b[l̖b[l̏?b[l ?b[lWSA bPbNbN  . .. lost+found@ usrA sys libD mntstandme etc dev bin tmp vmunixebootxe.logine.rhosts.cshrc.profiledprotomeb[lXAbմby ...b[ lWAb*by . .. c2 cpplibc.acrt0.omcrt0.occom.o f1gcrt0.ob[lW͜A b tby .A .. if_ecreg.hif_en.h if_enreg.hb[lWxuA byTbnby . ..copymediagme gxteste!imemtesthb[lW͜A b by  .A .." init_sysent.c# tty_conf.c.$ uipc_proto.cb[lWQA b|b|b| ~ . ..%hosts& delivermail'services(networks) protocols*fstab.ip+fstab.dd,configd-rdumpd.dumpd/fstab.xy0groupxy1passwdy2 rc3rc.local4ttyscal5 pac6fsckcal7rrestor8restor9syslog: newsyslog;fasthalt< syslog.conf= syslog.pid>termcap?fastbootdA ac@vipwootBacctontCanalyzeDbad144EcatmanFchownGclriHcronIdcheckJdmesgKdumpfsLgettyMhaltNicheckOinitkPkgmonQmkfsRmknodSmkprotoTmountoUncheckVpstatWquotXrebootYreniceZ sa[savecored\shutdownd]swaponn^tunefsn_umountnh rmt`updatenacomsatnbnd.localdcftpdcaldhtablelegettabledfimplogdgrexecdiroutej setifaddrkrlogindlroutedm lpdrestartnrshdstaoxtrusrap ndnewdiskqrwhodisrxtrusrndstelnetdttftpddu ndvdkinfownewfsxgatewaysy hosts.localzttytype{ndcopy|rxtrusrutmpile hosts.equivmtab.eq dumpdatesvremoteeprintcapic.motdnesetupme setup.filesb[ lWxVA bb.~by . ..}mouseot~console tty memkmemlenullle MAKEDEV.localttyp0V.drumV.ptyp0V.ttyp1V.ptyp1V.ttyp2V.ptyp2V.ttyp3V.ptyp3V.ttyp4V.ptyp4V.ttyp5V.ptyp5V.ttyp6V.ptyp6V.ttyp7V.ptyp7V.ttyp8V.ptyp8V.ttyp9V.ptyp9V.ttypaV.ptypaV.ttypbV. gfxptypbV.ttypcV.ptypcV.ttypdV.ptypdV.ttypeV.ptypeV.ttypfV.ptypfV.mbmemhombiohottyahottybhoMAKEDEVb[ lWv A bbyby . .. mv adb as awk cshdiffEVmakeEV sed shfalseVtrueV ar cat ccchgrpVchmodV cmpdateV dd df duechoV cpexprVgrepVhostidhostnamet.hkillame ld lnloginme lsmailmemkdirme mtniceme nm odpagesizet.hpasswde pr pwd rmrmailermdiresizeestripesttye susynce tar tee edwalle whowritee pstimeetesthh en[nb[ lW͝LA b by .A ..GENERICREADMEefilesme files.sun newvers.shparam.c makefile.sunb[ lWA bby ...b[lWLA b}b|b|o . .. copy_client first_client fixhostnamerxtrusr setup.cntlrsetup.constantsxtrusri\xtrusrndesb[!@lXA /Oby@ ...b[#AlWwA bbbA . ..BsundeveC netsunifmeEnetinet sysF OBJGnetpupeHnetimpeI hs confmeJ sun\Lmachineb[%BlWyA b obyB .A ..Karreg.hLbasics.hdMcgreg.hNdsdreg.hdOipreg.hPmbvar.hQmouse.hRmsreg.hSoctreg.hdTrect.heU rectlist.hVsureg.hWtmreg.hXvp.hveYvpreg.hZwinio.h[ wintree.h\xyreg.hb['ClWyA b byC .A ..]af.h.o^if.h.o_netisr.h`raw_cb.haroute.hb[)DlXeXOA b byD ...b[+ElWyA b }byE .A ..b if_ether.hcin.hetdin_pcb.hhe in_systm.hfip.hetg ip_icmp.hhip_var.hitcp.htj tcp_debug.hk tcp_fsm.hhl tcp_seq.hhm tcp_timer.hn tcp_var.hhotcpip.hpudp.htq udp_var.hhr in_proto.c.b[-FlWA bbbF .A ..saf.ometar.omeu autoconf.o.vcg.omewclock.oxconf.oeycons.oezdd.ome{dkbad.o|ffloat.op.o}if.ome~if_ec.oif_en.o if_ether.oo if_loop.ooin.ome in_cksum.o.in_pcb.oo in_proto.oo init_main.o init_sysent.oioconf.op.oip.ome ip_icmp.oo ip_input.oo ip_output.oldivt.o kern_clock.okern_descrip.o kern_mman.okern_process.o kern_prot.okern_resource.o kern_sig.oc kern_synch.o.o kern_time.olmodt.olmult.olocore.obak machdep.o.mb.omemem.omemovc.oems.omeocsum.ooct.omeparam.oprobe.optwo.oequota_charges.o quota_share.oo quota_sys.oraw_cb.obakraw_ip.o.o raw_usrreq.ohroute.osetjmp.op.osu.ome subr_prf.o subr_rmap.o subr_xxx.o swapgeneric.osys_directory.o sys_domain.o.o sys_file.oo sys_generic.oo sys_process.oo sys_socket.oo sys_xxx.o.o tcp_debug.o tcp_input.o tcp_output.oh tcp_subr.oo tcp_timer.o tcp_usrreq.ohtm.ometrap.oetty.ometty_bk.o.o tty_conf.oo tty_pty.oo tty_subr.oo tty_tty.oo tty_xxx.oo udp_usrreq.oh ufs_alloc.o ufs_bio.oo ufs_bmap.o ufs_dsort.o ufs_fio.oo ufs_inode.o ufs_nami.oufs_nd.o. ufs_subr.oufs_syscalls.o ufs_tables.oo ufs_xxx.o.o uipc_mbuf.o uipc_mu_msg.o uipc_pipe.o uipc_proto.overs.oe uipc_socket.ouipc_socket2.o uipc_usrreq.o vm_drum.oq. vm_machdep.ovm_mem.oq.vm_mon.oq. vm_page.oq. vm_proc.oq.vm_pt.o vm_sched.o. vm_subr.o.vm_sw.o vm_swap.o.vm_swp.o. vm_text.o.vp.omexy.omear.hmebk.hmecg.hmedd.hmedecnet.h.cdsd.hmeec.hmeefs.hmeen.hmeether.himp.hmeinet.heip.hmeloop.hemb.hmems.hmemt.hmend.hmeoct.hmepty.hmepup.hmesu.hmetb.hmevp.hmewin.hmexy.hmeb[1GlWypA b byG .A ..pup.he pup_proto.cb[3HlWyA b 8byH .A ..if_imp.hoca if_imphost.hb[5IlWPA b by`I .A .. acct.he bk.hhe buf.he  callout.h.h clist.hcmap.hconf.h descrip.h.hdir.hp.dk.hp.dkbad.hdmap.hdomain.h.herrno.hfile.hfs.hhgprof.hinline.h.hinode.hioctl.hkernel.h.hmap.h.hmbuf.hh mman.hh!mount.h"msgbuf.h.h#mtio.hh$ mu_msg.h.h%mush.hh&nami.hh'param.h(proc.h) protosw.h.h*quota.h+reboot.h.h,seg.h.h-share.h.socket.h.h/ socketvar.h0stat.ha1systm.h2text.h3time.h4timeb.h5times.h6trace.h7tty.hh8 ttychars.h9ttydev.hh:types.h;uio.hh<un.hh=unpcb.h>user.h? vadvise.h@vcmd.h.Avlimit.hBvm.ht.hCvmmac.hD vmmeter.hE vmparam.hF vmsystm.hGvtimes.hHwait.hhb[8JlW؃A bbyJ .A ..Iclock.hJcpu.hhKdkio.hL dklabel.hvMfault.hNkbio.hOmmu.hPndio.hQparam.hRpcb.hhSpsl.hhTpte.hhUreg.hhVscb.hhWsir.hhXtrap.hY vmparam.hvZconf.c.[ swapgeneric.c]sunb[: l x  5bxb,bx08@HPX`hpx\0 xD@F' |( <.H |0R f$<S$y /<B/N &<8S/<//N SfQ3 < |"H"<ቂ2R"o < |"H2R"j |""|p BYQ |(0Nq | N`Bg/<?<?93HNh/HChCCE BBBBBBBBBBBBBBB@F'Nu@F&Nu@F%Nu@F$Nu@F#Nu@F"Nu@F!Nu@F JsgN0Nu@FJsg / fN0NuNr NuNr'`Nu o"o !I""P#HNu o"P h #HNu o"o "//BB /S@k 1 VR@$Nu oJf4B( H"H"|p"Q !I""P#H 9q#qNuHzNsetrq oB( H"9qg("P h #Hf"9q#q oBNuHzNremrq@#qBs"9qBf mF `F'"9qg#qH |p P""PfHzNswtch h #Hg AH"9q#q` ABqJRf (fB/(Rs0NXFNu o@(4F'H("|($| $2 $2 8(0o.@ $2L(F(4J(Lg/x(LB(LF NNuNV n B"n #PN^NuNVBN^NuNV.*yw`(JLg0-H/ mLNXJDf+y D*mpfa*nN^NuNV.*|w` p*@Jf**nN^NuNV.*yw`V n0-PfFHx T/HmN Jg60- gHx .T/Hm*N Jg *mpf *nN^NuNVH8*np0. eB`<  @&P(yw`p0,fHlHUNPJf (lpf L8N^NuNVH ..*yw` -g *mpf L N^NuNVH ..*yw`p0-g *mpf L N^NuNV.*nm HmBN!P*nN^NuNV.*yw`&JmgSmfJXg0-H/ mXNX*mpf/9oBHzN *nN^NuNVH8(n &L` 0m 9oRJfJfp`HH0-@B*yw`* /HT/N Jf0-H".g*mpf` . s gT sg sg s g sg| sgp`A)P)h)h)h B`HxHUNgPNId-@A+P+h+h +h $/. mLNX/.NIX`0- gA(`0- gpNId-@A+P(+h,+h0+h 4`9m ``0,f*0- gNId-@HUaX/.NIX;l ` L8N^NuNVH<*n (yw-UB-mA$H`gHxHn/N A&H`JgRe0,H0BA-P-h-h-h Hx /.HnN -@Jf   (lp nj .ؑ .L<N^NuNVH0*nHxBNPP-@JglHxHm8NPJgLHxHm"NPJg, n (Ј(@)MHywHTNIP+LB,B`Hm8NX/.NXp7L0N^NuNV.*n-m nB/.NdXHUNIX /NX*nN^NuNV nh0 n h0(g/.aXN^NuNVH0*n n (Ј-@Jwg6 @0 g gp/`> nJg/NLXJfp1`"(mHxHl/.N l0BL0N^NuNV n (Ј-@Hx . //.N nh0N^NuNV#ww#ww#2vN^NuNV.HxBNP*@f/.NX`*;|$ Э-@ nX"@"#h#h#h n ."@"#h#h#h n "n"NId-@ 9vvm HUNX`*B|Jvf#v` yv!M|#vRv/.NIXps*nN^NuNVH8NId-@-yvJg" n#|vfBv nB|Sv/.NIXJg^ n (Ј&@B*yw` m(h 0,SfJlg 0,kf0-0gHxHkHmN Jf0-0gHxHkHm N JfjJg^Hy;B n/N -@g@/Hk ."/N Jf /.N` ."/NX-m*UwfJgH/.NX-@/Hk ."/N Jg ."/NX`d/.N`L8N^NuNVJm NqN^NuNV. n*hBf J gp` . b@0;N Vxxp@@(@@@@L n0(fp `Tf/.NPX-@ .`4fp9`&HUNQX`0-0gp8`/.HUNRP/.Nx`0-0gHUNQX/.Nz`/.NN`JgH0-0f/.HUNRP/./. n h h NP-@JgBm0`80-0f`8HUNQX/.Nd`r-|-`Hx n (Ј/HmN n1|`Hy N`*nN^NuNVH<*nA-H0-@Jg UJ,fX dLHn/. . @ PNP.. rNx @$P`Z Ъ(@ fJ0,$g> l,0( g.Hx/.HlN Jfg ,((d&L$Rff.. . @-P rNw @$P`` Ъ(@ fP0,$gD l,0( g4p0,f(/.Hl nNPJgg ,((d&L$Rf*gRk&L0+Rk @d7|=kBp0.//-B/9 HSaJf;nBL<N^NuNV. n (Ј*@ hgp` Ugp/`JgJmfp1` nJf@/-NgX/NMlX-@JfHxNMX-@Jg .-@B n0(/Jg ` .X @/p0-//- n/(aJgp0`> nJf .X @ ."@"A . "@" n1mB*nN^NuNV nB nBh n h0(g/.aXN^NuNV n-h nB/.NdX nJ g /( NYX/.NIX ./NXN^NuNVH0*n n (Ј(@1| n (Ј(@HxHTNFP89mA)PL0N^NuNVH8*n NId-@ n(P`*(T`& , fJg l1nP&L(THS nNXf/.NIXL8N^NuNVH0-| n*P`Jg, -g&*Ugp0-nfBJfJgRJ gJ g - f0-ng `J gRJg .g .l(M-@Jf L0N^NuNVH np.Jg/./. /.HyN n hm ( gHxBNP-@Jg  n1@ n0(Hr| n!A n (Ј*@B f nBn P/Hm/.N A-H0h n"H3h n n (Ј-@///.N n0(HЇ n1@ n| nߨ/.aX ./NXL N^NuNVH0 n (Ј(@0,H-@p-@Jg/./, HyN m\0. nh n .