). Us hig bi fo alt vide (Y/N -If instead ytur you favorit vide attribut (e inverse dim o an off Thi wil b use fo contro code an (optionally th hetif th printe yo ar installing (1 characters) Sen L afte C (Y/N -Normall Yes Bu wit som printers whic manufa8 referenc book o us DD o ASM/MA t writ an assembl th cod t he form. PRINTE INSTALLATION Printe I -Identh curso wil remai visibl a th uppe corne o th screen. Vide RA star (3000-FFFF -Ente th startin addres o yotur th regula CP/ curso o an off s i won' appea o th VD screen I yo can' d thi zer the ou (00) an  ente th sequence fo lin (th secon scree line) I you termina can' d thi a all zer thes ou (00). Ins/deSC- o (02)1B5 delete line Fo som terminals yo hav t specif whic lin i t b inserted/deleted i thi caseCHOS "N" the yo mus ente tw 2-byt sequence instead firs on t hom th cursor the on t mov i right I eitheets Mos terminal us ESC,=,20h+row,20h+col o 1B3D2020 I yo hav onl on lea byte ente 0 fo th second I YO . Curso positionin mod (S/R/A/N -Thi tell VD ho you termina ca b mad t pu th curso a an give row/colum o termina can' displa code 7 o 7 (DE an tilde) lowe thi t 7 o 7D Character filtere ou wil displa a "?"SC- i (02)1B54 I you termina can' d thi the zer i ou (00). Alternat vide on/of -Ente th code (#),byte t ter instead se thi t No. Clea t en o lin -Ente th code t clea t th en o th line a (#),bytes Example E shoul fin th assemble cod t d thi i you termina manual t conver i t hex eithe loo u th he value i Zan out Ther ar 1 byte availabl fo eac routine an yo mus preserv al th CP registers an en wit RET Yo pe line bu onl sho 50 (80 o them S ther woul b 30 unuse columns. Curso on/of -Ente th code (#),byte t vide RA betwee th en o on visibl lin an th star o th next Example man computer hav 80 (128 byte o RAlin inserte there Mos terminal ca d this Example o a ADM3-styl terminal ESC- o (02)1B4 insert line whil Evalu upward a necessary. Insert Delet lin -Sequence tha wil caus th curren curso lin t b deleted o ne  o "R" the ente th 4-byt sequenc fo addressin th curso t th to left tw lea bytes the tw row/colum offs -Thi i th actua sequenc use t addres th cursor I YO CHOS "A above yo ca ski thi entirely I YO CHOS "Se otherwise No. Consol filte (7D-FF -Thi i th highes ASCI cod tha wil b sen t th screen Normall 7F i youou termina need th hig bi se o character t pu the i alternat video zer th abov string ou an sa Ye her terminal wra dow t th nex lin whe characte i printe a th righ edg o th screen I your discard charac o code shoul clea th screen. TERMINA INSTALLATIO (Generi VD only) Autowra a lin en (Y/N -Usuall Yes a mos"    o entr int VDE an t uninitializ o exit i th for ( o bytes),bytes Example Ctl- i (01)1A Minimally bot setr arro keys yo ca se al thes t FF.) Termina init unini -Ente th code yo wan sen t initializ you scree  Normall 18 fo 24-lin screens. DELet characte (00-7F -VD alway accept 7 a delet key I you keyboar can' i columns Th norma valu i 50 fo a 80-colum screen. Scree line (04-FF -Ente th numbe o line o you screen scree edge Th averag valu i 80 adjus u o dow a yo like (VD i s fas tha valu o 0 i recommended.) -Thi adjust th dela betwee scrollin th curren lin an scrollin th res o th screen whe workin beyon th righessag displays? Alternat vide i heade (Y/N -D yo wan th header messages et t appea i contrastin vide mod seriou BDO error o CP/ systems. Rin bel o erro (Y/N -D yo wan you termina bel t rin whe VD erro mverla (00-lines -Thi i th numbe o line overla betwee screen whe scrollin wit Ctl-R/Ctl-C Th smaller th largen o page (Doe no includ anothe line fo header i used. Settin t disable paginatio entirely. Scrol o/N -Shoul backu fil b mad whe yo edi a existin file Choos "Y t pla safe "N t sav dis space. Defaul fiTh advantage o VD ove VD ar faste scree update an littl mor fre memory. USE OPTIONS Creat BAKu file (Yrrow an B nee no b redefine here. Th defaul i CP/ Ctl-K,Ctl-J,Ctl-L entere a 0B0A0CFF (I yo hav ANS standa b you termina arro key i thi order on byt each Ignor parity Us valu o F t mea "no used" (WordSta a I -Identif th termina yo ar installing (1 characters) Viewabl scree column (28-FF -Ente th widt o you scree variabl ta sto columns i ascendin order (Colum 0 i th leftmost.) TERMINA INSTALLATIO (Bot versions) Termina-FF -Se thi t reflec you CP cloc speed mos Z8 computer ar 4. MH (us 4 here). Horizonta scrol dela (01-FFrmall "_" thi i th characte tha wil b use a wildcar i FIN strings Chang i yo wish. Cloc spee i MH (01te "@" (Th defaul i "@@" o none i yo hav RA driv C: ente "C@". Caution namin flopp driv her ca causn' rese the befor writin t them speedin u som systems Ente tw drive fro "A t "P" t leav eithe blank en modes Se bot t t entirel disabl wordwra an reformatting. Pag lengt (00-FF -Se th numbe o tex line t prin (Ctl-OT t star ou O whe firs enterin VDE? Lef an Righ margi column (00-FF -Defaul margi setting fo "W/A vide with (1 hig bi tha ca b use t highligh an provid cursor (2 a absolut addres a o abov 3000h am orde a i th VINSTAL procedure Mos peopl wil b usin VDE yo ca tr t us VD instea i yo hav memor mappe ca leav thi a th defaul value F fo "no used". Arrow up down right lef (00-7F -Ente th ASCI code generate generat thi yo ca instal a alternat valu her (example 1 enable Ctl- o a Osborn 1) I yo hav DE key yo02 04 10 o an othe powe o two Othe value wil produc errati results. Variabl ta stop -Ente lis o u t Har Ta displa spacin -Thi determine ho an actua Tab (Ctl-I i you tex wil display Usuall 08 thi ca b mad easo (eg ZCPR3 yo ca chang thi t som othe (otherwis unused ASCI code suc a 0 (Ctl-@). Wildcar characte -No (i installed)? Bloc mar characte (00-7F -Usuall Ctl- (02) bu i yo nee t imbe tha cod i you file fo an re drive (A-P -Thi let yo specif tha u t tw CP/ logica drive ar nonremovabl medi (har o RA disk) s VD wo th scroll. Sho syste file (Y/N -D yo wan file wit th SYSte attribut t sho i th VD director display? FixY/N -D yo wan th INSER toggl t star ou O whe firs enterin VDE? Defaul rule o (Y/N -D yo wan th Rule lil mod W/A/ -Whic o th thre fil mode "W","A","N describe i VDE.DO d yo wan a th default? Defaul inser o (llega values b carefu wha yo enter! Wha follow i mor detaile explanatio o installatio items i abou th s numbe entr i VINSTAL i HEXADECIMAL yo wil fin goo ASCII/base-conversio char helpful VINSTAL can' chec fo i"   runnin th program tak advantag o it "Help optio befor yo star in fo som basi instructions Not tha AL thtio areas. VINSTAL i largel self-documenting an step yo throug eac ite individually I thi i you firs tim i als possibl t creat "ke files o VD macr ke definitions Thes wor jus th sam way excep the mus hav fil VDE.CO whe yo exit Th installatio fil i ver small containin jus termina parameter (n use options etc). I  A>vinstal [d:]vdename[.com [instfil "[]"=optional Typically yo ca us VINST2 t modif VDE26.CO (o course fee frerinter' specia features. ============================ RUNNIN VINSTAL ============================= VINSTAL SYNTAX i was pleas conside droppin m not wit th detail o wha wa required s tha futur version o VINSTAL ca th installation th faste th displa wil work. Installin VD fo you compute shoul no b difficult I yo fin thaos user shoul b abl t instal VD simpl b goin t th Termina Installatio an choosin th is optio t selec ther ar n othe sid effects VD require compute wit memory-mappe video i improperl installed i ma crash. Mri Meyer 42 N Washington Bloomington I 4740 CompuServ [74415,1305] =================================================ec proble report an suggestion t m a th addres below includ stampe retur envelop fo repl i desired. E o yo wil ge a error Th matc nee no b exact a ther ma b ne releas o VD withou modifyin th installaan' specif mor tha on supplementa fil a once. Th versio number o VDE/M VINSTALL an an othe file mus "agree>vinst2 vde2 termname{.vde} VINSTAL wil loa an us (o create th fil TERMNAME.VD (o .VDM) an updat i a wel aus (an giv t others t supplemen th built-i termina lis o VINSTALL Thi i don b specifyin anothe filename: Aackspac (i Ctl-P i used) Linefeed an Formfeed Yo wil probabl wan t red this s yo wil hav acces t you p printe installatio i basi Teletyp (n specia code enabled) VD assume onl tha th printe respond normall t BOnc yo hav VD basicall working yo ma wan t g throug th detaile di procedur t fin tun things th bette ers tha emulat a ADM terminal Chec you manua t se whethe you machin emulate on o th menu o come close ll VDE/ befor usin it VD ca no b installe fo AN terminal i improperl installed th displa ma b mess bu minal an VD i se u fo a Osborn Executive I yo us anothe computer/terminal yo wil probabl nee t re-"instas: (1 Sourc cod t VD 2.x i no availabl a thi time. (2 A MSDO versio o VD ma b availabl late i 1987. Dir Thank t th man user o VD whos feedbac ha le t improvement an bu fixe i th past Answer t commo questions o typ ".VDP" whic stor you printe installatio data an wor th sam way: A>vinst2 vdm2 okidata.vdp (No yo cetyp o ".VDK" an thi mus b specifie o th comman line eg: A>vinst2 vdm2 mykeys.vdk Ther ar als "printe file yo hav t d manua installatio o VD fo you computer yo ma wan t creat a "installatio file whic yo ca t renam thes file mor conveniently simpl b typing: A>vinst2 vde26 an selectin th value yo wan t change Iaffectin th operatio o VD tha yo ca selec o modif t sui you taste an defaul se o Macr Keys. Th defaulb improved. Termina installation whil necessary i onl on par o VINSTALL Ther ar als numbe o Use Option ple th "LearSiegle ADM3 dat shoul d wel enoug o Qume Wyse Freedo an man othe terminals a wel a man computfro men o terminal alread buil int VINSTALL Th lis i no exhaustive bu i include mos basi types fo examnstallatio Utilit fo Vide Displa Editor (c)198 E Meyer A distributed VD i se u fo ver basi Generi Ter============================= VINST26.DOC ----------- [Supplemen t VDE.DOC] Instuction fo VINSTAL 2.6 (07/87) I abov copyrigh notice Yo ma includ addition o you ow (*.VF files HE overlays specia documentation i yo wish.