Ѩ n (Ј*@p0--@Bm/./.NP".g(/.HyNP /NX`Jgp-/p/Hy N p-@ b@0;N""""";m $mxp-".e\Jgp-/Hy)NP fB`p--@p-( @,t @-PgHU . @HHЮ/ nN`B0.lHTa` ma^+@ +@` $mp-".e~A #A#HyHyHy /NR`@L0N^NuNV . @-P . @ ."@"A . "@"/.aXN^NuNVH0 .(@ np. Ь*@Bm n0(H/HTNP;@0lJg n/( /(HyAN BBBHTNL0N^NuNV.NId-@ 9w"<QN$HBHBBBЂ$ 9w"<NԀ-B/.NIX .$.N^NuNVH HxHxN!P*@fHyNXB dr,N"( AR m*yt`< mf.Jmg( mg dr,N2-H( A,xc#~~#~~ 9w3~#\wLHxNMX#\L N^NuNVH8NId-@(yw@g#|w@fBwDB|SwH/.NIXg |b llHxHTNP(@JfR~` Ь*@p-@2,Ho$/HTNP(@Jf R~`P Ь*@J9`g0/.HTNP;@ gR~`R~HTNX`;m0-Hm;m;m0-D@H.-L`(T0,HހJfJg0JlR~`0,Hn0l` D//.N>P(n oHUaP0.m0.mg^0-H2-HЁ2*HoD0-H2-HЁ2*H-@0*H".l*0.j0.j/. /N>P`$j */NX/*ahX`j0*HѮ$j f jJ(f$l &@-SB/.HSNP$j ` -@$j /HSNPf*l ;nA+P A+PHTNIX /NX &@k ` HSNXBL<N^NuNVH0 n*h `(m HUavX /NX*Lf/.NIX ./NXL0N^NuNVH0*n(n +L+l l !M)M L0N^NuNV.*n m!m m !m*nN^NuNV.NI-@*y~f` S-*U mJ(f/aX~f/.NIX*nN^NuNV` /9~aX ~~fN^NuNVH8 .*@ np-@Jofp-@JgX f -|` p--@ . Dg" g g .` -ep-".Wbp-" Ҁ-A A#fHybNLX&@-|-|f& f/././.Nl p` . @-P n ."@"A"n"X-p-".Wb8 .X @ ."@" f n/(NgX/NMlXJgb` -@-| (M ,e@p,r,Yc&p,R,",Jg `p-" Ҁ-Ap,JgJ g gN`p,Pr,bJ\g 9\ @"n"XNq n X,` n#fHybNLXJgp,Pr,bZX,`BL8N^NuNVH np-@ .*@J g0 n 1n n !| /. Э//.N 0-H"..//. .Ю/N 0.mL N^NuNVJm n .r @JgJf . X`& g f-n ` . -@HyD .r @//.Hy`NkHyP .r @//.Hy(NkN^NuNVH *nJg p-//-/- HyNJf |`| B` -e[-HxBNP-@Jf /NX`Hx@0-H/NP/B /N -@/.HUaPBB/. /N.f Jgv/.` n (Ј*@|B  gJ (g> 2g0 3g& 7g* @g& Ag//HUNl `z`z`|`z`L N^NuNVH0 n (Ј*@-|BJ g /. NX@ .m@;y~Ry~JfA-HHx/NFP .X-@ nJf1|A .P"@" wfJ-f HxNM`/-NgX/NMlX(@fJg 0-H//- /-HyN-|3/.NX` n/NYX`/.NWX nJg P(h,g n PR( n P0($g n -@/- NgRXJf+l /.NgRXJf@0, f -|1`TJf -| `B0-lo -|(`,0-ln@;m;mBm /./.NP;@ /./.HT lPN -@`0-@f0,H-@ m nh nB`HxBNP-@Jf -|7`xp| n!@ n (Ј-@ @ !m!m!m !m o&/./.HUad -@ n1@` n1| . n1@ .Ю2-Hm"0-H n1@0(H-@` n1n nh  nh n"H3h/././.N n nJf/NX` n"H3h nBh /./.NP n1@ /./.HT lPN -@f .Ѯ0-H".mh`A .f @Jg @ P h&g @ PSh& .L0N^NuNVH0 .*@ . (@ np-@`lp-@Jgf f -|` p--@ .o-nJg .g/.HTHUN .Jn . " -A`BR .f .L0N^NuNV. n (Ј*@p- 3A#A #HyHyHy/.NR*nN^NuNVH0B n -h*n` 0-HѮ*UfHxBNP*@f-|7HUNX .`+|h;|* Э(@ n h 0(@ .9@ n0(0g* -@ @ Pg -|/` n)h `B . @)P|HxHywBHUNL0N^NuNV 9"HAHABAЁ-@R dfBNq n n1n  n1n n!nJg n .6"@ <"Q2`Hxf .6/NFPJg n . "@ < "Q`Hx( . /NFP n1n4JgJg(0.HP @//.HyN `HyNX0. H @/HyNP0. HJgV gN gJg$ n0(HP @/HyNPHyNXJf`B n-h-h0( H-@ n f-n-n0.-@ n fJg .Ю//.HyN `/.HyNP/.HyNP n(!-@Jg-| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -|HyNX`. . @/HyNP . f .| @/HyNP` n/(T/(,/((0(BH//(DHy N n0(@//(8/(4Hy?NN^NuNVHP;kB -! -S'@4 +4m( +4f: +8m +8f&0-"k@c7m"@'m4'm8Jk@gBk  gFJm&g> k mp` g -PBm ` +D-@Jo g(-!R m&cSm&`S0- H".䲀nZ0- Hf gD/.HTN>P .ѭ0.m p0-&c 0.m&`-!Bm&0- HЭ2+BHҫD-@Jo.0- H".䲀l D/HTN>P0.m -! n0(g@ ko8Jm g2HSNXX&@Jg/.NXB g`V g*0+HW b@0;N**** gHx6HSNP`Hx6` g0+HW b@0;NBJfpp0-&ЭHoJp0-&Э'@H n0("H"+HDЁS1@R nJhRfh@/.NX+d0-&m b HU/.aPJm f g k mp` +(n -TnR( +,(l'k(,Bk /.NxX7|BHSaBP -S'@4 -(o -Tn -(-@JkZg -\o/9/9 +`NNf0+ZHNd`h0+ZHN// 9N// 9"9N.N// +`N// 9NNN6N'@`BkZ -TfBk `P +`N// 9NNN7@ k l7| k< o7|< 7|ZBk n0(8H".ಀo(0(8H/ 8/N(P n0(8k@`$/. .8/N(P0.k@B n0(LfJHg .8/NX'm( +,(l'k(,0+H] b@0;N:h~`Jo n0( g /NzX7| `Jo7| HSNX7|x/.NzX`Jo|HSNXX`87|x`rBJf$HUHSaP.J f+`+`HTNX gX k mp`BJf/.NrX+RD0+HW b @0;NPX|7| n0(gBHyHS0.H/BNHSN`7|`7| HSNX7|x/.NzX`7|x` g Hx/-B` gRm HxB0- HЭ/HUHSNJg /.N\XLP0l ߬&Sg<0, HЬ.Jo(0+ Hl8߫0k / /N>P/+HTNIP mm0p`.&S +-@/+NIX/.NX`|BJg(Ug ,Df mfJl f0, HѭDp,!-@HTNIX -@(T n0( g/.NX`/. ."/NPg ,Dg ."/NX .` /NXBL8N^NuNVH<*n m$(hBB -,(-@p0-@-HHЁ2,8Hd0,8H`p0-@-HHЁ.Jm0-Ho0-H.-|0-H @-@ -,Ї2,8Hҭ(d .f -0(nJg60-Hg .Ї2,8Hl r2-@dJ-fp-f0,$H2,"H2,(H4,&H’l 0,$H2,"` 0,(H2,&H-@Jo6 -PD". "HAddHABAЁ2,$HN #d0Jm@fJl8gJm fJm fBmHUaX`NId-@&ytg8Jk gHyNX7| SytRyt#tB'| `HxBN`P&@/.NIXfp7` '|T7|(Jg//./,DN &JfB Ы$@J fHyNXHx(HR/- N %m,%mD%j%j mlbp-f8-|-|0,$HrN l0,$HrN` < n1@ n"H3h` Jg m (Ј-@0(H-@Jg-SHxBNP&JfHSNX/.NX` S -S n1n/. n (Ј//.N n (ЈЮ-@` nBR nRh n0(f0(H-@* 鈁* n!0,$H2,"H2,(H4,&H’l 0,$H2,"` 0,(H2,&H-@0,$HrN".lBJo5n" -0,o -0,5@&5j&&* !`+m(0Jg .Ї2,8Hf*! Юg .Ї5@ 5j .(Ї/HSNP5@$J-f .gR,߭, -,To+m,T -,ToJmZf;|Z -,+@\Jm fX -,(gN -`N// 9NNN;@ m l;| m< o;|< BmZBmBm ` -(RTo -(R+@T0,gBHRHU0-H/HxN .(Ї5@|B0,g <w` -$ //-HSN-@f6Jo -DЮPo -DЮ+@P-JgJ-gBL^HUNXX*@`$Rm m nB -`NN;@ m l;| m< o;|< J8g*0- H2-H;@ m l;| m< nR`V0-HS @ N//0- HNNN;@ m l;| m< o;|< +m(,HUNX`J m$ h0(g, mXlZB -(S/ -DS//- HUN`BmX;|Z `:HUN,X|HUNXB-` mlHxH4(H2(>FBmHUNXX*@g m m m$/(NzX `;|`;|`*nN^NuNV#(,#,(N^NuNVH8&n |b klHxHSNP&@Jf R`x Ы*@ c BHUN|DPp0--@0-Hg0-H".o^R`JB*B-;n ./HSNP;@gFRp0-/Hy`NPHSN`0-H/HSN>PJfHxp0-//-p0-//- Hy(Nl(@f&/-NgRXJgHxHxHUNl `X3RA #TkHSHyP ,"/N Jg8 ,"/NXL8N^NuNV n-h/NjX/.NzXN^NuNVJmn nd . b@0;NNNNNN`< . -@Hz .r @//.Hy(NkN^NuNVH8B*n ` 0-Hހ*UfHxBNP*@f/. NXp7`+|`;|* Э(@B(B,| P9@ . @)P . @)P n9h n9h9l Bl /HUNP9@ 9@| n&h0+/0+g <w`B/BHUNL8N^NuNV n-hBJfJ g-|`@0;N$j`JfHy(/.NgP-@JfHxHx/.N6 -@Jgf`bJf -|9`P/.NkX`@/./.NhTP-@`(-|-` nJ g -|8`/./.NiP-@Jf/.Nx` nJ gz/NjX/.Nz`x/.NN`jJg4 . @-P nJ f|/./NiP-@Jg`r nJ g/./.a.P-@BJgJ/.NjXA ."@"`*/.NkX/.Nd`H/./.NkbPJg /.NX .` . cHynN`N^NuNVH N N\*y+y(8Z;|40-4Hr WЭZ+@| |Hy(/-NP#(PA#(TBy,~` ) @ R mB - @  -"@"R m#-#-#-#--+|FN,Na2NdNId-@NL N /.NIXNtaa(aBB09vH/NEL -@JfHy|NXHx ./HyN n/( N~X |w#w(#w,N\NNrHx/.09vH/N #|/NXHx/.09vH/N #,/NXB, |~ <C)"Q |~ <C*8"QNj #v 92<"<N y1@4 y|BNXJg, y@ 92<#) y!@ZNL8Bv yB( y1|4BNXJgNN y(P h=h H` y1|4NkL N^NuNVH *|B+M+MR ?mL N^NuNVH0(|0`)L)L )L)l(@0e 9"928N-@ 9"928N-@B`P й<*@;|BB B+y+| y!M#*HUNXR28mBvBw8-|p`$Rv n (w8o#w8 nJPfJvfHyNX vo, 9w8йoS"9oN"9oN#w8 9w8"9vN#w8 9+"9vN#+BN|XL0N^NuNVH *y#B`A@+H R@ 92`N*y` JmgNeHyHNZX)B`LJf #*yȻdJmf ,\ @ RmB BA# L N^NuNVH .. d ,\ @*Pf  )B` L N^NuNVH<*ng moSm` mf2/. /- NP)J f J9)fB Bm`|0H-@(m=lPp0,&-@Jg/.HTN$bPHTNȮXHTNXBm . g `gr`0.H"HA((HABAЁ. ` mg4Jmg.(mg"0.H",Nfp0,&g`V&|H`Jg 0nge0.H"HAHABAЁ-| @$P*y̻e^ `f 0.H/NpX0.H/NXXHU/.0.H/N L<N^NuNVHx(Hy(NP`NVN^NuNVN^NuNV#)N^NuNVH8-y)x n/(NHX*@g(mp0,& g )`j=lP0.H"HA((HABAЁ., @-PJg n f (f (f (g 0g n (g 0gf n  fV r -@ n ШSr -@m0 . y(P"(6遰m y(P <>".d ."(6遰m y(P <>".dB`6 n/( (Ю/0.H/ nN g n .m (g -|x`-|`B`/./9(PNxHP&@HxHSN-HP y(PB& n (S@鈁S n/( (Ю/0.H/ nN R n .mh y(P n (, @L8N^NuNVN^NuNVH0*y)x f -g )` r -@ ЭSr -@m . y(P"(6遰m y(P <>".d ."(6遰m~ y(P <>".ddB`F/./9(PNxHP(@HxHTN-HP y(PB(zTT@R .m y(P L0N^NuNVH B`F y(P (Z"(6Ё"Ё*@g$gp0@f*zUU@R)m ., @L N^NuNVN^NuNVN^NuNVN^NuNVH y)x r "9)遐.JlB ), 9)Іr 㠰-o  )`Z/9) 9)І//9)N Jf6Hy*8Hy)/9) 9)І/N$Jg B/NZPLN^NuNVH<(y(P , -@*y)x  gv gxJg , g fB`x ,6ЬZ"Ё&@g^p0+@R"HA HABAЁй$@*g`( ` `~+gR:m f~`l0,4Hr ЬZ"偐&@gFp0+@R"HA HABAЁй$@*f+gR>mB`j ЬZ&@gXp0+@R"HA HABAЁй$@*f$+gHS//,VNa R6mL (@*l RJn `g HTNX V.Jg2HnNNX3.p09.R/Hy.HnN /./. .X"Ҁ//.aJ9)gfB .찇lHx"<NЮ/09w`H/N (@gHTNX` < Y-@ .". -A y(T!A< .//.N@PB`/./.N@P "<NJfRg HTNXHx "<NЮ/09w`H/NH (@*l HH-@/ .R/NPR .fpX .fB/.N@PXSl8B/.N@Palg HTNXJg/.Hx/9N /.NXL8N^NuNVH0*n  -f -|`BJ-gXp0- fJ m gB(y`2 lf$Jlo ,f0g )`e 9-r . 9-й-r , . r R*///N JfD |~ <C*"Q |~ <C*"QHy*Hy*//N$Jg y(P ( fNX`X y(P y(P /9(PN X`Hx/9(PNP y(P (  g y(P y(P . |* <C)"Q |* <C*8"Q///NXH JfLBB 9- //9- y(P (6r /HUBN(h)/.HUNPJgT y(PJVgH 9-r / R/ y(P hV/()l>:)l:69|4R +:Ы>ѹ`,)k66)k::)k>>9k44R +:Ы>ѹBB)kFFBRB,)yTdBlb0,(Hr?N. P @;Pj "<N"P A0R+0B ,\ @$PgXJg.NLJg$HxHn/-N )J9)Nq*nN^NuNVNLJg> n wѹw(NI\-@ n#w#w/NIXNN^NuNV.*y)x c )`NI\-@Jfn 9(P| @-P-h-h-h JfJg` .wmwf .wl B-n`4HywHna*P`" -` @-P-h-h-h /.NIXHx/-HnN )/.NIX*nN^NuNVH0*y)x(y(P c )`HxHn/-N )J9)fJg +maHnahXJfHnaZXJfNI\-@JfdHTHzNPJfJg.HywHnaPHnN X/HTHzbN A)P|)h)h)h `$A -`"@"#h#h#h /.NIXL0N^NuNV.*nHxHUNPJ|fJfB+m`n/.NIXNI\-@Hm|Hma$P -wnwf -woHmN X/HUHzzN /.NIX*nN^NuNV nJm nJm B@mp` nJf (ol!yoBN^NuNV.*n - lFJf4 JfJgN+U+m . J l:B@ S`,B@ S . B JfJ gp`B B*nN^NuNV n  nѐ n ( nѨ/.a2XN^NuNV n  n n ( n/.aXN^NuNV nJlS nB@ n B@mR nB@N^NuNV#w)N^NuNV.*y)x-UBHna\X*nN^NuNV.*y)xNI\-yw 9w"<N=@NI=yo=yoHx /HnN )*nN^NuNVH0*y)x(y(PNI\-@HTHz6NPB)l|B)JfJg0 ,wnwf ,wo ,w#)Jf B)l`4 |w)P)h ѬHlN X/HTHzN /.NIXL0N^NuNVBHn /.a" N^NuNVHxHn /.a N^NuNVH0*n(n `Jg/./ajPHH, %fHH,  lgn Xgnl DgnR %gavP`R Sr gBJg/.Hx,aPP-| nHH, o/./a(PR` n  oxR`-T .R @HH,g/./aP`/.Hx%`b Og` cgn bg` dg` ugn sgnn ogp`` xgZ`RL0N^NuNV. fJl/.Hx-aDP .D-@A*H .". N @ .". N-@Jf/.SHH/aPAb*nN^NuNV.BJw4g `B#w4*NHUHUN$P 9(PeDd @Jg @/(NKX/.Hy!aP/.BN>P*nN^NuNV/.Hy,aPN^NuNV n/($0(a/0(//. Hy?aNN^NuNVH ..J g^*y,Ȼg ->gNId, fHUHx N`hPHU/N`hPHUNRHX/NI`Jgv gn gf 0`0g(B0#0`0B 0 @BR mJ0m 0mB0"900 AR0Jg /NXL N^NuNVH0*nA(H+n ." Ҁ*( )nL0N^NuNVH8*nA(HJ of . ooHyXNX&L`  m»fp vod +"9oN"9o-AlD  m +Ё.  -@&Jg Ю //./9ad `R.+ . ѫ . fP'k'Sff rNJgHy`NX`PJf0BL8N^NuNVH JoRJ oJ .P*@-M`Jg P -och -ЭmZ -Эn . ѭJg .Ю m .Ю n ѭJgP+m+U` .Ю m$Jg .Ю n .  . ѕ`b.-+n-G.* P-G fA"nc:Q -Э//- n/(HypN+U+mB* .$f*J9w0g"B9w0/9$N ` HyNXL N^NuNVH<*nA(HJ nHyNXfB`&L` +nГnPJfJg +Г".Ү m +f2Г".Ү f$KJg|P%j%R` . ѫ . `^ +Г".Ү g$K`PJff`j%j %RQb .Ю '@ +Г".Ү '@ .& .L<N^NuNVpN^NuNVBN^NuNV . m . N^NuNV . n . N^NuNV . e . N^NuNV . b . N^NuNVH 9Ю eHyNX`B/9Hx 9 /N,pHx/9 9 /NwD B 9R " @p0@/NPXR m 9Юbf*y .ѹ L N^NuNVH..|` g `R mBLN^NuNVH0*n(n .. SJg gp`BL0N^NuNVH *nB`RJf L N^NuNVH .. n *P ( Jg> gJ gJRS n S n RJn n P n SB`.//NPJlp` U`//NPJm`L N^NuNVH0-y)xBHxHy0N *@J9)fgHUNX)`(y/ n n@ n/(/,NX/HTN *@fHT`2mF n (29,FAH;@&;|(;y)*;l,,HxHywHywHUNRl(l@HxHywHywHTN | <C"Q-m-lBHxBHxHnHUHxN(h)J9)f .fHyNXSmfm .g HmN X . g> .fHyNXSmfm .g HmN X*nN^NuNV.*y)x-m-mA-H-|BHna(P*nN^NuNVh.*y)xJo o )`BAl-H-m -/Hnl/-N )J9)f BHnaP*nhN^NuNV.*y)xA-H-|-m-mHxHnazP*nN^NuNVh.*y)xJo o )`BAl-H-m -/Hnl/-N )J9)f HxHna P*nhN^NuNVH<*n y)x d ,\ @(Pf  )`0HJ fr`rgBB &UB`$Jl )`n +ѭJmR .m-m y(P ( g*Hy)|NXJg -f)` lf0BHUB/, J f < ` < @N)`$l+l p0*& g`jHx HRNPp0*fj0g  f )j2 +l /. HUHRa )jp0*g(jHRN X`/. HUHRa ) .Ѭ .#)L<N^NuNVA-H-|-n-n-n-n-n/.Hn/. a. -@J g n `Jg-| .N^NuNVH0*n(n =mPBJg gHyNXJf JfB`Jl2p0-& f0.H"92gp`Jfmp0-&* fJf2HT0.H/0.H"HA((HABAЁ.`6mBHT0.H/0.H"HA((HABAЁ. @ PNP)9)HH`Jg f0 f( ,Ь-oHx/9(PNPp` `g=m -m n-h0`-| ,".N-@ ,".N, .䐆d .䐆` ,. `gJf -2-@JoNl. Ї/ fB`p//.HUN n"(d-@J9)f fJm f. ,Ї2o" @g g f ,Ї+@2 l .R n"(P"-2m n (0` n (HF2Ш4SL-@` .-@X#wX-n#wlJfJl./.NX-@ @/( @/( NFP nB(`R -Rf(/9wl/9wX/./.0.H/N`/./.0.H/NH -@+n` ."<N-@B`< .Ю/0.H/N;PJg .Ю/0.H/N:PR .ܰmf/./.0.H/N>`/./.0.H/NH -@ n .萨(l ` n .萨(. n g-|/NX`HT/./ n ( І/a)Jf, Іg ,2f n/.NX``p0-& @f /.N\`* Іf n/.Nj` /.NXmBJy)gm&J9)f JoJfd .L0N^NuNVH8*n.. (nB`PSJoJg&T-kJg .c-G , Jg8 gb g( .ѓ . . .Ѭ`Jf/./HUN`/.HU/N -@Jf&`Jf/./HUN `/.HU/` .L8N^NuNVH0..*n `SPJfHyNX(UJoJo - Jg" g, g,RSSRB`,//NPJl` T`//NPJlpL0N^NuNVdH0-y)x n/NHX*@JgL0f  )`6 n.( f/NLZX.Jf )` ff n , @` ff n , @` r, c )` g.JgR/Hn| n/(N )J9)g6`r @gJg/Hn|NFP`  g n-h| mfHn|//- N `(mp0,&-@x xgL @ff$ xg @xf ,2 -@|` f~g f}g)`=lPvB) y(P ( gHy)|NXJg )`zBHn|/0.vH/0.vH"HA((HABAЁ. @ PN)J9)f, @g"Jg/ n/(Hn|N )L0dN^NuNVpN^NuNVN^NuNVN^NuNVH0(y)xJn y(P `/,NTX*@g$ -f y(P0-*h(f - f )`JgHxHyNP`0-(H## ##  `$ -f HUN XHxHyNPJ n#)J l)BHyN XL0N^NuNVH0 y(P0((H"9gB` y(PB(.9 B S b@0;NVLLHxHx/9N Jg/9NX#HyN X`xHxHx/9N JgT/9Nl`.9Jm: l0 rN( @#` y(P(hVg" ,Df l<0(&fh~/9/9NP.lvHyx/9NPJg2Hyx 9V/NPJg/9/9NP.Hy`/9NPHy` 9V/NPJmJg,F`B/9N@PJm /9/9N@P`.9 rN(*@B  @ й(TgDR m 9(T@f 9gN*`N ` g y(T!yD bT y(Py fNHyN Xp`4HyN X y(P(HH/NX# `rL0N^NuNVH0*y)xNȢ(@JgN89|/-/-Hn/N)J9)f)n ` 9),\ @BBlL0N^NuNVH0*y)x/NHX(@gV lg &)`D/-/-Hna )J9)f"/./, NxP)/.NXL0N^NuNVH0*y)x/NHX(@g( lg &)`/-/, NP)L0N^NuNVH8*y)xJgJHxHn/-N )J9)fB/./-N Jf )`/NHX(@g lg &)`NI-@&l 0+f )`0+g"Jkf#)`zHxHkNNPJkfJkPf0+ g7|5PJkPg Q)`:0+ f>-kHx/.NPHxHSNP))n nB&n`lNXJmNȢ(@f 9),\ @B`-kHx/.NPJfHyPNX&n9|8)K HxHxNP-@/HSNPJgP n0(H".o 0(H-@/./- n (Ј/N Hx/-HnN /.NX/.NIXL8N^NuNVH8*y)x/NHX(@g lg &)`&l /-/-Hna L )J9)f/.HSN$P)J9)fhNI-@0+g0+g $)`00+gJkPfHxHkNNP`Q)BkP/.NIX/.NXL8N^NuNV)N^NuNVH0*y)x/NHX(@g lg &)`A-H-|-m-m-mBBHx/-/-N Jf )`\/-/-Hna )J9)f./- Hn/./, N) -#)/.NXL0N^NuNVH0*y)x/NHX(@g lg &)`A-H-|-m-m-mBBHx/-/-N Jf )`4J9)f,/- HnB/, N) -#)L0N^NuNVH0*y)xHxHn/-N )J9)f@/NHX(@g* lg &)`A-H-|-m-m-mBBB/-/-N Jf )`B/- HnHn/, N )J9)fJfB`H n0(H".ܲo 0(H-@/./- n (Ј/N )J9)f2Hx/-HnN )J9)f -#)Jg /.NXL0N^NuNVH0*y)x/NHX(@g lg &)`xA-H-|-m-m-mBBB/-/-N Jf )`,/- HnB/, N ) -#)L0N^NuNV)N^NuNV)N^NuNV-y)x n/NHX-@Jg2 @ hg &)` n/( n/( NP)N^NuNV-y)xB n/NHX-@Jg @ hg &)` n po )` nJ gfHx HxNP-@Jf 7)`~ n/( n (Ј/ n/( N )J9)f8 n ( n1@/. n/(/( n/( NJ)Jg /.NXN^NuNV-y)xB n/NHX-@Jg$ @ hg &)` nJ gJHxHn/(N )J9)fHx HxNP-@Jf 7)`/. n/(/( n/( N)J9)fv nJ gl n0(H".o 0(H-@/. n/( n (Ј/N )J9)f Hx n/(HnN )Jg /.NXN^NuNVH0BBHxHnHxN)J9)fBBHxHnHxN)J9)fNȢ*@g-y):;|+n NȢ(@gL89|)n #))#)/./.NPN^NuNVH<*y)xHna@X)J9)f#.HxBHy0N (@gx l fp0,& @gHTNX)`HHT/-0.H/aB &@g*#.A$H`N0fS.AҵeBL<N^NuNVH8BJ gp`p/0. H/0. H"HAHABAЁ-x @ PNP)J9)gX))Jg /.NXgBg HTNXJg /.NXB`2Hx Hx0. H/NH -@ @ f*|H`"Jg0. Uf`l`e*|HdJf+n: n&h /+hNX(@+L/+h/, n/( N /.NXB&l T\f 0nJ gp`B@J f| +4SЫ"+4N-@/+Hy,pN7>P-@JgB`-k0 .Ы8o ."+4N-@/. +Ю"+d/0. H/NH -@ @ g/+/.N8P` /./. n/( N ."+8NAЈ @ .Ѯ/.NXB +8Ѯ .m,+n: Jg nh/.NX L8N^NuNV-y)x n/(a X)N^NuNVBa X)N^NuNVH8HnaJX-@Jf$*|H`Jg0.Ugep`0.H/NXN0.H/N2X-@l Jfp`Jm(mlHTNX m&h /+/+N8PJ+fp`B-@/-NXBBU HrN/N<8XJfJ/.0.H/0.H"HAHABAЁ-| @ PNP0.H/NXXBL8N^NuNVH0 n h*h /-hHx n0H/N> (@/-h/, HUN HTN\X -4SЭ"-4N-@-mB`-m0 .Э8o ."-4N-@/. -Ю"-d/ n0H/N> (@/./, /.N .ѮHTN\X -8Ѯ .mrL0N^NuNV.NLJf 9)HH`lHxBHy0N *@gp0-& `gp`4=mP0.H.mp`HUNX n0B*nN^NuNVHxNVXN^NuNV.*y)x#/#/#/ # /$*nN^NuNVNLJggHx0(BH/NlPN^NuNVH0*y`F mg8Jmg2(mg&p0,& f0. H",NfUeL0N^NuNVH . fg mg, tg,`R*|X`( ".lX`*|p`*||.fJg ".f `BL N^NuNVH0(y)xNLJgJg#BJf$*ygHUNXB`HxBHy0N *@gfp0-& g )HUN`>Jg( y (f 0( m g/9NX#HUNXL0N^NuNVH8&|JgV y(h$, ,`Ԭ",<ҹ ,(NrdNo#BHyNX*yg M(h$, ,`Ԭ",<ҹ ,(NrdNn #BHy$N`4HUNȮXB (X @ Ї"@R m/9,aX7@ /9,aX7@ 9w-/aX7@'y-7y)7y)Bk 9,й,.g 9,й,й,"N7@ 9,й-/aX7@J,g 7y,`7|y--m2B9)BHx/.Hx HSHUHxN(h)J9)g/.HUNPHUNXL8N^NuNVH..BB`R * lJgR mR r ЇLN^NuNV | .L"@"#h#h3h N^NuNV.*nNIl-@`4 ->g.J$g(HU m$NX@>HxHmNPJfHxHUaP/.NIX*nN^NuNVH *nNId. . gHm N|XJlHUN X . gXHmN X>/. HU0-8H"HA((HABAЁ. @ PNPHmN|XJl . g"HUN|XJlB-DB-IB-J>/NIXL N^NuNVH *n Э . oHxHUaP> m(Hm-QHH/N4PJf>HUaBXL N^NuNV.*nfHy NX>HUa X*nN^NuNVH *nNIl. ->!fJ$g HU m$NX/NIXL N^NuNVH *n0-8H-@ . t}g"n tgn tg nt trft -Efl y(P0(&mBg\,fT ( fH +g< +g0Hx0(&H/NlPHxHyvNP` tg . t gn tgn tgn| tgn trg&/././. HUNp` tg$n tf` tvf` t gn( tgn t~f\` t fN` tugn< tf2`-EHH n B`T n.Bmp`` >` n-PNIl-@ -: f . gHUa`x -:".gb .gFHm HUNP-U-m-mA *+h+hA+P +h+h` :HUaX t f+n:` .: -: g>HUaVX/.NIX`" n-P -: gHUa<` :HUa>X`j -:".FgP .fHm HUNP-U-m-mA *+h+hA+P +h+h -: gL`8 n :`lHx/.HmLN `RHxHmL/.`>`8 n.Jf~`/HUaP`HUarX`NIl-@ ->f>BHU0-8H"HA((HABAЁ. @ PNP`NIl-@ ->f -:g`>:`DJy)g 9,Ȱgp `HU nHH/-EH(h @ PN`" tg ` tgn tg`v tg`h @fgn( tng>n tg`B tog`4 @tgRn @tg` @tgD` L N^NuNVB n (: g/aX n-h (:"g Ѯ .N^NuNVH 0. H$HB((HBBBЂ.$ @$0. "HAZZHABAЁԀ*BNIl-@ . g g*`n m( whRf>`VJ(f+y(P(`F-H @0H"-oFJ,g m, whRf >`+y(P,/.NIXB`HUaX-@Jo/.NIXpL N^NuNVH0*n (y(P;n 8Jl&f #,3 ,JmBf;l(B9mB&>> -EgHUaXBL0N^NuNV.*nJ-EgHUaXB-E`BmBHUaXB>*nN^NuNVH *n:>-U-m-mBB+m`HU/a$PHnN|X.l>L N^NuNVH ..*n ,-:  gHUazXRɌ gHUa~X  gb o8HxHUaP -:@g ->g-P-Qg`HU/N4PJmHUaXHU/a>` ->f ->g> -Ef-YHHf& -:gHUHyaJP>`L-WHHf@ -:f4HxHUaPHU/aP Э gHUaX:` -THHf8 -:f HxHUaZPHU/a\PHx0-BH/Nl`-QHHf\ ->f>>BHU0-8H"HA((HABAЁ. @ PNP`x-PHHgX`f-PHHg@-NHHg -OHHf: -:f HxHUaPHU/aP-NHHfp`p/`( gX o:-H @0H"-l -EfHUHxa`HU/N4PJl` ->g2-LHHg -MHHfHUHUNX/a P-LHHfJgBHUHUNX/a `*-MHHfh -:g(-IHH"fJg>HUHUNX/a P`HU/alPHUHx a`PHUN|XJnB-I>` -Ef-XHHfnJgHUNX. g fHU/a PJf`nHU/a PJg^HUNX. g fHU/N4`2-VHHf HUa X` Э m -EgP`HU/N4PJmHU/aPJgB-IHm HUNPHUaX`-IR-IJfmFJ> \f> ->g>HUHx/aP-FHH-@HU/a P-RHHfV -:gH-FHH op` -FHH-@JoHUHxa*PS`>:HUaXL N^NuNVH0..