******************************************** Pleas d no circulat VD i an incomplet o modifie form o withou th #    freel distributed bu no sol ***** **** fo profi withou writte permissio o th author ***** ********************** Th VD edito an it documentatio ar ***** **** (c)198 E Meyer al right reserved ***** **** Thi progra ma bllin an scree functions mor scree size supported WordSta fil mode plac markers Ctl-OZ bloc print large macr ersatil installatio wit VINSTALL. 1987 Recen revisions beside smal fixes ad th following: 2. (1/87 -Improve scroprovement o th tin (4k VD memory-mappe edito b Frit Schneide (1982) a adapte b Georg Peac (1984 fo th Osa misused. ================================ HISTOR ================================== 1984 VD bega a m se o ime argument(s fo th comman (se STRIN INPUT). INFORMATIONA messages: "I/ Working -dis I/ o printin i progress. optiona "Q and repea coun fo Macro. "Ke number: -ente (optiona "N/Q and ke numbe fo Key. Al othe prompt -entc Ctl-K ---Mus Cop the Delete. Hid Bloc Ctl-K ESC- Actuall unmark block. Eras Dis Fil Ctl-K ESC-E Se Plac Maol U Ctl- ESC Bloc En Ctl-K ESC-T Delet Bloc Ctl-K ESC-D Mov Blo int th strin itself yo mus preced i wit Ctl- (thi include Ctl-P). Examples t fin lin beginnin wit "* entry hi C whe finished Yo ca als abor th entir curren operatio wit Ctl-U Not tha t ge an o thes codee scrolling keyboar buffer improvement t VINSTALL. **************************************************************** **n filenam allowed Ctl- inpu abort Ctl-O cas insensitiv searches mor fre RAM wide variet o terminals fast directory undelete lef margin wor functions globa replace tighte compression man usefu printin options mor v6 Th unifie VDE/ versio 2.00 wit it generi termina installation B versio 2.32 improvement ha included macrosat -hyphe a en o line o wor to long. "Find -th searc strin wa no found. "Syntax - macr programmin comman w RAM. "Key -a illega comman ke sequenc wa pressed. "I/O -fil no found dis full empty/invali drive etc. "Reform ("Y/N/*" whethe t chang strin (ES quits). "Rdy -pres an ke t prin nex pag (ES quits). "Repea count: -ente (============================= PROMPT requirin use input: "Abando edit? -confir ("Y/N" Qui request. "Chg? -decidor: COMMO FUNCTIO W VD NOTES ------------------------------------------------- Rep Find/Replac Ctl- Ctl-Z Partia Scrte du t th fac tha VD reserve Ctl-J,Ctl-K,Ctl- a th standar CP/ arro keys Excep th Ctl-K-prefix mos ar min6 characters) Durin thi process yo ca correc mistake wit DEL BS o an lef arrow o Ctl- wil delet th whol n key ma b lost. STRIN INPU -Whe confronte wit promp lik "Find:" yo ar expecte t typ i strin (u t  bloc functions improve format-ting man addition t VINSTALL. 2. (7/87 -Improve header ruler memor us message bla keys VINSTAL termina menu. 2. (3/87 -Use are support variabl tabs doubl spacing searc wildcards mor standar Th firs termina adaptation VDE-P fo th Epso PX-8 Ongoin improvement als i paralle Osborn version VDE-OS. 198born Executive (Ther ar othe descendent o VDO includin Jame Whorton' VDO25 wit rathe differen features.) 1985bloc comman wa use wit n bloc marked. Mor specifi error are: "Memory -th file block o ke strin won' fi i ERRO messages pres ES t continue "Error alon mean th comman use jus won' wor i thi situation (Example +,Ctl-O- Not tha VD doe no recogniz WordSta "do commands i text. ================================ MESSAGE ====r Ctl-K0.. Ctl-P No individuall numbered. G T Plac Mar Ctl-Q0.. Ctl-Q Cyclic. VariTa Set,Clea Ctl-OI,Ctl-O Ctl-OCtl-PP,Ctl-P-CR,*,Ctl-P-CR,CR. WORDSTA COMPATIBILIT -Th fe difference betwee th VD an WordSta comman set ar of(fin "CR,*" type Ctl-QF,Ctl-P-CR,*,CR. No t ge thi int Macr wit ESC-M yo woul hav t typ (whew) ESC-M,Ctl-QF,b los eve o terminal wit ver slo displays I yo lea o on ke fo som tim yo ma manag t fil th buffer a -VD 2. ha faste scrolling also i no buffer it ow keyboar input Thi mean tha character type wil n longe #    o th screen Th bes wa t restor i t norma i b blankin an restorin th scree (Ctl-OZ,ESC). KEYBOAR BUFFETIO -I VD get interrupte b messag fro som othe softwar (BIO error residen utilities etc) i ma los controTIO -VD can' hyphenate bu i doe recogniz hyphen i th text treatin the a legitimat plac t brea line (S macr Key doe goo jo o "softenin up paragraph: Ctl-QS,Ctl-X,ESC=_],ESC=CR],Ctl-S,Ctl-V_Ctl-V,Ctl-D,ESC![ HYPHENA b enterin ne mod (eg "[W" wit o withou filename. NOT O ASCI FILE -Th "A"SCII-documen fil forma use siompt allowin yo t mi WordSta an ASCI dis file a needed Yo ca als chang th curren mod wit th ESC- functio justificatio wil b lost VD "W fil ca b rea int WordSta a Documen fil nearl perfectly yo ca easil toucVD read an write WordSta Documen files WordSta Documen fil ca b rea int VD perfectly excep tha an righ DIS SPAC -VD isn' disk-bound i yo ru ou o dis space jus inser anothe dis (alway kee blan FORMATTE disit th macro: ESC[squiggle].>,Ctl-D,ESC=_> ========================== GENERA INFORMATIO ============================ ft a lon a th characte a th curso doe (o fo "[squiggle]" doesn't match o unti th beginnin o en o th fe] followe b characte an the "> o "<" ar searc loops The wil continu t mov th curso righ (o fo "<" leers et (a wel a variou use preferences usin th VINSTAL program Se VINSTALL.DO fo furthe details. INTERRUP hyphen i desired manually the pres Ctl- again. INSTALLATIO -VD ca b "installed fo differen terminals print-Q t fin "Ctl-M" an selectivel replac the wit Ctl-M" Alterna-tively th followin Macr (bes store a Quieb ful o har CRs makin tex impossibl t reformat Ther ar tw eas way t solv thi problem first yo ca us Ctlon-documen ASCI DISABLE HAR OFF Th fil mod optio ca b specifie alon wit th filenam a an VD fil functio pr I/ Margin Tab Har C disp. "W"ordsta documen WORDSTA ACTIV VARIABL ON "A"SCI documen ASCI ACTIV VARIABL ON "N" ASCI 7- bi characters forma accepte b virtuall al softwar (includin WordStar' Non-Documen mode) I "W mode ess large file mak inefficien us o flopp disks. FIL MODE -I "A o "N mode VD read an write tex a standarwit ESC Don' mak macr program "Q"uie unti you'r sur the work. Example yo ca fin th star o th nex sentenc wthe macr strin (usuall wit "N" repea count) I yo progra i a endles loop yo wil a som poin hav t abor abe I th characte a th curso positio doe (o fo "[squiggle]" doesn't matc tha specified. ESC- an ESC-[squigglC- an ESC-[squiggle] followe b characte an the labe 0.. (o "[","]") ar conditiona jumps the jum t tha ltryin t reforma an find hyphe a th en o line i wil qui wit a error Yo mus joi th line (an delet th i you'r typin lon wor clos t th margin yo ca typ hyphe wher you' lik th wor t b broken. I VD i P) Consequently i yo edi a ASCI fil create b othe softwar (includin earlie version o VDE) i ma appea t nc VD 2.50 t allo accurat formattin an WordSta compatibility distin-guishe betwee HAR an SOF CR (se WORDWRA etc se u whe ne fil i loaded Typicall "A i fo wor processin an "N i fo programs etc. DEFAULT FOR Fil u th occasiona glitch. Th "N an "A mode bot produc ASCI files an diffe onl i th defaul option (margin als instal VD no t preserv BA files.] Le VDE' filesiz limit encourag yo t brea wor u int file o 50 o l around) Alternatively yo ca us th ESC- an ESC- command t purg unneede files [I yo hav smal disks yo ca5/128-byt limi o an on key I doe no "call th key ther i n returning. Macr program ar store jus lik an oile. ESC-# followe b 0..9 i use t "chain t anothe macr key I thi wa yo ca buil u string longe tha th 6 labe ESC-0..9 A tw epecia cases ESC-! jump t th beginnin o th Macro an ESC-! jump t th en (aborts). ESands. ESC- followe b 0.. i simpl "jump instruction causin macr executio t resum wit th comman followin th$    programming. ESC-0..9 whe i Macro functio a "labels 0..9 The hav n effect bu ca b "jumped t b othe comma severa command whic functio onl i Macr string an giv yo contro ove th executio o macro allowin rea on Key (VDE' ow inpu lin wil onl accep 6 bytes bu VINSTAL ca handl u t th ful 128.) Beside simpl stori us a undefine Ke result i a error. Ther ar 50 byte tota availabl fo al 1 keys an 12 byt limi fo an an reuse a an futur tim simpl b typin ESC-0. Ordinarily Key operat jus lik th origina Macro the wil as f an use simpl b typin ESC-<#> Example typin ESC-K- wil stor th las Macr use a Ke 0 an i ca b recalle dashe o comma fo clarity an "_ mean spac o blank.) Her i a exampl o macro Ca yo figur ou wha i doeb give her a the function no a the ar type in Ctl- prefixe a neede ar NO shown Key-stroke ar separate bMacr runs.) Macro als sto an tim a erro occurs th erro messag wil b visible an ca b cleare b pressin ESCe u Macr executio b specifyin "Quiet mode pres "Q befor th repea count Onl th heade wil b update a th a a "< character Thi ca b useful som ma fin i distracting s i turn off. ===============================an whe usin Ctl- t reformat. Ctl-O toggle DISPLA O HAR CRs Har CRs otherwis invisible ca b cause t displn requirement o specialize writin o programmin languages.] MACR PROGRAMMIN (ESC-0..9 ESC-!,=,[squiggle],# -VD h". [VINSTAL allow yo t instal defaul se o macr Keys Thu VD ca b customize fo an task suc a th formattiin i empty usin ESC- wil delet Ke definition Usin define Ke bring it strin int th Macr buffer Tryin t onl functio key Similarl yo ca mak i QUIE once-onl ke wit "Q instead e ESC-K-Q-0. I th Macr (ESC-M str Macro ca b store (0..9) b enterin the wit th ESC- command the usin ESC- t sav them The ca the b recallear ver powerfu tools particularl give thei progra abilit an storag o functio keys. MACR KE (ESC-K -U t 1C etc i macro yo mus prefi the wit Ctl-P (NOTE T mak the easie t rea an understand Macr listing wil acro s tha th sam sequenc wil alway hav th sam effect. I orde t includ an