*n -: g2 -:gp`Hm/N4PJg `RɈ` f -:g fp -: f^-Fr. -:f0NIl*Hm/HyN ߹Ɉ/NIX-FJfPp `JRɈ -:gj(| Jg&HHfHUHx\aPJl*,HH. Am ZnHUHx\aPJm` am zn f -:gHUHx aPJl ~f -:g~` -:fHm/N4PJfAF(H < @HH,B ? b@0;N\JgS`~ -:, f Jg&HxHHV/NP.` f~B`: -:r , fHHr. lBRJg -:fHm /N4P`x -:@g~` -:r , f ~`h~ `b g fPHH-@mB l6HmHxN4PR`L0N^NuNVH0*nB ->fp` y(P0(&mBg +g +g ( fHx0(&H/NlPHxHyvNP`n ->g -> g/.NIXB`HxHUNP/.NIXNIl-@ -: gHUa X/.NIX,g,,-:  gPNIl-@Jol/NIXJfJg n Jg/HUN|X/NpP-@` g `A (@NIl-@Jn, ->g -> g/.NIXp#`/.NIX-|`& g f~ g< n4 ->gn < @Jg < @HH.> -Efh-UHHf\Hx0-BH/NlPJgHxHyvNP`h Am Zn ` \f>`Z-RHHf gT/. /NpP-@Jf6 n Jg, fHU/avPJfBHTN|X.l> ->g2 3l*Hm-PHH/N4PJf>HUaxX .L0N^NuNVpH8*n(n ->fp`-H @0H-@-lB`f,f -:@g| y(P ( fj +g^ +gRHx0(&H/NlPHxHyvNP y(P0(&mBg`SPJlHy+NXJo T.(Jg do~dA&HHTHx/HSN.-@Jf -nD -:f -:gJoHH*B-IHU/a0P*lHS -oNIl-@Jg T Tߨ߬ -n0/.NIX` HUaXHxHyvNP`Hx?Hy g ,fp#` B`@>HxHmNP`L8pN^NuNVH0..*n -:g: -:gZJ-If HUaX` g fHxHUa`l < @ b@0;N00@00 -:g Am ZoHx` -:f`-IHHm^NIl-@-FHH, >:mJF(m`HUHH/aPHTHUNP(@f:>/.NIX-FHH-F o|SmbHUHxaP`Hy3NX`D -:g& ->fHUHx\aP>HU/` HU-LHH/aPS-IL0N^NuNVH0*n -:g <:` <>(@` HUHTa6PS lL0N^NuNVH0*n -VgHU-VHH/aPHUHx a PNIl-@(m`HUHH/alPHTHm NP(@f(m`HUHH/a@PHTHUNP(@f>/.NIXmIB-JL0N^NuNVH ..*n -> f: -:g -: gHU/` f -:g~ -:gh  n g f  f8HUHx^aP f~?` -:g``@ -:g Am Zn HU /aPL N^NuNVH ..*n g,-RHHg -SHHg f -:gp`BL N^NuNVH0*n(n `HTHH/aPfL0N^NuNV nJ(g, (>//((NP n> nB(/.N XN^NuNVH0*n -Efp`.HxNX(@HxHUNPP*+l BB BL0N^NuNVH *nNIl.HUN XJg/NXB`Hy@NXBBB B-E/NIXL N^NuNVH *n ->fp`jNIl.` -EfHxHUNPJ g/NIX -Ef/. B/- U/( N.-@ U+h BB .L N^NuNVH ..*n J f4 mRR g f+| HUN XL N^NuNV . tf( . tg @tg @tg @tgp`pN^NuNV.0.  mp`0. "HAZZHABAЁ͠*@ ->f@HUNP,XB:J$g> ->f0>HxHUNP` ->gJy)gp`"HU0. H/-EH(T @ PNP*nN^NuNV.0. "HAZZHABAЁ͠*@HU-EH(X @ PNXHUNZPX*nN^NuNVH00. "HAZZHABAЁ͠*@0. "HAHABAЁ (@B  fj` y(P0(&mBg^ +g +g ( gp`Hx y(P0(&H/NlPHxHyvNP,gJf$ -> gp#`HxHUNP`^ o, n Jo"/HUN|X/N/PJl-| f HUN|XJg*`ZJ$g"/. HU-EH(\ @ PNP-@HmN XJ g //, NPB  .L0N^NuNV.0. "HAZZHABAЁ͠*@J$fp`/. HU-EH(` @ PNP*nN^NuNV. n0(8"HAHABAЁ *@ n (>f g+|/.a X*nN^NuNV n0(8"HAHABAЁ -@ @Jg* @ //(NP nB n ./N XN^NuNV.0.  mp`0. "HAZZHABAЁ͠*@J$gp`Z+|s$ ->g HUN X>0. "HAHABAЁ -@ @B nBB*nN^NuNV.0. "HAZZHABAЁ͠*@ ->gHx0-BH/NlP>HxHUNPPB$*nN^NuNV.0. "HAZZHABAЁ͠*@B ->fp`N0. "HAHABAЁ -@ @ gfJg(/. /(N/P-@Jf nBB`/. BN/P-@`$ n gp#`HxHmNPJg ->fJg. n Jo$/HmN|X/N/PJl-|-H @0H"-nJ ->@g>HmN XJ,g$ ->//-,NPB,> .*nN^NuNV.*n0-8"HAHABAЁ -@J f-| @` n n . HUaxX*nN^NuNV.0. "HAZZHABAЁ͠*@0. "HAHABAЁ -@ ->fp`NIl-@ . g gf/.NIXB`Jg ->f/.NIX` n-hg n whRf n` n!y(P` n  gJg-h g n whRf n`f n!y(P `V*nN^NuNV|H<0. "HAZZHABAЁ͠*@B0. "HAHABAЁ -@B ->fp` n Jg4$PJf4S n P n JlHy NX n Jf .`J dl *`pd.A(H/. Hx/HTN.-@Jf Ї&@`H n g* Ѫ n Ѩ n `HxHmNP n  gVJfHU/HTN HUBN4PHUN XB`HUHH/-EH(h @ PNPRdJ-Dg mHUN X -> gb Ѫ n Ѩ n Jf|p#L<|N^NuNVH00. "HAZZHABAЁ͠*@0. "HAHABAЁ (@0. H"HA((HABAЁ. @ tf . f~gl tpg" t gt tig.`z -Pfp` nJg`B` nJg `HxHUNPP` nJg``HmN|XJl0. H//./. HUNR-@Jl-| -QgRB-@ @gJg< `Jf@HUaX .L0N^NuNVH0*nNIl,Jn~BB+m` m.RSn: -S(@ (@BB((#(J9f>`P -fD(m X+@((#(J9gHyN XB9/NIX L0N^NuNVH8*n(n JoNIl.Jo|-LRSg\ mRSnz -S&@ &@B+m&(#(J9gHyN XB9/NIX `rBB+m/NIXB`X -ff&m X+@&(#(J9g4HyN XB9`L8N^NuNVH8*nNIl-@Jn D./.NIX `H -. l.J g(m&LǹdHH g. `R`L8N^NuNVH0*n.. NIl,JoJoJg -(@ -Sf-m`  -@ .-@mB X+@((#(J9gHyN XB9`r߭Jn2((#(J9gHyN XB9Jn B+mB/NIXL0N^NuNVH8*n NIl.&mgJl:(y(f/NIXp`f#(BA&H+K`2 f(A(H((g(T#(BA&H R+K/NIXBL8N^NuNVH8*n.. JnB`*NIl, n(hgJlf&y(g\#(BA(H n!L`6 f(A&H&(g"&S#(BA(HSJf n!L  nѐ/NIX L8N^NuNVH0*n(n JgRg f ,X` `BL0N^NuNVH0*nNIl,Jn~`S mHH.Sn0(m (@B+m((#(`d - fR -+@(m (@`(T f-LA +H(T((#( nB/NIX L0N^NuNV.` /. /a\P/.aX.l..N^NuNVH *n lp`"BHUaXAR m0.HL N^NuNVH *n NIl.J(f/NIXp`4=n BHUAHH/aPR m/NIXBL N^NuNVJ,fp`>/. 09,H/09,H"HA((HABAЁ. @ PNPN^NuNVJ,fp`>/. 09,H/09,H"HA((HABAЁ. @ PNPN^NuNVJ,fp`>/. 09,H/09,H"HA((HABAЁ. @ PNPN^NuNV tq fB,By, y(PBh&B`TJ,fp`H/././. 09,H/09,H"HA((HABAЁ. @ PNN^NuNVJ,f )B`>/. 09,H/09,H"HA((HABAЁ.( @ PNPN^NuNV. . tg0n t~gFn tvgn f~gp`Hx .N//.N B`Hx/. .N/`*nNIl-@ n (: f0- f t f/.NPZ` n (:2-g0-gf  //NP n-P-h-h . @"n"#h#hA . "@"#h#h` n :/.NnlX nUG nmH nmL nmM n:0-H n: n (: g>/.NRHX/.NIX`*n nG nhH nhL nhM n (:;@`N nJg n >`6 n>`&Hx .T`Hx/. .T` n rF n:` n: n r n:` n (:r n ` n  n1@B` n0(BH` t}g`` t gn tg`H t g~`: @tgn& @twgn tug` @t|gn` @ttgn @tg`*nN^NuNVH8*n(m .0b ,LFg2Hl/./,00- H/Hy,NHyXNX .0fJgJy)g*$, ,`Ԭ ,(", &@/+/+ NFPB( `*HyhHTaPHlHyyNP)BL8N^NuNVH<*n(m .0b" ,LFf .0b ,LFg6Hl/././,00- H/HyNHyNXJy)g*$, ,`Ԭ ,(", &@/./+ /* N ./ + Ю/NFPHRNX/./. HUa ` Hy 0HTaPHlHy ANP)BL<N^NuNVH8*n(mJg ,,",N". eB . ",N-@Hz :/./. /HUa\-@Jgl//-0- H/N &@fB/.HSa ``Jk&g.Hl/+p0+&/Hy iNHy NX `*Hy HTaPHlHy NP)BL8N^NuNV.*n -"-,N-@-mBB` ."-pAЈ @ "-lF®Ё @ l` ."-pAЈ @ "-lF®Ё @ (m0-n ."-pAЈ @ "-lF®Ё @-PR .,md -".N*nN^NuNVH  n*h ."-\NJg .SЮ @Jf l, n ("-N-@ -".NЭ8`X -"-,N-@ -R-@`< ."-pAЈ @ "-lF®Ё @ (m+n`R .,mB`4 ."-pAЈ @ "-lF®Ё @ (lR .oB` .SЮ @ Э8-@ .Xo" -X"-`".XҮ AАf`J@gZ -@"-DN"-N$ -|"HAHABAЁ" N"-8SЁ"-8N"-8NѮ .L N^NuNV.-n n*h/././. / nN-@Jg .`-|`T .Ѯ . ,m -, /.B/. /. nN-@Jf ."HAHABAЁ-@ .,m .T"-,N-@ -|`8/.B/. /. nN-@JfRR . ,fB R .,mB*nN^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @ ."( lB`< ."-T-@ -LF-@ .ЮS"-8N".n/- -". N$"-F® -NԀԭ -d/ n0( H/NH (@&l f UgHTNX`P'yw ."-N-@ ."-T-@`< .ЮrNAЈ @ .ЮrNrāgR .m-n`< .ЮrNAЈ @ .ЮrNrāgR -8".m ."-T".A4҈ AS .gA4 .R ."-T-@`f .ЮrNtF .ЮrNAЈ @S$S . "-pAЈ @ "-lF® Ё @S R .mR-HTNX .L8N^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @Jf .0fB`/- -". N$"-F® -NԀԭ -d/ n0( H/NH (@&l f Ug HTNX`Jf .0gx'yw .0f&/.HSHUa -@HTNX .` ."-T-@-@`A4 .JfR .8m .8fJgf/.HSHUa -@"-N-@..`, .ЇrNt .ЇrNAЈ @R8m -8.߫$߭ . "-pAЈ @ "-lF® Ё @ߨ R-A4 R`/./.HSHUa -@Jm2B`. .ЇrNtF .ЇrNAЈ @Rm .$ . . "-pAЈ @ "-lF® Ё @ . R-A4 .S .gA4 .RHTNX . "-NЮL8N^NuNVH0*n(n Jf -l(`8 -8SF ."-N-@"-`/HlHUN Jg -n` ."-|N"-N-@AT .JgJXf( -".N"-|SЁ"-|N-@`A .-H ."-|N"-N"-N-@.` Ю @JPn R m fB` Ю @JPnRm Ю @JPo ."-XN-@ ."-N"-|$-`N-@A\ .  Pf(Hm//.Hy NHy NXA\ . 0H. .Ї/HlHUN Jg .Ї"-`-@`zA`-@Jo <".nށ`Hm//.Hy!NHy!,NX/-8/.HTHUa -@JlB`)n( ."-`/HlHUN SS , "-pAЈ @ "-lF¬ Ё @S ."-|N"-N-@A .$ ."-|N"-N"-NԀ BSPAT .SR- , "-NЮL0N^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @Jg/- -". N$"-F® -NԀԭ -d/ n0( H/NH (@&l f UfxJ gz'ywJg ."-N-@rNAЈ @HH .rNrāf .rNt .rNAЈ @S S . "-pAЈ @ "-lF® Ё @SR- . @f0RR . "-pAЈ @ "-lF® Ё @RHTNX . "-NЮ`p-k0B`NR .mB .rNAЈ @HH .rNrāf 'n0`R .mHTNXBL8N^NuNVH<*n(m .0b ,LFg2Hl/./,00- H/Hy!NNHy!zNX . ",N-@/. HTNڌPJg/-/. Hy!N `/, ,".N$",F® ,NԀԬ ,d/0- H/NH $@&j f Ug HRN`'yw . ",N-@ .0f . ",`/HkHTN Jg.Hl/. 0- H/Hy!NHy!NX . ",`/HkHTN܎ RR .",pAЈ @ ",lF®Ё @R . ",|N",N.A $ . `\ . ",8N". -A rNAЈ @ .rNp8"<ā-BHxHk4/HTN .",T-@B` . ЇrNAЈ @ . ЇrNrāg2Hl . Ї/0- H/Hy!NHy!NX . ЇrNt . ЇrNAЈ @Rmh߫$߬ .",pAЈ @ ",lF®Ё @ߨ .rNAЈ @ .rNp8"<ā-BHxHk4/HTN .",`/HkHTN Jg ,8$ ,8 .",pAЈ @ ",lF®Ё @ ,8 RR .",pAЈ @ ",lF®Ё @R .",|N",N.A $ .",|N",N",NԀ BRPAT RR,HRNXLNHy"]NX . rNtF . rNAЈ @R R ."-pAЈ @ "-lF®Ё @R . @f0SS ."-pAЈ @ "-lF®Ё @SR-HSNXL8N^NuNVH0*n(n Jg ."-N` ,,rN-@ -^rN-@ -8rN".SЁr/ -8' @/AHP/.NJ-@JfZ .R-@B -8rN".SЁr/ -8' @/AHP/.NJ-@Jg .Ю-@)@, .P-@` .rNAЈ @ .rNp8"<ā-B -@ .$ @-P .$ @-PB`0 .䰮f .Ю`d .-@ .-@R -8".ܲo -8Ѯ .m>Hm/.Hy"wN Hy"NXpL0N^NuNV/. ./Hy"N N^NuNV.JfHy"NX/./. 0. H/a *@ f\ -oHy"NXHU0. H"HAHABAЁ- @ PNXR,HUa vX *nN^NuNVH0/. 0. H/aPJfx/./. 0. H/a *@ fT -oHy"NXHU0. H"HAHABAЁ- @ PNXR,Jg/.0. H/aPJf/./.0. H/a (@ g HTaX`T ,oHy"NXHT0. H"HAHABAЁ- @ PNXR,f/./. 