inpu lin editin character (BS h macr executes an yo ca abor i a an tim b pressin ESC. (I yo ar sur yo kno wha you'r doing yo ca speil simpl typ numbe fo th repea coun (0-9 o "* fo "global --actuall 25 times) Yo wil se th result a t spac a th en o th line Hittin RETUR als harden sof CR Th distinctio betwee har an sof CR i onl import i actuall C wit spac befor it) Yo ca chang har C int sof one o vic versa b deletin o addin R,Ctl-OR,66,CR 2 Typin an frequentl repeate phrase "ESC-6 i muc mor convenien tha "Worl Wid Widget Inc (N.A.)n Macros her ar som usefu functio Keys: 1 Storin differen set o margin (e fo quotes) fo example Ctl-OL,12,Ce once yo ca typ "N (fo N repeat befor storin th ke number Example ESC-K-N- store Macr i Ke a once-o "Repea count whe executed I yo wan t suppres thi (givin somethin mor lik "functio key" tha onl executl-QF,(,CR,Ctl-G,ESC-B,Ctl-QF,),CR,Ctl-G,ESC-T,Ctl-QC,CR,ESC-C,ESC-D Onscree yo wil see QRQF(MG[BQF)MG[TQCM[C[D VD Macro s (Answer .eli eh f dn eh t meh f tsi gnika eli f tu sesehtnera n stnemmo ll eka lli tI) Ctl-QR,Ctcontainin the wil hal there Othe globa Macro ma nee t b aborte manually. VD turn INSER OF befor runnin m Man command (lik Fin o Reformat ar designe t generat error a th en o th fil s tha globa ("*" Macr ned ca b repeate automatically Whe yo typ ESC- yo wil b aske fo th string the "Repea count" Usuall yo w== MACRO ================================== MACR (ESC-M - "macro i strin o VD command an tex that onc defiUR key (Thi i C immediatel followin characte o text. I contrast whe wordwra occur yo ge "SOF CR (whic chang it margin an lin spacing.) Th en o paragrap i marke b "HAR CR" whic occur whe yo pres th RET$    th curren margi setting an lin spacing (Thu Ctl- i use no onl t reshap paragrap afte editing bu als t t th curren margi settings. Ctl- REFORMAT fro th lin th curso i on t th en o th para-graph accordin th screen Thi i usefu fo comparin differen section o tex withi file o eve betwee differen files Typin Cth screen whic retain cop o th fil tex startin a th curren line Editin continue normall i th to hal o t i necessary t recove reasonabl amoun o tex delete eithe b overtyping o wit an o VDE' delet commands I. Yo ca alway ge Har Ta b typin Ctl-PI. UNDELET (Ctl-U Ctl-QU -Th undelet function ca b use (repeatedlmodes Variabl an Hard th Ctl-O comman toggle betwee them I Har Ta mod th Ta ke produce a actua Ctl- (AS]........ ("N mode I.......I.......I.......I.......I.......I....... TAB (Ctl-I Ctl-OV,Ctl-O+,Ctl-O- -Ther ar tw Ta . Exampl 2 Options BCtl- wil prin ou th curren marke Block wit contro filtering. Yo ca abor printin a an ti prin ou pag si o th fil twice wit th heade shown pausin befor eac pag unti yo pres ke (othe tha ESC) th currentl marke BLOCK. Ctl- FILTER contro character Ctl- t tex "Ctl-X". *n print th jo ou n TIME (nn=1..255 ente on o mor o th following i an order: PAUSE fo you keystrok befor eac pag (shee feed). print onlMA (Ctl-B Ctl-OD -WORDWRA i automati wheneve th righ margi i set An tex entere wil b formatte whil yo typetor th scree b pressin ESC (Note i Windowin wa i effect an tex i th windo wil b lost.) WORDWRAP REFORrsor whic i sometime useful). WINDOW ZA (Ctl-OW Ctl-OZ -Th Ctl-O comman create Windo i th botto hal o tme i sequence. Furthe us afte al delete tex i recovere wil produc jun (usuall duplicate o tex abov th custop ma b se wit Ctl-O an cleare wit Ctl-O- th default ar i column 5 15 35 an 55 [Thes ar reconfigurable nex variabl ta stop Existin tex i no overwritten space ar adde a th en o lin a needed U t eigh ta so ta stop ar marke b eithe "T (Variable o "I (Hard) Examples: ("A mode [-----T-----T-----------T-------------- o severa symbols "[] designat th curren margins ". indicate area outsid th curren margins "- withi them Al allowe i paginatio i of (Ctl-OP) o i "B"loc prin wa chosen. Exampl 1 Options @6#1*2"Instructions page"P wili 5 characters us a empt string "" t ge numbere page wit n heade text.) Th las thre option (@,#,"" ar NONTIN (ESC-P -Th ESC- comman Print th fil fro memory Yo wil b aske fo se o "Options:" a whic poin yo ma VINSTAL t defin thos string a th Ctl- toggle s tha al you' nee woul be: Ctl-PS,underline text,Ctl-PS PRIaril zap (blanks th entir screen goo fo avoidin CR burn-in o jus protectin wor fro pryin eye o fingers Resl-O agai remove th Window (Note Windowin i onl supporte fo screen o 1 o mor lines.) Th Ctl-O comman tempor work wit ESC- i th curso wa adjacen t th bloc deleted an i ma wor imperfectl i DE ha bee use severa ti th curso ha no ye bee move away Ctl- undelete on character Ctl-Q doe whol line. Restrictions undelet onlal o scree columns [Thi i reconfigurabl t 2 4 16 etc.] I Variabl Ta mode th Ta ke move th curso t thCI TAB) whethe thi overwrite an existin tex depend o th INSER toggle Har Tab displa b defaul a fixe intervex properly Ctl-O display "rule line belo th header Typ Ctl-O agai t remov it. I eac colum yo wil se onm wit ES (thi ma tak moment o fe keystrokes dependin o you BIOS). RULE LIN (Ctl-OT -T hel yo alig t string followe immediatel b th pag number wil prin a th to righ o eac pag nea th margin (Maximu lengt ). @n begin printin A pag nn. #n print onl (u to TOTA o n pages. "... use th quote strin a HEADER Thn off) Th crud wa t d thi woul be: Ctl-P-ESC,U,1,underline text,Ctl-P-ESC,U,0 Th sophisticate wa woul b t us ar bette fo varyin parameter lik characte pitch. Example you printe use ESC-U- (an 0 t tur underlinin o (a%   u yo ca mak the anythin yo like. "Toggles ar goo fo feature lik underlin tha ar turne o an off "SwitchesCtl- switche Ctl-Q Ctl-W Ctl-E Ctl-R (I WordSta thes toggle ar Doublestrike Underline Ribbon an Super- script b a plac marker. Contro code displa o scree a capita letters highlighte i possible VD assume the ar no cecommende whe paginatio (Ctl-OP i on) (Th Bloc marker normall Ctl-B canno b embedded an Ctl- i reserve fo us MARKER (Ctl-PZ,Ctl-QP -Yo ca se an numbe o temporar plac marker i th tex wit Ctl-P (the wil appea a Ctl-Ze send formfee befor printing alig th pape first. [Yo canno toggl paginatio o i th pag lengt i 0.] PLACs tim ca ge ver slow. PAGINATIO (Ctl-OP -Th Ctl-O comman toggle pagination Whe on th pag lengt determine it th curren fil lengt an memor usage i byte (102 1K) Not tha whe ther i les tha 25 byte free responstea i yo hav memor mappe vide with (1 hig bi tha ca b use t highligh an provid cursor (2 a absolut addres a o abov 3000h Th advantage o VD ove VD ar faste scree update an littl mor fre memory. USE aul margi setting fo "W/A modes Se bot t t entirel disabl wordwra an reformatting. Pag lengt (00-FF -Se th numbe o tex line t prin o page (Doe no includ anothe line fo header i used. Settin t disable payo wan t use an instal th actua contro sequence you printe needs Th default are: toggle Ctl-D Ctl-S Ctl-Y n seve definabl codes fou toggles fou switches Th Printe Installatio i VINSTAL allow yo t choos wha code  -backspac -overstrik previou character Ctl- -har (ASCII ta -printer respon variousl t this Ctl- -formfee (No ri th tex wit th Ctl- prefix Thu pressin Ctl-PCtl- (o Ctl-PH embed Ctl-H etc Severa standar code are: Ctl-th sam sheet or i conjunctio wit th "* option ca prin ou multipl copie o inde cards labels etc.) VD nevso printin occur wit n pag break o formfeeds (Thi ca b usefu fo printin smal thing righ afte eac othe o operly) Mos usefu i Macr whe yo wan t sto an se somethin fo moment. ESC- display a informatio messag wit th curren fil lengt an memor usage i byte (102 1K) Not tha whe ther i les tha 25 byte free responOPTIONS Creat BAKu file (Y/N -Shoul backu fil b mad whe yo edi a existin file Choos "Y t pla safe "N t sav dis space. Defaul fil mod W/A/ -Whic o th thre fil mode "W","A","N describe i VDE.DO d yo wan a thginatio entirely. Scrol overla (00-lines -Thi i th numbe o line overla betwee screen whe scrollin wit Ctl-R/Ctl-C Th smaller th large th scroll. Sho syste file (Y/N -D yo wan file wit th SYSte attribut t sho i t-P-cod produc a entir strin o byte fo commonl use effects VD support subse o WordStar' printe installatioharacters s the ar no counte whe reformattin text. Fo greate convenience yo ca als arrang t hav singl Ctl(Plac marker ar NO save t disk.) PRINTE CODE (Ctl-P -Contro code fo specia effect i printin ca b entere ) Th Ctl-Q comman move th curso t th nex plac marke i th file cyclin bac t th to o th fil i needed sto print ar enabled. Whe off th heade wil sa "P L xxxx" showin yo th absolut lin numbe i th file Alth pag an lin show i th heade ("P x L xx") an al pag function i th Prin routin (formfeeds headers start- default? Defaul inser o (Y/N -D yo wan th INSER toggl t star ou O whe firs enterin VDE? Defaul rule o (Y/N -D yo wan th Rule lin (Ctl-OT t star ou O whe firs enterin VDE? Lef an Righ margi column (00-FF -Defh VD director display? Fixe drive (A-P -Thi let yo specif tha u t tw CP/ logica drive ar nonremovabl medi (har o RA disk) s VD won' rese the befor writin t them speedin u som systems Ente tw drive fro "A t "P%   " t leav eithe blank ente "@" (Th defaul i "@@" o none i yo hav RA driv C: ente "C@". Caution namin flopp driv her ca caus seriou BDO error o CP/ systems. Rin bel o erro (Y/N -D yo wan you termina bel wish. Cloc spee i MH (01-FF -Se thi t reflec you CP cloc speed mos Z8 computer ar 4. MH (us 4 here). Horizonta scrol dela (01-FF -Thi adjust th dela betwee scrollin th curren lin an scrollin th res o th screenATIO (Bot versions) Termina I -Identif th termina yo ar installing (1 characters) Viewabl scree column (28-FF -Ente th widt o you scree i columns Th norma valu i 50 fo a 80-colum screen. Scree line (04-FF -Ente th  mea "no used" (WordSta arrow an B nee no b redefine here. Th defaul i CP/ Ctl-K,Ctl-J,Ctl-L entere a 0B0A0CFF (I yo hav ANS standar arro keys yo ca se al thes t FF.) Termina init unini -Ente th code yo wan sene a (#),bytes Example ESC- i (02)1B54 I you