0. H/a ` HUa X L0N^NuNVH *n. fR- -oHy"NXHU0-H"HAHABAЁ- @ PNX fHUa ~XHUaX` gL N^NuNVH *n fR-0-H"HAHABAЁ- @. gHUa` HUa,XL N^NuNV.*nHUaX*nN^NuNVH0*n @g HUN X 90@g0Hy0N X g g`;|NId.Jn&(|`(|Ȱ l !M+l )M +L`J f g(|0` g(|Ȱ`(|p l!M +l)M+L 7/NIXL0N^NuNVH0 . rN2. HЁr?N"HA HABAЁ(@*l`& -$ f0-n f fp` *mfBL0N^NuNV/. 0. H/atPJg/./. 0. H/a `BN^NuNVH0 e-|@ . rN2. HЁr?N"HA HABAЁ(@*l` -$ f0-n f fNId-@ g"@HxHUNP/.NIX`/.NIXNId-@ m!m m !m/.NIX/.HUaPJgR`*mfF0. H.mHy"NXa*@HUaX m!m m!m+l+L l!M)M;n +n $Bm/.HUaPJg L0N^NuNVH0a*@HUafX m!m m!m(|Ȱ+l+L l!M)M;|Bm/.HUaPJg L0N^NuNVH0*n . fp` . l6 gHUaXB` gvHy"NX`d mgT-m$ . "<NЮS-@ -$rN2-HЁr?N"HA HABAЁ-@ n(h`g0,mf fJg ,$n ,"<NЬ$oNId-@ g$@HxHTNP/.NIX`p/.NIXNId-@ l!l l !l/.NIX gHTap`HTaX(lf/. HUa PL0N^NuNVH$*n . "<Nr -@gl( - Ю/ -//98N `-mgx - Ю/ .//98N $@fj/./98NP$@gN/.HR/- N /- /./98N `/./98NP$@g+J falJfRf HUaPXB`+n+n pL$N^NuNV nJg /( /(/98N nB nBN^NuNVH0NId-@(|Ȱ` , f@0b/.NIX0fB`*l NId-@ m!m m !m/.NIX gHUa6X`p*HUa"X m!m m!m+y+| y!M#;|BmHUa XpL0N^NuNVH0` @HxHTNP/.NIXNId-@(|` , f@0b0g/.NIX*l NId-@ m!m m !m/.NIX gHUa `v* L0N^NuNV.*nNId-@`HxHUNP g/.NIXJ9)fHUaX)*nN^NuNV.*n gHy"NX  gHU m0N` gHUa`HUN X*nN^NuNV.-n ."<NЮS-@ . rN2. HЁr?N"HA HABAЁ-@ n*h`0-n f fJg -$n -"<NЭ$oNId-@ gh@HxHUNP/.NI`B/.NIXNId-@ m!m m !m/.NIXHUaX`2 f/.NIX*mf*nN^NuNVH0`\ n g 0. mflNId-@ m!m m !m/.NIXHUaX/.NIXNId-@(|0`*l ` f*m f@e/.NIXL0N^NuNV.*nB g0-H-@fp` .*nN^NuNVH0(|`$*l`0-n f*mf eL0N^NuNVH *nJ l)B`-mBwXBwl n -2"(P-@Jf l l lR n"(P"-2m n (0` n (HF2Ш4SL-@ n차0lJo/(0/HmN/./.HUN/AN ./HUN*-@Jfp` .R n"(0N+@2 n ($ n"(dAN". mB/.NX lAN . -P f Jg`\Jg . R n"(0N"-2l8Jgh n (HF2Ш4SL-@ (4ЮSL-@o//.HmN/. /. HUN//.HUN*`h . R n"(0N"-2l n (4ЮSL-@` n-h0/.HmN/. /. HUN/HUN -@Jg~ @ ($ n"(d-@p0-& @f /.N\` /.NXAN . mB l$AN . R  n"(d#wX . R l . T n"(P"-2m n (0` n (HF2Ш4SL#wl`B-|-n  -| n"(t .N-@ . m .䑮 SJnJghA~p-PJf g(BB/.HUN-@ n/(0/HUN -@Jg @ ($ n"(d-@/.N\XA~p mB`x n/(0 ."(d/0- H/NH -@ @ g/NX` n-h n"(t .N-@ . ".N n"(tN. Ю @-PJf f/.NX`Jf* lBB`/.//.HUN-@ n/(0/.HUN -@Jg @ ($ n"(d-@ mp0-& @f /.N\` /.NX Ю @ /.N` /.NXR o n (tSl* RЮ @  n"(d#wX n#0wl .L N^NuNVH8*n(n &m f+L +LB `r ,((lFJ g$ k (((l, k ,((m&HJ f)k 'L f.+L`(&k `J g k (((m ,((m&H`L8N^NuNVH *n=mP0.H.p0-& g `g8B`j2ep`^/. 0.H/ "HA((HABAЁ.`..d/. 0.H/ "HAHABAЁ-x @ PNPL N^NuNVH0*n.. fn mJ(g4p0-& g p0-& `g )`p0- g HUN&Xp0- g )`\Jy)fB`R09)m*g209)m,g$(|) g0-,Hg X)ep0-&f )pL0N^NuNV./.BHy0N *@g 09)m*f `aJfHUNXB*nN^NuNVJy)f y-p` )BN^NuNVH0*y0(|~?`()LPSl#A#+|"*+M.9o`&*+M y +y"A#SnBL0N^NuNVH<*n 0. H/N0XgHy"NX0. HЮr?N&@(S` .f0. l fp0,glHx HTNP`p0,gD$|H`& *f=R j*h -|`LeHy#NXJl f,-lg n!l""`#" l" BB"Rl l`(Tf,(yfHy#NZX)B`T-lg n!|"#BB"HTNIXHSHTNIP9n )M)n9|Rl B/-0 ."-N" -N$ ."-N"-F" -NԀԭ ."-N"-xN"-`Ԁ -d/0. H/NH -@ @ g(/NXHTNIX()LBHTaPX` n-h ."-xNѮ n <C&"Q/.NX L<N^NuNV.*np0-fHy#NXHUaXHUa X*nN^NuNV.*n m fmJm(n6BHUaPp0-&-@Bm&BNmB/./-HUN p0-FgBHywHywHUaRHUaXBmJg y +y"`#+|"BA#Sm *nN^NuNVH8*n&mp0-Fg2J+f*/+0 -"+N" +N$ -"+N"+F" +NԀԫ -"+N"+xN"+`Ԁ +d/0- H/NH (@ g HTN`p0-g n +P6p0-g n+P>p0-@g+ywFm -"+xNЬ -@A&"n <"QJg HTN\`HTNXL8N^NuNV(H0 n (2 cP*h . Э0S"-PS,  -@t-@ -t"N".-A n <(CJ"Q2-|FA .FJl( .~".FЁ @BA .F SFJFl~ ` .N"Ё @BSn n!n 2 nhBHxHywHyw/.aAJ(H-|FA~ .F-PJgR/.FA .F//.HTa*A .FJl"A~ .FB/-0/.HTNr A .FJlVSFJFl|~ `jAN -PJgTAN B l R"-P",2m -0` -HF2Э4SL*//.HTNr SnJmAN -PJg l R"-P",2m -0` -HF2Э4SL-@@)n 2 l R"-P",2m -0` -HF2Э4SL-@0(XP2(bJ#4g0 hb /aXJgHy#8HTaP .ѹ-` g n0(-@Jg0(XPJox .İm -|-y- n0(`JJfH .Ѯ f-y- .䰮m$-| n0(й-䐮-@ nJg40(y.f(0(/ P/Hy.N Jg-y- n0(ѹ-0(Ѯ 9-䰮m  fhJfbJl(gZHxHTNPJf@JfB-`#-#-lBg HRNX/.NX#/B` n0(XЮP2c4Hy#FHTaP n0(XЮP)@2lB n0(XP/Hy. /N HRNX  fJfHxHTNPJf>#/ 9-fB-` 9-䐮#-Jg ,. fRl `/9. HS0, H/N (@f/9/N` 9..f" 9..fJ9.f,f:#.  f*Jg"JfHxHTNPJg`b . f f-| l ."HAHABAЁJ @Jgh ."HAHABAЁH @0l fBHTNX ."HAHABAЁN @(PHTNȮXRl &lU`NR`f#/ ,. f )`/9. HS0, H/N (@g`\-LHxHy#WHy.N Jfp/.NX/9. HS0, H/N (@fP/.NXg HRNXg HTNX/.NX` ,. ffRl &lp0,& f8Jf /f*HUNNXR-@ ,2Ю dR oB>)`P/9. HS0, H/N (@/.NXfn`/. n ( Ь2/HUN BHxB/,2 n/( HTBN(h)J9)f n*h HTNX /f:/.NX`R /g(y,Ĺf(y|HTNȮXRl `(nHTNȮX&l` /g/.NXJg"#/`$R /g/.NX`/.NX L<N^NuNV/. /9- n/( (/Hy#ZNN^NuNVH *nB`AJfp`Rp0-eAHHL N^NuNVH0B n#. -p09.XP-@J-fV 9-gHy#NX3.BHx/9-/.Hy. /9/HxN(h-@` 9-й- y/2c 9-й-!@2Hn/9-/9/az -@Jf/9/NX9)HH`B*np0-XP-@p0--@p0--@`d .Ю(@Jg;n Ю*@` .Ѯp0,XP-@p0,Ѯp0,Ѯ/.HUHTN .-eJf, .Ю찮dHy#NX .Ю3.`. .lHy#NX3.;n Ю*@/.HUHy. N /.N\X y/hB/9/NX .L0N^NuNVH0*y/J-f>B. BHx/9-p09.XP/Hy. HUHxN(h`HHn 9-䐹-/HUa (@fB` n09.hHTN\XmBpL0N^NuNV n #. BHx/9-p09.XP/Hy. /.HxN(h)/.NXN^NuNVH0 n*h . "-P-@ -HF -@ l .R"-P n"(2m -0` n (2"-HFЭ4SL-@//.B/./.N"-d-@J9)f `HTNXB`@/./. n0( H/NH (@ fJg , Ю n L0N^NuNVH0*nA(HB`HnHx/HxHTHUBN(h-@ <-@Jf" mp0,XP".dB`6Jg ,.f lg lf ,. fp0,ހ2mrpL0N^NuNVH0J#gaJwpfRwp(|H`rJgf Tg` l-h nJ(gLJ(g( ./Hy#NPHy#NX nB( n!yw HTNIXe*y0`Hp0-f4Jm g.mRm BHywHywHUNHUNXteBwpHxNpXL0N^NuNVH0*n(m ,0SЭ2",0N-@B`rHx/.HUN ",d-@ l .R",P"-2m ,0` ,HF2Ь4SL//.0- H/N R .mL0N^NuNVH n (8' @ Ю @-@ . -@ z`p n (8rN"ҀpgP $ @. $ @,(`& . f Ю @ .ѐ؅R n8oR n8mLN^NuNV.*n . $e&/. Hy#NPHy#HUNPp`B*nN^NuNV n (8S b@0;Nj,` . Ю @ fp` .rA .Ю @r.r.g` .rA .Ю @r.r.fL` .rA .Ю @r.r.f`FHy#NXBN^NuNV n (8S b~@0;N\Bt ttt`p . Ю @B`b .rF .Ю @`@ .rF .` .rF .`Hy#NXN^NuNV n (8S bz@0;NZBp"ppp`l . Ю @`\ .r .Ю @`< .r .` .r .`Hy$NXN^NuNVH0*|H`TJgH0n f@ m(h T\g*Hl0. H/Hy$ N Hy$"NX `4e0. H/Hy$3NPHy$?NXBL0N^NuNV.0. y2 fp`2*|H` 0n f HrN`ep*nN^NuNVH0*|0B`BBA .BR oNId-@(m `$ ,"<NAЈ @RR(l f/.NIX/. .# @/Hy$aN BA .Jg(A ./ .r /Hy$nN R oHy$vNX@R0e L0N^NuNVHy,a"XN^NuNVNLJg Hy,aXN^NuNVH0*nHxBHy0N (@gTp0,& @g)HTNX`,Hx@HTNPJfHTNXJg /NX*L0N^NuNVH0-|(y)x ,R-@g .f )` .gLHxHxHy0N *@fBJ9)fT , /atX*@B`HxBHy0N *@g/./.HUa L0N^NuNVH0(y)xHxHxHy0N *@f,J9)f4 , /aX*@gBHx`HxHxHUa L0N^NuNVH0*n.. Jg` gHxHUNPJf8 g:HxHUNPJfp0-& @f)HUN`B g0HUNX/BHUN# -@HUNȮXJ9)f g BHUNPHUNXNȢ(@Jg\ 89|-y))M/HUNXP)J9)f ., @` .,\ @BSlHUNXL0N^NuNVH0(y)xNLJg*BHxHy0N *@g )`.J9)f0/,aX*@gJg +lNmFHUNXL0N^NuNVH8&y)xHxBHy0N *@gp0-& @fNLJf HUN`Rm(m@HxHywHywHUNHUNX#.BHxHy0N (@g)HTNX`B-mFBp0-& `f -|`(p0-& f -| ` m-h0B-n-nHx-mFp0-& `f -|`(p0-& f -| ` m-h0Hx$/. HnN )*nN^NuNVBHxa(PJgHxHxaPJfHy'4NXN^NuNVH ..-GNId-@/./90NP-@/.NIXJfB`$ .r *@B/9/. . @/N0JJf0NId-@/././90N /.NIX`/.HU . @/NwD . JgT g `NId-@B`B*t#tRytRm0yt/.NIX` r "<N,JoB;| RytRytHUaXS`L N^NuNVN^NuNVBHxaxPJgp`BN^NuNV.NId-@*ytgBJm gHy';NX;n Syt . t @RP#tB+| `/. /.a,P*@/.NIX *nN^NuNV./. /.ajP*@fB`Hxp Э/NFP *nN^NuNV.NId-@ nJh fHy'@NX n0( Ht @SP nBh n c< (Ј*@ r s @Sf*t#tRyt n*P t nB nB|#tRyt/.NIX *nN^NuNV.aDJf RytB`xNId-@*ytgBJm gHy'FNX;n Syt . t @RP#tB+| `Hy'KNX/.NIX *nN^NuNVH0*ngNId.NId-@Jm fHy'RNX0- Ht @SPBm c< Э(@ r s @Sf(t#tRyt(U*tBB|#tRyt/.NIX*LfT/NIXL0N^NuNVH8*n..JgJ mJlHy'XNX0- H-@`0fHy'_NX0-H". m0-H *UJ nA&HBJof ;gHy'fNX .`*NId-@(ytgBJl gHy'mNX9n Syt .t @RP#tB)| `/.HxaP(@/.NIX&g0-H l ` 0-H 9@ |c. Э-@Ю )@ .r s @R`&0,H/ Ь/ ЭЮ /N ;g0,HB *U&L`/.aZXBL8N^NuNVH0*n(n `*UJf`d |d0-HЭ2,HЁ |c*`D0,H/ Э2-HЁ/ Ь/N 0,mHTajX(@fL0N^NuNVH0.. *ngzJl D.JolJmf<`d0-HBm*UgNJoJ0-Ho0m߭`4Jmg (M*Uf0,Hn0,HBl*n`0lL0N^NuNVH0(n p n0NId-@*ytgDJm gHy'rNX;l Syt0, Ht @RP#tB+| `0, H/BaP*@/.NIXgBm0-Hrp l 0-Hrp`". -A0,Ho 0,H-@/. Э2-HЁ/ Ь/N . 0.m .Ѭ0.lJlfHTaX(@fjJ gHUatXHTaXB`* L0N^NuNV n "n"i#h n"n "i#h n1|: n1| > nh" n Bh$ n Bh( n hpN^NuNVH0Jg/./.N!`/./.N!LP*@fp+`0Hgp)`~HxHxNPP-@Jfp7`b n (Ј(@9|Bl8Jy)f9|)M BBBHT mN-@JglHTaX .` n BL0N^NuNVNI-@/. BHx/. n h hN-@/.NIX .N^NuNVNI-@BBHx/. n h hN-@Jg/.NIX .`\ nJf!H n!H nhJ lB  l . `p n1@ nh /.NIXBN^NuNV nJg:B/NPJf"Hx/.NPJfHy(NX nB nJfF0(g: 8/NX ."/NX ./NXN^NuNV.*nNI-@0-f `&/-a4X -g `/-a X -fJgJ gm0-g0-f,BHUaP-@JgJ fb/.NIX .`0-gB0-g0-g J fp$`0-gHxHmNNP`Jg(BBHxHU m hN-@J fJfr0-gHy("NXmHUa"X/.NIXB*nN^NuNVBBHx /. n h hN-@N^NuNVHx n0(g -|%`$/. BHx/. n h hN-@/.NIX .N^NuNVH<*nBA&HB0-f m 0(g n0-:H"(op(`H .g 0-f m 0(gp`B-@`mLHxHmLNP0-LfmLR-NI-@0-gdHx /9(PNP-| /.NIXmL0-LgmLHmLN XJg /.NX .`lJmPgp0-P-@BmP`0-f. m 0(g -|9`zJ f -|'`hJgZJgm/. /. .gp`p /HU m hN-@JgmBJfA&H nJg .gT-|/.NIX nJoJo$PJfP nS nJlHy(FN`0-:H2-8H2->H4-H2-H4-H2-H4-H2- n"H3h&( n0($H2("Hm: n"H3h"$Hm8N`Hy(N` n0H g f0Jg& nJf/./.aP-@Jg`n nJf -|9`X n h*P0-$H2-"H2-(H4-&H’l 0-$H2-"` 0-(H2-&HJo/. n (Ј/Hm"N Jg/.a` nJfHy(NX n h*P/.Hm"NP0-&H2-(H nh>;m&(0-"H2-$H nh:;m"$Hm"`Hy(`Hx5/.a6P`P-|-`DHy(`|L N^NuNVH0/9(/9(/.N6 -@Jf2HxBNPP*@fp7` Э(@ n!L(BL0N^NuNV.*nJg/-NXBJgHUaX`Hx6/- anPJ f/NzX UB/-NX /NX*nN^NuNV. n (Ј-@T#. nB(HxHxHyN *@gHUNXp0``9)HH-@f`9)HH-@B9) .`4HyNX*@g n+P n!MHUNXB*nN^NuNVH0 n (Ј*@ n-hA#.B-HxBHyN (@fD9)HH-@B9)`&-|&`-|=`-|)HTNX .`p0,& f-lJg n"n0Qf I0H g` f n"n#h n-h n"n#h  n!n /.NxX/.NxXHTNXB`t n0(g0/NX-@g @-h n!n n!nHy;B/. N n!@`zHy(NX`hL0N^NuNV. n*hgB n/NzX n P0H g\ fb - f n+h `4*m `*mfHy(NX -f n+h nB`B/NzX*nN^NuNV/.ahXN^NuNVN^NuNV n P1nP/.a"XN^NuNVN^NuNVH8*n(n -o&M..*L-n (K-G -UBHU/.aB Jg"BHT/. a0 JfHxHU/.a  )B`pL8N^NuNVH0..*n ,9oBA(H-U-m .`A mHy)NXmL//9NP(Jf0*HxHU .V/a~ JfHy)NXB`^ݭ`(Jg m Jg///9N Bچol H@H@B@܀XmBm<*pL0N^NuNVH 9o"HA HABAЁ n"(4偲oB`*nB`J n (4倐.oo.9o//9NP*f/./.a|P` 9oѮ n (4".m n(F g@ (4"<N//9NP n!@0 nJ0f/(4`pL N^NuNVH . -@ *nB`8 . .oo.9o///9N B 9oѮ . m n(F gXS fY`JX`DL N^NuNVH0*n.. ,. . , fJo "9oN"9o-A o-FB092 H/BB .r / Vr / "9oNЭV @$ "9oNԀ/HUN~0 VЭZ(@ .V/HTN-HP mVh@ޮ`@ fp`B/Hn/.//a f ЮVS"<`"-6 VҀ-AB092 H/BB .r / .r //.HUN~0 f(0-4Hr ЭZ"ҮVS偐` -6ЭZ"VЁ(@ .V/HTN-HPBޮJfL0N^NuNVH0..,. *n*9o .P(@JmJm І no.Hy)%NX`ol H@H@B@ڀXl Ѕw8oHy),NX //NP+@Jg Э"`"Ҕ*L0N^NuNVH *n . 6d< . -@"9oNЭV @$ ."9oNԀ `h <>". eHxHn/.Hx </`,BHn/.Hx -6". /a .L N^NuNVH *nJ o . wtoHy)8NX`r 9x+ l* 9 /N X`HxHyxNPJxg/9x/. NP./././HUaH J n 9x+ l 9 /N XpL N^NuNVH8*n.. rNJgHy)ENXBBJof0-@gp0-@R"HA HABAЁй(@R,g,gB " Ҁ AxR mJgHx/.HSa, BXS`\SB " Ҁ AxR m, @fHUp0,/p0, @"HAJJHABAЁй/Na `n,fJf&MR`xgfNgFp0@-@ lHy)NNXB l " Ҁ AxR`JgHx/.HSa* .L8N^NuNVH .R"HA HABAЁй @p0@. .R"HA HABAЁй @ , "HA HABAЁй @P @爁P "HA HABAЁй @? 툁 .R"HA HABAЁй @ 9x+l 9 /N XSxLN^NuNVH<*n . rNJgHy)]NXNId-@ . xo/.NIXB`-n `v yp0@-@"HA HABAЁй(@Sxp0@-@ yP@爁P ."HA HABAЁй @?,fHy)dNX .Sйа0. H/NXr-fp0-@" A0`(Mp0,@"HA HABAЁй*@@fHy)NX - f0. H/NXr-fp0-@l@爁l/. 0. H/a>PJgHy)NX-m/.NIXL0N^NuNV. .  @0 й*@NId-@`^ - f$0. H/NXr-f `R m/.NIXL0N^NuNVH ## < 9<#x 9@r N#4xl#x~`~ S"HA HABAЁй @P @爁P "HA HABAЁй*@ S?툁-?-Rxoz 9x"HA HABAЁй @PB  @06R m y 9x?툁 y(?#xBwL N^NuNV/.aX/.a^XN^NuNV. .R"HA HABAЁй*@`HxHUNP-f*nN^NuNV. .R"HA HABAЁй*@-fHy)NX-g HUN X*nN^NuNVH .r .//9(PNxHP*@ .Ю r ,`4gp0-@/aX`Hx r /N@dPXRSJnL N^NuNVH .r //9(PNxHP*@ .Ю r .`&p0-@/aX fXSJnL N^NuNVH8Rs .r .-G*y(P 6d -|` <>e -|`-|/HUNxHP(@f df0,@g fp0,@R"HA HABAЁй @(gZHx/-VNP/HUNxHP(@gJ gp0,@/N>XHx/HTN Rs\`NId-@p0,@R"HA HABAЁй @(g.p0,@/N/&XRs f mVRh@/.NIX,g fHT //-VNa R,Rs`J gp0,@/N>XHx/HTN`RB`f:-|Hy*8Hy)/HUN+-@-@-@=y2 `p0@-@ -@Hy*8Hy)/HUN+-@ oHy*NX f*JVfHy*!NX mV h<=h -n`T f=y2 -n`: .,\ @JfHy*1NX .,\ @ P&h=k -|-T f gJ*fNId-@/.0.H/N;P-@Jg @p( f n(g n(fHy*BNX mVRh@ .␹r NSй-@/N/&XB(Rp.爁XR mY n n n(f n(gHy*ONX n np0("gHy*cNX -VrJN nh @h 0.y2 fRsd`RshRs`R,0.y2 g:/.092 H/N;P-@Jg/.092 H/N:P/.NIX`/.NIX xm /.HUHxHTN0Jp.爁p0,@-@R"HA HABAЁй @ f\ mVRh@HT //-VNa `X nRh2B/9+,HnBHT n (6Ю //.a@-@Hy*8Hy)//.N+-@p0,@/092 H/Hx B .r / .r //./.N~0 `(-f nSBBHxHTN5< RsRR .mTL0N^NuNVH< 9<R-@NIdJg NazHx 9 /NPNIBBN 9@l 9x+l 9w"HA HABAЁй&@+f+fp+ bX@0;Np0+ @"HAJJHABAЁй(@*l8p0+-@p0+ЭZ$@p0*@"9wSҹаgHy*NXgZ*g+ @fHR ./HTNa - fJ* f -BFo+ @g-HH"9+ -Bl`p0+ @"HAHABAЁй*@`*m^ - @f(mV+ f8 -6r2+Ё-@ -6ЭZr2+Ё`p0+"<-A0-4Hr ЭZr2+剐`f0*@g*g 9+rN".nR - fNIdJgaJf4@Hx 9 /NPNIN`^NI 9wSй/N>XHyHyHUNv + @f RlHHR ./HTNa `Rm2B/9+,HnBHR/.HUa-@JfHy*NXHy8Hy/.HUN+-@ p0*@/092 H/Hx B .r / .r //.HUN~0 `<+f+ @fSl@`SBBHxHRN5< RsBRsR@Rw 9wmBwRs nzR`NVH<`# /.NIX+m8 0->H/0-H//9$N - r / 9 /NxHP-@BB` np0(@-@/N?X .R"HA HABAЁй$@ .4g*fR`hRp* bZ@0;NxxHy*NXp0* @"HAJJHABAЁй&@SkHJkHf HkHN X*fp* ff k8 (Z`Pp0* @"HAHABAЁй(@`(l^ , @fSl2Jl2fHl2` ,6ЬZr2*Ё`0 g f$0,4Hr ЬZr2*剐-@ nf2* @fSk@`SBBHx/.N5< RsXm0 gHy*NXB+y # 9@gHyN XNId-@*yf@/NIXL". e-| <-@-m>`| . "-6遰e@ <>". d.-| -6". -A-m:` -| . -@ mV-h4 .S-@(n-n -@SmX fX`Y f. f$JgY/.092 H/N;PJf/.HTaZPJf .S-@(n .Юo .".-A`-n-n -nR .찮lX fY`X f. f$JgX/.092 H/N;PJf/.HTaPJf .쐮S-@Юg(n f .候 .` .候 .䑮 .ЮR n fS n S`S n S @R-n B`gJfFp0,@/N>X fHT . //-VNa `-T/.HUHxHTN0JJfHy*NXp.爁p0,@-@АR"HA HABAЁй @ f mVRh@`RRBXR R nm .L0N^NuNVH0*nJ fjgB`r0-@gp0-@R"HA HABAЁй(@,f,ff0-@g-f`f0-@fpL0N^NuNVB(<#(<#(D y(P!n6#)Hx/.aJPB/. a>PN^NuNV.*y(PN/-: -6ЭZ/N-HPB/->0-4Hr ЭZ"->S偐/N-HPBJBgHy*NXBJ`HxHm2NPJm2fHxHy)BN%B HxHy*8BN%B B6B:B>B)B)B)*nN^NuNVH<*n(n &n$n)m66%l6B6'm6)m::%l:B:'m:)m>>%l>B>'m>)mJJBJ)mBBBB9m22Bm2)mVVHTHUN`PBVA <C"Q |~ <C"QA8 <C8"Q |~ <C8"Q%kLLBLA <C"QHxHHkNFPA <C"QHxHHkNFP/.HRHSHTHUNbL<N^NuNVH<*y(PJg .rNJgHy*NX-y)-y)J f0 -6Э:-@ .ѭ: .ѹ)`$ .ѭ> ->S"<-A .ѹ) 9(<й(8&@ 9(Dй(@$@ ".o4/./. ". "<N/Nf 9(<-@ 9(D-@J f .й(8JoB`".Ё` .й(@Jo".`B偐(@Jl .D/HTN-HPBJ f .Ю#(<` .#(D-|xJl .D-@`nn@ .ѹs|-L-n`A(XSl/././.N L<N^NuNV.*n`R9w0Hx/9$NPHy,pHUN_PJg y(P/(NKXHy(HyxHyHy,pHUNdp#+xLHy{NXJgp`.J g> 9(<`#x<#xDHyHyxHy(HU/9(Pa`HxHHy|NFPHxHHy}NFP |* <Cy"Q |* <Cz8"QB{LJVg mVR(DHUNXHx/-: -6/ -6ЭZ/HUaPHx/-> ->S"</0-4Hr ЭZ"->S偐/HUaB*nN^NuNVH0*n ..,.//9(PNxHP(@`SgRB l*XXR`X/./.HxHUN,p nRBB " Ҁ Ap0(@/ Ѕr /NP " Ҁ A@R mRp0-@/N?XXJf^ n L0N^NuNVH *nJm4fHy*NX0-4H//9$NP.JfB`BHU0-4H/ / n NJf/0-4H//9$N ` r +@Z0-4Hr WЭZ+@0-4H//-Z /NwD B`" І @p0@/NPXR0-4HmpL N^NuNVH8 n*hVg &hZ(m8g -4/HS/,ZN `-|`-Fgnn@B` A&XR4m-F gd-Fg$/-4Hx/-"<NVL N^NuNVH8*n(n&nBHUHx/- n NJfB`B Э @ " Ҁ"A" Э @R mB/-NPHxHSHTNwD JgHxHS/.N 'MP`^B092 H/HxHxHxB/-NHUN~0 +䰭6f +谭:f +찭>f +PgHy*NX'mZ80-4Hr ЭZ '@@0-4H'@HpL8N^NuNV n/(N/. /ahP//9N N^NuNV/. /.a>P//9NP n!@N n (NN^NuNVH *nJ g(B092 H/HxBHxB/-NHUN~0 B Э @C "R mHxHnN-HPL N^NuNVH0.. <(D( 9(8"<N&-y(HJo rNJgHy*NX .Ї//9$NP-@g` "<N* .-@B/9(P/ .Ю/N0JJfF/. .Ї//9$N y(P/(NKXHy+NXJg`/.//.a / Ю/ .ЮЇ/a .Ю, *@ " Ҁ(A`DHyHxp0-@/ /HUNLp0-@/NPXXRe 9(Dй(@*@ .ЮЇr "9(DЁ(@ Юr ,`(XXSJfNI\-@ .r  y(P!@Z y(P#Z(8 .ЮЇr #(@#(@߹(H0 y(Ph4 y(P0(4Hr W y(PШZ!@/.NIXJgv/. /NP//./9$N `F/./. /9(PNr JfHxHyvNP`n y(P NJL0N^NuNVH0..,. *@ . (@`8 /Hxp0,@/ /HUNLXXRSJfL0N^NuNVJ+f 9<rN#+J+ fB#2+ 9<rN"9+ o 9<rN#+ J+f6#+ 9+ rN"9+o 9+ rN#+J+f #(+ vf$ 9wTr ?oHxHy+`NPJ+f 9<"<N#+ +l #+ vm& 9+"HAHABAЁrN#+J+f 9+#+N^NuNVH<Bw|BBJ9w0f^/9+/-:HUNr ` f>NIdJw|gBw|BHyv`R9wbBHywbNPNI`B-| 9*rN".o-|-|-lJJVg lVJ(Ef 0(BHѮ/9+/.NP-@".N"9xHo2 .ѹHHTNXJf/9H/.NPH&LB +4o # +4 +4l #+4BB۰*y`\ -  fB -g8g2JVg mV(Ff-HH*o< -f - n -f$-HH".l(M-HH-@`Jf -g -f-mBJVg mV0(@H(EHHNѮ .ذ+4l""HA HABAЁ0-@R`-y۰ n (nF#۰$|ۨ` j .m$HJf n!j%n n!n n DeJfH-|$y۰`.*R-HH-HHЁ-@m(M-@$jfJf$JgfJg .*oNId ,f HTNJ~XNIJgF-lBJVg lV0(@H(EHHNѮ/9+/.NP-@ѹH`B/,>/,:HTNr JfT/9H/.NPH`8NIdR9vBHyv`VNVH8 9+rN"9+NrN/ 9Hr N/NP//9HNPH 9йxrN# 94"HAHABAЁйxrN#4*|s0(|&|` ЕrN( ѓBXXXsc 9wrNJfѹ 0-Dy-HHS b@0;N - nR - gRy`J - g( - nRy`.-HH*lRy`-HH*lRy-HH*m `6R - gRy`Ry -:Э>ѹ0-DyDe 9ѹ 9ѹ09y09 y3"/.Hyva PL0N^NuNVH *nB +@ @/(/ 9+X"9+\N.// . NN// " Ҁ A/(/ +@ @ "(NN6$& ւ C !AR m|L N^NuNVH8*n(n&n BB Э @p0(@k@kXR mHxHT/. a L8N^NuNVH0*n (n..`2HyHx ?/ r /HTNLXSJfL0N^NuNVH0*n(n -6ЭZd@ Z`. -6ЭZeJ -6"-6ҭZ$ Ђ`F0-4Hr ЭZ"->偐c0-4Hr ЭZ"< L0N^NuNVH *n.. 6d ЭZ`r "-6遰e6 <>d( -6ЭZ"-6$Ђ`"0-4Hr ЭZ"<偐L N^NuNVH8*n(n .Ю-@&l +0"<N-@` .".N.BHx .".N/HTN"+d-@` . U@鈁UJ9)fJlUU@Rs|`* r "<NЮRsx|` " Ҁ A R mXR .g Rml .m L8N^NuNV.