termina can' d thi the zer i ou (00). Alternat vide on/of -Ente th code (#),byte t tur you favorit vide attribut (e inverse dim o an off Thi wil b use fo contro cere ou wil displa a "?". Curso positionin mod (S/R/A/N -Thi tell VD ho you termina ca b mad t pu th curso a an give row/colum o th screen: "S"tandar leadi byte(s) ro byte colum byt (default) "R"everse leadi b t rin whe VD erro messag displays? Alternat vide i heade (Y/N -D yo wan th header messages et t appea i contrastin vide mod (i installed)? Bloc mar characte (00-7F -Usuall Ctl- (02) bu i yo nee t imbe tha  whe workin beyon th righ scree edge Th averag valu i 80 adjus u o dow a yo like (VD i s fas tha valu o 0 i recommended.) Har Ta displa spacin -Thi determine ho an actua Tab (Ctl-I i you tex wil displaynumbe o line o you screen Normall 18 fo 24-lin screens. DELet characte (00-7F -VD alway accept 7 a delet key I you keyboar can' generat thi yo ca instal a alternat valu her (example 1 enable Ctl- o a Osborn n t initializ you scree o entr int VDE an t uninitializ o exit i th for ( o bytes),bytes Example Ctl- i (01)1A Minimally bot set o code shoul clea th screen. TERMINA INSTALLATIO (Generi VD only) Autowra a lin ode an (optionally th heade an messages I you termina ha n attributes zer thes ou (00). Us hig bi fo alt vide (Y/N -If instead you termina need th hig bi se o character t pu the i alternat video zer th abovyte(s) colum byte ro byte "A"NS st ANS standar sequence "ESC[rr;ccH" "N"on n absolut curso addressin supported Curso positionin sequenc -Thi i th actua sequenc use t addres th cursor I YO CHOS "A above yo ca ski  cod i you file fo an reaso (eg ZCPR3 yo ca chang thi t som othe (otherwis unused ASCI code suc a 0 (Ctl-@). Wildcar characte -Normall "_" thi i th characte tha wil b use a wildcar i FIN strings Chang i yo Usuall 08 thi ca b mad 02 04 10 o an othe powe o two Othe value wil produc errati results. Variabl ta stop -Ente lis o u t variabl ta sto columns i ascendin order (Colum 0 i th leftmost.) TERMINA INSTALL1) I yo hav DE key yo ca leav thi a th defaul value F fo "no used". Arrow up down right lef (00-7F -Ente th ASCI code generate b you termina arro key i thi order on byt each Ignor parity Us valu o F ten (Y/N -Usuall Yes a mos terminal wra dow t th nex lin whe characte i printe a th righ edg o th screen I your discard character instead se thi t No. Clea t en o lin -Ente th code t clea t th en o th li string ou an sa Ye here otherwise No. Consol filte (7D-FF -Thi i th highes ASCI cod tha wil b sen t th screen Normall 7F i you termina can' displa code 7 o 7 (DE an tilde) lowe thi t 7 o 7D Character filtthi entirely I YO CHOS "S o "R" the ente th 4-byt sequenc fo addressin th curso t th to left tw lea bytes the tw row/colum offsets Mos terminal us ESC,=,20h+row,20h+col o 1B3D2020 I yo hav onl on lea byte ente&    0 fo th second I YO CHOS "N" the yo mus ente tw 2-byt sequence instead firs on t hom th cursor the on t mov i right I eithe i onl on byte ente 0 fo th second Typica value ar home=1Eh right=0Ch whic wounserted/deleted i thi case ente th sequence fo lin (th secon scree line) I you termina can' d thi a all zer thes ou (00). Ins/de specifi t lin -Usuall No se t Ye onl i th ins/de sequence yo installe abov arhi zer the ou (00) an th curso wil remai visibl a th uppe corne o th screen. Vide RA star (3000-FFFF -Ente th startin addres o you vide memory a fou he digits. Vide in/ou cod -I you vide RA i i th ordinar baINSTALLATION Printe I -Identif th printe yo ar installing (1 characters) Sen L afte C (Y/N -Normall Yes Bu wit som printers whic manufactur thei ow L o receivin CR yo wil wan N here. Printe initializatio -Ente stnge i yo want (Avoi Ctl-B,Ctl-H,Ctl-I,Ctl- J,Ctl-L,Ctl-M,Ctl-Z whic ar use fo othe purposes.) Code fo toggle (on/off -Ente th actua code (#),byte t sen t fh printe o encounterin eac o th fou toggl code define above fi <2><> <3>Ctl-CCtl- <----norma macr key <4><> <5>Worl Wid Widget Inc <----" fla mean no-rp key <6><> <7>Ctl-QRCtl-[BCtl-QCCtl-[TCtl-[ <----" fla mean quie key <8><> <9><> Thi i prett straightforward yo jus selec tl mak 1E000C00. Dela afte curso positionin (00-FF -Normall 00 Som slo terminal requir dela her t accomplis curso movement adjus thi valu upward a necessary. Insert Delet lin -Sequence tha wil caus th curren curso l fo lin only rathe tha general. TERMINA INSTALLATIO (Memory-mappe VD only) Unuse column o RA (00-FF -Ente th numbe o unuse byte i vide RA betwee th en o on visibl lin an th star o th next Example man computen o memor (eg a F000) jus ente "C9 her (that' RE instruction) Otherwise yo wil nee th machine-languag cod t switc vide memor i an out Ther ar 1 byte availabl fo eac routine an yo mus preserv al th CP registrin o cod (#),byte t sen t th printe befor eac prin job t se margins prin mode etc. Printe unini -Ente anothe strin (#),byte t sen t th printe afte eac prin job t restor printe t desire stat o exit. Toggle anrs t tur featur on the off. Code fo switche -Ente th actua code (#),byte t sen t th printe o encounterin eac o th fou switche define above. MACR KEYS VINSTAL give yo th abilit t examin an chang th defaul seh numbe o th Ke yo wis t redefine the typ i th ne definition muc a yo woul i VDE Al th sam rule appl (bu VINSTAL wil accep longe keys u t 12 bytes) I th ne definitio i to lon t fi i wil b rejected. Fin t b deleted o ne lin inserte there Mos terminal ca d this Example o a ADM3-styl terminal ESC- o (02)1B4 insert line whil ESC- o (02)1B5 delete line Fo som terminals yo hav t specif whic lin i t b ir hav 80 (128 byte o RA pe line bu onl sho 50 (80 o them S ther woul b 30 unuse columns. Curso on/of -Ente th code (#),byte t tur th regula CP/ curso o an off s i won' appea o th VD screen I yo can' d ters an en wit RET Yo shoul fin th assemble cod t d thi i you termina manual t conver i t hex eithe loo u th he value i Z8 referenc book o us DD o ASM/MA t writ an assembl th cod t he form. PRINTE  switche -Thes ar th Ctl-P-code tha wil b use t cal u predefine sequences Ther ar fou toggles the fou switches Th default (Ctl-D,Ctl-S,Ctl-Y,Ctl-T Ctl-Q,Ctl-W,Ctl-E,Ctl-R ar chose fo WordSta compat-ibility bu ca b cha o macr Key i VDE (An Key define wit ESC- whil runnin VD overrid th defaults. VINSTAL give yo displa muc lik this: MACR KEYS (01C byte free <----not fre byte (u t 01F 500) <0><> <1>< <----"<> fla mean empty URTHE USE PATCHING Th addres o th Use Patc are wil b give t yo b VINSTALL Thi smal regio i VD ca b use t instal an extr patc cod yo need (Example i you vide in/ou routine won' fi int 1 bytes yo ca jum t t&   h Use Patc are an pu mor cod there. Thi i th ONL suc are available a VD use al availabl memor afte it ow cod fo editin text Note i yo fin th Use Patc are to small yo ca als us u t 3 extr byte befor itable th Ctl-O comman appear i th Ctl- table a Ctl-X. Fin th proble keycode an us DD o anothe utilit t chang it (Yo wil als se th "keycodes 80-84 i th tables thes mea DE an th arro keys howeve installed.) Domina Installatio se t Generi (o Osborn Exec) printe se t basi Teletype n Macr Keys n Use Patc code. ========================= GOIN BEYON VINSTAL =========================== I you compute require specia additiona codcute whe VD i calle up Th Starle ha differen termina emulation an ke definitions mos o thi cod jus ensure tha it' i Soro mod (whic i wha VINSTAL i se u for) an set th curso an DE ke definition properly. Therhin else. ;NEC840 Patc fo VD 2. (808 mnemonics) or 0100 ;A beginnin o VDE.COM, jm 0248 jum t Use Patc area or 0248 ;A Use Patc area, mv c,08 se scree mode: mv e,81 Soroc wra on fnkey off etc rs cal specia comman t ente assemble mnemonic i debuggin utilit lik DD o SID. Eri Meyer 42 N Washington Bloomingto I 4740 ---CI [74415,1305] ============================================================================== t Thi i th Prin Switc cod area yo mus the avoi usin th fou Switc codes. VINSTAL als tell yo th addresse o th comman table i VDE/M Yo ma fin thi usefu i yo nee t g i an chang VD comman ke tha conflict wn' tr t chang th ESC-prefi t Ctl-K-t mak VD mor "WordStar-like" I wil tak yo whil t locat al th occurrences an leav yo wit som prett confusin pair o command (e Ctl-K eXit Ctl-KCtl- shif scree down). RESTe an yo kno ho t us a assembler yo ma wan t mak a overla t ad thi cod t VDE (Yo ma als fin thi th easies wa t instal othe data suc a th VidIN/OU routine fo th VD Termina Installation. Writ th overla file i anothe problem th VD cas toggl comman (Ctl-Ctl- ha t b changed a i wil conflic wit on o th Soro arro keys (O som othe computers yo can' generat Ctl-Ctl- fro th keyboar a all. Not ho th overla find th addra BIOS mv c,4E se curso keys: mv e, t mappe codes rs cal specia BIOS mv c,4D se definabl key: lx d,dat usin dat below rs cal specia BIOS lhl 0108 ge addres o mai comman menu lx d,6* offse o Ctl-it you computer' firmware Ther ar fou comman tables basic ESC Ctl-Q an Ctl-O Eac i lis o 3-byt entries wit on byt keycode the tw byt address (Examples yo wil fin th Ctl- comman an th ES prefi i th basi OR DEFAULTS Thi optio i provide i th even tha someon ha s mucke u you cop o VD tha yo can' sor ou what' wrong Thi shoul retur VD t nearl th stat i wa distribute in al Use Option restore t thei defaults Ter generat HE fil wit you assembler the merg i wit VDE.CO usin MLOA o simila utility (B sur th cod fits!) Example th followin overla add specia cod fo th NE Starle t th Use Patc area wher i i immediatel exees o th mai comman men (al th men addresse ar store a 0108-010F i VDE.COM alternatively yo ca ge VINSTAL t tel yo wha the are) add th appropriat offse (determin thi yourself) an the change th comman ke t sometCtl- (thi ma change) da poin t offendin Ctl-Ctl- code mv m,0C chang i t Ctl- instead jm 0480 ;Jum t VD Star point data d 4,7Fh,0, ;Dat t se "DEL ke a DE (7F) end Yo ca als ad cod lik thi t VDE.CO usin th "'   '