*n09v°ywdf$ -"<N-@ -$Юw8oHUN` vo -$"9oN-@Юon -$"9oN-@"9vN"HA HABAЁp @=P ."9vN-@"9oNЮ+@$`=yp;nJnfHy+NXHU0.H"HAHABAЁ- @ PNX*nN^NuNV/. HyHx0. H/Hy۸HzNN^NuNV/. HyB0. H/Hy۸HzbNN^NuNVH0HxBHy0N *@gp0-& `g)HUNX`x=mPHUNX0.H.m )`H(|p `40nf&Jg )`( pr N/a` JTf)L0N^NuNVH ."HA HABAЁp @=PHx0.H/0.H"HAHABAЁ-x @ PNP ."HA HABAЁp @  ."HA HABAЁp @(B` , ."9oN$ "9vNԀ.w8mHy+NXoo,9oJfl3pw`HxHy+Hx rNY//9N/9Hy+ rN/ rN//9N`///9N ڹom$LN^NuNVH8NId-@`@HxHyNPJg*y# /.NIX .*`f4 f .r ѹ` .r ѹ+n, . g -@ y (z"(VЁ".Ё(@ .r //.NxHP&@B`*0+@ggHy+NX(XXe y (VЮr +@ +|0+n$4`+n `+nHUaX.-+n $;n"B0."H"HAHABAЁ- @/HUNb . gdHy+N`߭  g, .fJfHy+NXB/.a P "<NѮ Jn*NId-@ǧ+y # 9@g.HyN X 9 /N X/.NIXL8N^NuNVH *n gHy+NXNId.+y RsP -"<NѹsX# 9@g 9 /N X/NIXL N^NuNV n0((H/Hy+NPJ g -|+`-|,/.NX/. n0((H/Hy,)N Hx /.NP n@ N^NuNVH0*n n(PB nJfB` fB`p//,/N Jfp`pNId-@`@HxHUNP f/.NIXBm+y(P,+T Jo .*;n n ("<N+@$+lHU nNX.- y(P /-m /.N?nPHx/.HUNb NId/.//.N? y(P @g HUN X/.NIX(߭  n nߨJ(f gHUN$X-@J(fJg .` nP nS`XL0N^NuNV n o!|N^NuNVH0*n(mVg HTN~X ->Э:Э6"<N;@4Hy0JHUN_PJg.BHyHyHy0JHUNdpJf"HUNb6Xg HTNXB`HxHyHUat B  @p0@"ҭ Ar2(AgHy,@NXR mHyHUNePgHUNXHTNXBBNId, -f HUNJ0X - g#+L /NIXB-R+0RspL0N^NuNVH8*n-|-|(|&| 9g" 9f-|(|&|NId.` .BHTNP 9f ./NIXHSHTHUNv HSHUNePJfHy,GHUNxPB`PR'n D'nH HUNXJVg" mV (Ef"H3h@BHU/-VNP+mBJHk/. BHx -6ЭZ/HUN'Hk8/.BHx0-4Hr ЭZ/HUN'JBgHy,ONXBHSHUa NIdHxHUNfP - g -f(PgHy,^NX HUNb6X B-S+0RsJ9wbgB9wbHywbN X .F 9g .FHTN XJf4NId. (Pg -f HUNJ0X/NIX .L8N^NuNVH8*n(n -6Э:Э>"<N. -6"<N,0-4HfR 0-4Hr  `Z0-4HlR(`R$ ,H"<N*0-4HlJDg ,HVg -6ЬD"<N-@ ,HV"<N-@JgJg~ .Ю nnR, -6ЬD"<N-@ ./ .r 㠐ЭZ/0-4Hr ЭZ",HS偐/N SJg( r /0-4H/ /HU/.aJDg4 -6ЬD"<Nr //BHU/.aB`: -6ЭZ"Ё&@f 0+@f+gHy,fNXRDmB`F0-4Hr ЭZ"偐&@f 0+@f+gHy,mNXRHmL8N^NuNVJoNB092 H/Hx/./. .r n ШZ/ (N ".Ё//. N~0 N^NuNVH0 y(P*hVgHUaX(mP-FB<`-F/9(PHUabP y(PBVL0N^NuNVH8*nJ-g(y`f&LJd`JPlHTNXL0N^NuNVH0*n(mVgHUN`X+l8^)M8R,EL0N^NuNVH8*n(mVg@ ,8f)m^8`'m^^B^`$&l8` +^g&@J^fHy,NXL8N^NuNV. n *hVg/.aX n !m8^+n 8*nN^NuNV#@aNߜB@N^NuNVH0HyHy0JN7P-@JfHy,NX(|h`"-l n-hJf .X @-PgB e n ( r //9$NP-@fHy,NX .r -@Hy n ( r / .r / .r / ./NL` .Ю @JfZ .-@0,H//. n PNP-@Jf6Jg(/. n ( r //9$N B`/.Jg <,` <,/0,H/ n/(,Hy,N-l Jo m/.Hy,NPJg`f/.Hy-NP/./.aPJg` .ЮЮ @Sl9|)|)n nJ0g (02,HЁ @ *|l~` fJmf0-lg m?f/.HU n hNPJg;|;l+|(+n Jmg Ll;yNRL`;|+L$ nJ(g ((2-HЁ @ 0-H/0,H/ n/(,0-H//($Hy- N nJg HU hNX,Jff-Tf*|l~`Jmfv mfl-m n-hJf .X @-PgD n0(4-@BJg -n` e n ( r //9$NP-@fHy-!NX .r -@Hy n ( r / .r / .r / ./NL` .Ю @JfZ .-@0-H//. n PNP-@Jf6Jg(/. n ( r //9$N B`/.Jg <-M`Jg <-R` <-X/0-H/ n/($Hy->N-mJo m/.Hy-]NPJg`X/.Hy-pNP/./.aPJf Jg` .ЮЮ @Sl+|(;|+n ;| nJ(g ((2-HЁ @ nJg HU hNX,-UfxHy/.N8PL0N^NuNVH8*n . @(P` g0&L(l6fB6f . @ `'M6L8N^NuNV#Dx <"9oN3C33 "3 333"N^NuNV#wN^NuNVN^NuNVsN^NuNV.*|pB4+|$ ->fF y 8 HUNP,X+| :| HmHG+|>HxBHzN ->g Jy)gp`"HU0. H/-EH(T @ PNP*nN^NuNVHyp9ݵH(X @ PNXHypNZPXN^NuNV/. Hyp9ݵH(\ @ PNPN^NuNV/. Hyp9ݵH(` @ PNPN^NuNVH *|p ->gNIl,`HU/-EH(h @ PNP y N. f -> gB g6/9 y NXJf">HU-EH(t @ PNX/NIXHxBHzLN L N^NuNVH *nB ->!fTJgL y ,Jf ># f m  maB`4-H @0H"-os` 9orN/BHzN `JoHmN|X. g~ -: fr /HUHyRN >`l ->@g>HmN XJ,gh ->//-,NPB,>`B/ y NXJgR >#-H @0H"-otL N^NuNVH0*|p~(|B`H -: gB`HxHmN~P.Jg( Ї n/HTHmN} ܇JnJo4(|`R e/9 T/Hy y \N Jf4HmN|X. /HUHyRN >`Jo sNIl-@>-H @0H"-nJ ->@g>HmN XJ,g$ ->//-,NPB,>/.NIXL0N^NuNVH0*|p/././. HU-EH(d @ PN-@Jm .`/././. HUNR-@Jl . kg kgp`^ n"y 8"B`N(|HxHy n/N Jgp`& є Ѭ Ѭ Ѭ Ѭ y @ `L0N^NuNV  mp`& y T Ю  @0?-@N^NuNVH..NI\, fHx y NX/ y NX/NIXLN^NuNV. y N. g ..N^NuNV y T-PHx .p/N>P .p/NXN^NuNVH *n . r".ЁЮ,BA 0rA"2(Ё*f `mJm R ~mpL N^NuNVH0*n.. BB Э(@ fp܀A(H0-HS*S`0-H**Ul*Jo fv /HTN|P܀  gp܀z`Hy2$NX r"Ё, r"Ё, F, `xp܀S R(@ /HTN|P=@HxHnHnNjn p0.܀  gdp܀JglgTJmf*U`L0N^NuNVH0 <*r -@BaNB`X. ?...A r"@2R .耺ez8`X. ?...A r"@2R @eN*|B *XR e` *XR <r ⨺d` *XReJ2@gLz`2. ?...A r"@2R <"<Ne <(r /aX#wt``HyHx/9wt <r /Hy NLHyZHyN>PJf(HyNX ZfRwt wtm#wtwTBHyHx  / <r /Hy NLHyZHyN>PJf HyNX Zf R m#DzwtHy//9wt <0r /Hy NLHyhNX 9wTr / 9wTr r /Hy2hN JfHy2NX`$ r / r r /Hy2N #J28f o -@ (op(` .#28r "<N#28 ."HAHABAЁrNr "<Nѹ28 .rN-@ P28o( 928Pr r Ѯ#P28 .ѹ (o(#(` 9wTr "<PN#28 28l #28Hx/928Hy2N J2X`Hx/.N@dPHyHx/. <r /Hy NLNHxHy/.B y(P h0( /NGFp0-@/N?X*nN^NuNVH<*n  g 9 ` -,-@ - r -@ gP&m "<N&@ - ЭY$@ "<N`d g, m, (".Ё&@ -r " ҀY$A`0/./.NxHP&@ - ЭSr //.NxHP$@ R.`R9w0Hx/9$NP//9$NP-@g(@`p0+@(XXc .r -@// ./NwD  g ;n<0;@>+m 8 -8+n HU n NX  fdNId-@`/.HUNP g/.NIX+m8 / ./NP/.//9$N LPJf߮Jn .LN^NuNV0. Jg g" g8p`P . r -@wTl`: . r -@ d ` . r -@ d0N^NuNV#!#!Hy!NXJf n0H-@#!` #!pN^NuNV#!#!Hy!NXJf nHH-@#!` #!pN^NuNV#!#!Hy!NXJf n0#!B` #!pN^NuNV#!#!Hy!NXJf n#!B` #!pN^NuNVH0A *H(y(PBRs4 |,-P-hp0-B f#(T`-HfAH`A|+H< . gnp gn gn gln g`NI\HU/.Ba T /-S"<-A . m (6Ю ".m@ .m n (:Ю".m" .m n (>Ю".l .rN n"( Ё-@/./NxHP-@ n/(L0(@/NH8P=@p0./ n// n/Hy9cN .rN/ n0(@r / y NPH-@/.Hy9NP` /././. /.Hy9N-n n/( /(/(/Hy9N n/(/(/(/(Hy9N . -@ n/( /(/(/Hy9N n/(/(/(/(Hy9N/.NIXL0N^NuNVBN^NuNVH8*n0--@?.Jo .f@NI-@B Jf#` y!M #a/.NI` l "HA HABAЁ&@ @JhgxNId-@(|8`R@HxHTNP f <A/ Q*_ )|ۼ0#xHSHTa PJfB/.NIXHUN`F+l((+l/.NIXHT0,H"HAHABAЁ- @ PNXL8N^NuNVH0BNLJfp`NI-@ . ngn ng ngh ngB ng8 ng: ng ng-|/.NIX .`(9`B99` n#`(nB "HA>>HABAЁ @ g R m l "HA>>HABAЁ @  "HA>>HABAЁ @ `R n :` @ hg4 @ h0(& `f n h (N.m -|`.-*-JmxJo ljJf, l\ "HA HABAЁx-@` l0-|B "HA>>HABAЁ @Jf-FR l*Jm "HA>>HABAЁ @ f`4Jl -|`,. "HA>>HABAЁ @ $HB>>HBBBЂ$ "HA HABAЁԀ-B n h (N n0J l n!yD` n!m  n!m nJo (Ш#D` nBBD n1|Jm n "HA HABAЁ"@"#h#h`L0N^NuNV/. HyHx0. H/HyHzNN^NuNV/. HyB0. H/HyHzrNN^NuNVJ@(g 9@(`J9>f <@`B!#!# !#!#!#!!3 !NI-@Hy!aX 9!g/.NIX !m !oB` 9!N^NuNVH8(|`fHxBNP-@gh @!|  n (Ј&@Hx\HSNFPHyHSNIPR9='M)m '|XHSa"X*l g 9=eL8N^NuNVH<*n(mA $H -X g gn`+l @+lD gp`p@0,@%l$%l B(%y|R|y; |%PB<+|X+|Pp* f /HUaP`HRa X&@Jg+|XHSa ^XL<N^NuNVH0J9>f8R9>HxNMX*@JfHy@ -$lr Э",t 塐-@Jo+@( .`B( ,ѭ$pL0N^NuNVH0*n(yx g9m @g HUN XHTNXBL0N^NuNVH0*n(y` -$g(TfRB`./9NgRXJfA #-; L0N^NuNVH<*n(y` -$f - g(TfJ99gp- gp-?-@/- NgXJf 9紁 &|  g>edRkp-@gJf/-NgRXJfdjp-@fb lR ."HA HABAЁAЈ$@ @Jhg,`t-r9:g,HxHUaPRB` l ."HA HABAЁx$@ @Jhgp- fJ o n lJmJm -ltJ(g R`p - -@ .й oRR`8Hx$NIX-@/.NiX(@/.NIXg .ѹf R`Hx\HTNFPA\-H)HHx@/.NFP)LH)nL .@)@@ n!@ )m D n!lDA -HHx0/HUN . @ ."@" nB n( n( ny:)|P)|Xp- f n ` nB n  n!|0 n!m$ n"n#h($HyHTNIP mF - f.Jl0H/NX l@ ` l@ )|X`HTaX`jHR/.aP L<N^NuNVH(*n/-NgRXJfB`>HUaX&@Jg-k A'P 'n|ny:HSaXpL(N^NuNVH8*nB &@+m+m+m +m$$+m((+m,,(K` 0,Hހ(Tf0;@||M RHxHywBHSNL8N^NuNVH8*nHxBNP(@Jf RB`2)|L9|0 Ь&@gHx0HSHUN L8N^NuNVH BA-H-n`HxBNP*@g.. mrNId-@-ytg( .r s @RSyt n#t/.NIXJg.<0;@ .쐍+@`& po pp` pn .0;@+|  Э-@///.N ߮ n -M J n .`/.NXBL N^NuNVH<*nA $H-|HxBNP(@Jgf)|L9|0 Ь&@Hx0HSHRN Do <` -D.'G,/. //-@a^ -@fHTNXR`F(߭@Dߪ(JDoR< ".-A m .l ЭZ(@ -6 l -6`p,%L 05@&|3*`Lpc ` p&gJf p0 ?6`6X SJfp* SJg6` .mذl -6 -6ЭZ"Ё(@ -: l -:`p,%L 05@&|3*`Lpc ` p&gJf p0 ?6`6X SJfp* SJg6` .mذl <.0-4Hr ЭZ"偐(@ -> l ->`p,%L D5@&|x3*`Lpc ` p&gJf p0 ?6`6Y SJfp* SJg66`JgHy@NX n /aX n B` က//./. y N /.NIXLS"<-Am .Ь6m(m .Ь:mm .Ь>l rN-@ , ".Ё-@ @JgP/-Lp0-@/NH8P=@p0.? f`9)HH-@B/-LN@dP)NId-@Jg nJfHx/./HTa</.NIXp`BL0N^NuNV.*y(PJfa`/-NIXHyH/-NIP - ga`*nN^NuNV.*nX`J g .  @0*nN^NuNVH<*n..,.*.NId-@ r (@ x(p` r &@JSf:BaX$@R@=S 8rN.?.A6`$p+?"HAHABAЁ8$@Rj ?*X08=S/p./NP..A6R SJf./.NIXLd "-6遰mh <>dZ -6ЭZ"-6$Ђ`n <>e20-4Hr ЭZ"<偐`< <>d 6l0 6l ЭZ(@ R-@ f <`` BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV.*n 928#`BHmNPJgB`p*nN^NuNVH0*n0-H`(@)m 2R,L0N^NuNVH0*n(m2BB-B-||Bm8Bm:B-B- B +|+|+|+|B$+|(B-0B-1|6Bm8B-B-0.+@<|,gJA0gHyBNX.<B@`,fJg S,gJfJA0gHTHyBNP,gJA0gHyBNX,gJA0gHyBNX| Sn.<B@`Jg S,gJf$JA0gHyCNX`BB`,HxHx0.H/a JfB-pL0N^NuNVH00. H. `*@JA0g/. 0. H/HyCGN lJ-fT0. /HyCX`20. H/HUaPJf00. /HyCr` /-. ,. 0H`*@JA0g/0H/HyDKN J-o0gB-J-g0HxHx0H/a HxHx0H/a `B-HxHx 0H/a J-gHxHx0H/a -gnHxHx0H/a ||`JHxB0H/ar HxHx0H/a^ HxHx0H/aJ ||B-J-l B m2B-JA0gHyD]NXL N^NuNVH00. H`(@JA0g /./. 0. H/HyDoNJ,lp`A*HNI|, g&@HxHUaPJg/NIXp`* /NIX;n +n+n (B$HUa`XNI|, fHxHUa6PJgp`./NIXHUN$X. @g HUN XB L0N^NuNVH0*n0-H-@`-@@(@B NI|-@ f .gv .ghS`J`lZJA0gHyDNXHxHy`aTPJgR`;| n|1 n!m LHUN`LJ f )M B` l!M )MJA0g/9`HUHyDN nJ(6g/.aX/.NIXL0N^NuNVH0.. `*@J-6fDHyDNX`2/HyDNP`6JA0gHTHU/HyENB-J-l9|JA0g(0,H///,$/,/, HTHyE N|1+l L fHAg@Ag8J`nHy`N XR`JA0g/9`HyEfNPHTN`Aff|1-l(B$ f+| 0,@0+l ( .BF @/HUaP@6 -6f|6`Af4J-g.B-` g0/,/, NFPB()l(` ,$ng f ,r Ь$+@ - $f4+l$|1 f-||`$-|`JA0gHT/- /,$HyEN9|`"J-6g(mLfJA0fL0N^NuNV.*n-m-m2 g f  f-| +m+n JA0g@/-$/-(/. . A @//. .A @/HyEN g g fHUa^X` gv  fH`h  f -| `R  f -| `< g0  g$p`j g g gJg/. . A @//. .A @/HyEN|`B*nN^NuNVH0B*|`J-g (m2,fR mB`BJfHTHyF#NP`HUa&X@6J-6gJLg/avXpL0N^NuNVH8*n(m2&mL-|,g gJA0g$/- -A @/HyFSN +m+| `HyFuNXHUaXJg-g^| - R+@p-1 g g gp-1/HyFNPB-17|`-g-f/-HyLNX`( . K @ //. HyLN B`|Hx./- NFPHUHT/- a BmB`H .//. HyLN /- Hx./9HN B-`R l,<Sn m g;|JmgpL0N^NuNVH8*n(n &n k|T  @p0@r " /aX-@ @)P|| ;|A-H  @p0@r "./aX-@ @+P k|BSn k|L8N^NuNVpN^NuNVH<*n0-"(@0->x&@0-H-@JK gHyMNXJK f$Jf/9oBHzN RHx/9HNP$@fHyM)NXL<N^NuNVH0*n(n HT x"<>N/HyMFN |@;lBBmF;lD;lH;lJ;lL;lP;lR;lNB lA . ." Ҁ"A"#hR`'J( ." Ҁ A 7m<'M4'm$8Hx/9HNP-@JfHyMRNXB+@`7|BBkFBkD7|HBkJ7|L7|NBkPBkRHxHSapPJgHTaX/HyMuNP`B lj nBh/././.HTaJg/././. x"<>N/aJgl/.HSaHPHxHSaP/.Hx/9HN J+@fB l ." Ҁ AB ." Ҁ ABR`R`2 m4Jhmfp0-N-@p0-L"HA<N/HyMNPpL8N^NuNVH0*n(n . " Ҁ A x"<>N.BlBBBHxHxB/.B/. HTHxHUa$Jg HUaX-@JgB .".ЁS"HAHABAЁKb @HH".RmJgD .".ЁS"HAHABAЁKc @HH".Rm8Jg .".ЁS"HAHABAЁKd @//././HyMNB`p0-Br2-DЁ6mEB+@mMB+|J gHxBBBB/HSBHTav$`*BBHSBB x"<>N/a*HSHx/9HN `pL0N^NuNV.*nHxBBBB m p(/ -  /HxHUa$ m (-*nN^NuNV.*n mھg:B*nN^NuNVBn=|-n0.SnJ@gv n0nT`HUaXJf@/./.HyM`"/./.HyM`p0-//.HyNN `~p0-".f mbp`dJngB`pN^NuNVH0 n*h .Ю @ P(h(  fp`B@ Bln ., , .+, ,   9nn#n . @p0@r "./aX-@ @)P .$r /aX-@ @)P  @p0@r " /aNX-@ @+P n h gB-JK g$/.( . LR @/HyNDN n h|J(g /.aX`BL0N^NuNVH *n.< m f.,<Sn SJnHyNYNX m|p` m| m p(L N^NuNVJK g/. 0. H/HyNeN 0. HrN-@"HA>>HABAЁx-@ @J8fp` nJ(@fB .Ю @B .Ю @!|R m n1|B nBhF n1|H nBhJ n1|LB/.a~PJg(/.HyN}NP`HyNNXp` n|@Hx/9HNP-@JgB l nBh n1nJBHx/.BHx0. H/aJJf/./. n h40(H/ .x"<>N/aJgH/./.aPB/.aP m nBhJ/.Hx/9HN B`R`2N^NuNV0. HrN"HA>>HABAЁx-@0. HrNЮ-@ nJ(@fp` n (N^NuNVH<*nJK gHyNNX0-. l "HA>>HABAЁx(@0-HrN" Ҁ&AJ,@f Af-m$ .nJgf +m(`0,LH" .N+@(p0,FГѭ(Ah$H l8 ( /NIX,HUHRNPJf*HTalX ,8"*@J gJf /,8aX/NI`HUNXL>HABAЁx*@JK g( . LR @/0. H/HyNN A(H m8 ( /NIX` JgB`@HxHTNP f( NI9n n,n.)n)n )n$HTaXJfHTNTX @g HTN X L0N^NuNVH<*ng&m4$m80+HrFùɐAh(HJ gdJf0)|Jkm"0+Hrᡃɐ0+Hx @R g$BJ.f%L.` j2!L%L2)|L<N^NuNVH<*n`+k.&m.g(k gR60,"HA>>HABAЁx$@0-"-@-l$0,HrN" Ҁ-A ,"<N-@ n ($".l ` n ($-@ n r2*HNr2*LNѮ n!n n!l  n1n)l(HUa XL<N^NuNVH<*n m.$h 0*"HA>>HABAЁx&@0-"(@r2+L ,Nr2+L. o <` .0,Hl `0,H.+l r 㠰(l r ` *(+@(Af +,g +,gB @ HUNeXL>HABAЁx(@Ah .gHyNNXr2,L +N-@r2,L +N-@r2,H .N-@r2,H .N-@p0,JѮp0,FѮAfD *"<N-@p,,-@ gL gBJg>-j `< -"<N-@ g -|`-|-m l40(H-@m4p".㠁ɐ .` @R -".ɸ Aѐ l40(H-@B/././././/./.HSa$L<N^NuNVH>HABAЁx(@)y 0 n0(HrFùɐp*, n( *0("<N(f HyOG`JgHUaX-@HUaXЮS"HAHABAЁKb-@0-Rm nHAmBm0- Rm n(HAm K^mHyOW/.HS/aAfL ,,fBB,@ l4Jhm l40(Hɨ @ L0+/HyO^NP` K^mHyOm/.HS/ax0+HrN& "HA>>HABAЁ @ P0(H&BBBBB/BHxHUax$` K^mHyOu/.HS/a/.a`\ fAf ,,f g f0m`Bm٭ r ѭJmf Bm ;m /.NgRX"e L>HABAЁx-@ fJjo|HUaXL<N^NuNV n /($ n/(/. .LR @/ n 0(HrNa/ n 0(HrN/HyO{N`j&m.B6+k.B'l HTNX .f nJ(.gJ g /.arXJ.g6J6f.HUa`"N^NuNV.0. HrN. mp`@/. HyHx0. H/ "HA>>HABAЁ /HzN..N^NuNV.0. HrN. mp`>/. HyB0. H/ "HA>>HABAЁ /Hz N..N^NuNVH00. HrN"HA>>HABAЁx*@0. HrN" Ҁ(A . dgZ dgh dg@ &dg @dg$ @ dgt @&dgpL0N^NuNVH Hx/9HNP*@f^pL N^NuNVH Hx/9HNP*@fp`-n m8 ( n m4"n3h m80(" @"n3P n1|B`FAB"n <"Q2`NLJf9)HH` n <CB"Q2BHUabP` n !l`NLJg n()h`NLJg-np0-L-@ n-hr2-H N".N-@ n Ю-@".NJf .谮gp`b .Ю".Ҭn/.BHx/. n(//0. H/a,JfB .r /B n/Hx0. H/a`NLJg-nr2-H Nr2-LN-@ n Ю-@p0-L-@ n-h-h .".NJf .谮f .Ю".Ҭnp0-H".N" .N-@p0-H".N" .N-@/.Hx@Hx/. n( //.0. H/aJfB .r /B/.Hx0. H/aJfnHx/././. n/0. H/aJfBB .r /B n`rnnnnn . Ю,`.B/. HU/. Hx0. H/a.Jf . Ѯ . mHUHx/9HN `(|n . .@nB-B/.HU/. Hx0. H/an.HUHx/9HN L N^NuNV.R *|x`LJ-@g@ 9 0 m.HxBBBHx x"<>N/a>e/9oBHzN *nN^NuNVH80. HrN"HA>>HABAЁx*@0. HrN" Ҁ(A m80("&@ m40(H-@J-@fp` .l Юop`r2-L .N-@r2-L .N-@r2-H .N-@r2-H .N-@p0-JѮp0-FѮ ѮHx/./././././. HxHSa$-@Jgp`BL8N^NuNVH8 . "HA<-j `d -"<N-@ g -|`-| - @p0@r "--@ l00(H-@m4p".㠁ɐ .` @R -".ɸ Aѐ l00(H-@|:/././././././.HSa~ L<N^NuNVH/. HyB0. H/ "HA88HABAЁx/HzN..N^NuNVH00. HrN"HA88HABAЁ*@0. HrN" Ҁ(A . dg dg dg &dg @dg @ dg @&dgZp`-n m4 ( n m0"n3h m40(<` @"n3P n1|B`PAB"n <"Q2`NLJf9)HH` n <CB"Q2BHUaP` n !l`NLJg n()h`NLJg-nr2-H Nr2-LN-@ n Ю-@r2-L .NJf np0-L"(gp`p n (Ю".ҬnB (r / n(//Hx0. H/aJfB n (r /B n/Hx0. H/a`NLJg-nr2-H Nr2-LN-@ n Ю-@r2-L .NJf( np0-L"(f n (Ю".Ҭn0-HL" (N-@0-HL" n (N-@ . n( -@B .r //. n/Hx`L0N^NuNV.R*|`LJ-@g@ 9, m.HxBBBHx "<8N/a8 e/9oBHzN *nN^NuNVH80. HrN"HA88HABAЁ*@0. HrN" Ҁ(A m40(<8&@ m00(H-@J-@fp`: .l Юop` r2-L .Nr2-L-A m .-@r2-L .N-@r2-L .N-@r2-H .N-@r2-H .N-@p0-JѮp0-FѮ Ѯ/././././. .  @p0@r ". /HxHSa: HSaX-@ .Ѯr Ѯ JoJgJgp`BL8N^NuNV. . @*Pp0.N f A #(TRs<` mNJfF*m6f . @ R SrdNJf/.Hy\4NPNN*nN^NuNVH0*n(mHx$NIX.BbJf)M(`" ,fHy\_NX l!Mb)MHTaX/NIXL0N^NuNVH8*n`0+4gJg , @p f 0+4gn , @p g/,aX)@Jf `)l*bJg0+4g;|4Rm0J, f.HTa*`6*b)lJg0+4g;|4Rm0 T-h HT nNX(Ug&Jm4f &TJm0gJg0+4gL8N^NuNVH0*n(mHx$NIX.Sl0Bl4 fHy\dNXJg -gB - gN/-/-apPHTabX U-h+|HU nNX/NI` U0(4g| HUa XL0N^NuNVH0*n(|BbJf )M )M`" , fHy\sNX l !Mb)M sL0N^NuNVH<&|Hx$NIX.*kf/NIX`'mb/NIX(U0,4gJnHy\|NX - f $m-m` $m-m0,4g -R//.HRad`/-/.HRN J- f0 - /NIX.HU l NX/NIX`Hx$NIX. -g /-/aPHSaX - /NIX+|HU l`LJ"g n(HH"B"`. n(HH" `J"f J9"f&J9" f9"H nr(Ag9"HH nѐ9" HH n쑨 np(  n@ n-h g` n ("HA HABAЁ".PЁ*@ n* n+h n(+@ n (R!@ nmB np("#"B9" " "*nN^NuNVH0*n(|HxHUNPJfJ\gN#\Hx"/9HNP".  h A .  h @JfJ/. Hy]HNP`2HTHx/9HN JfHx/. Hy]dN B`(Hx" .  h @/NFP/. HUafPpL0N^NuNVpN^NuNV n h$"n0)H 0"@2 n0( @"nJgp`BN^NuNVH8*n .  h @(P y\"y\P 9\T/HTaPTHlHlaP||.<B@J,gSnJn/. Hy]NPB`|A &HHlHSa:PHxHSNFPBSBkJ,f|| ,g+g*p+//. Hy]N +`|pL8N^NuNVH00. . l> "HAHABAЁ (@ @Jf  ( @*PgJmfp`HxHx(0. H/al Jf$`(/Hy]`,g2/Hy]NPBp`r,g,g . fB)|B@B,Jlf>)|B@9| 9o"HAHABAЁ/0. H/Hz N BL0N^NuNVH >. ,. 0"HAHABAЁ *@ g gPJ-gJHxHx@0H/ab Jf0HxHx@0H/aJ JfHxHxI0H/a2 JgB0fBHx0H/a BL N^NuNVH 0.  *@NI|.`$Jf f@HxHUNP f* /NIX;n +n+n (B$HUanXJfB`XNI|.`HxHUNP g/NIXHUN$X-@ @g HUN X .L N^NuNVH<*n0--@"HAHABAЁ $@ . 8&@B NI|-@`HxHjNP *lR* . ( @ P(h$J f"'M BJ.f)K.` l2!K)K2` k!M 'MJ6fHTaX/.NIXL<N^NuNVH<*n`+k.&m.g(k g0,-@"HAHABAЁ $@B*Jl6BJ'l HTNX*S* mHjN X`B-| . f ,( gf 4gx 8gV Dgh+|6Hx,Hx< ,"HA HABAЁ/NP/NP%@-l-l(`+|6%|,-|`+|6%|` ,$rNo9|` ,$rNf( g/,/, NFPB()l(` f ,$rNR%@ ,$rN-j".䲀fd-l f8 6g$JJg-|L+|6B-|`-|0`-|,+|6%|<`+|6 ,$rN".䲀l-|H ,$rN-@`-|I ,$rN".䒀-AHx,Hx< ."HA HABAЁ/NP/NP%@ op`B-@B0-H h @  -@Hx/NFP . n0 . n(刁( nJ*g n .`0,gB`p n(爁( n . ( @ P0( n(刁( n1n n1n+l +n @ HUNeXL<N^NuNVH0*n"0-H h @  (@ -gHy]NXJm oHy^NXHl /-a P0-H h @ PJ(gHy^NX0-H h @ P| m|"L0N^NuNVH  @&Pg2J.g, +"g  h @ PJ(f xJf B`.R`  h @  -@*k.(m fHy^7NX0,. mHy^MNX "HAHABAЁ $@ . @5P*g f5l` n0(",5AHx/.NFP n0  h @ P|   h @ P| k|B  h @ PJ(g .R o8Hy^fNX"*+6f$0+H/Hy^NPp`vSn` f*g*g*gz%|B@p*-@ f| f *gBJg g g f>HTaXz5lB6"`RJ Jl0RHSNgRX`0 gJo  pg/./,$/Hy^N` S b@0;N~`R`f  fV ,( gD 4g< Hg Ig pg qg` ,Ѫ` ,`B` ,$rN%@` Hy^NX`L[l8 ./Hy^NP)|B@NI|.a/NIX 6fNI|. -"f|J+fv||A $HHxHRNFP4( . ( @ P0(,* 刁* m|"/NIX 9o"HAHABAЁ//.Hz~N L ->ffHUNP,X| GmGH+|:/anXBHx"0. H/aP NIl ->f0>HxHUNP` ->gJy)gp`(NIHU0. H/-EH(T @ PNPL N^NuNVH00. . "HAZZHABAЁ*@HU-EH(X @ PNX(m4, ->f ->fBHx 0. H/aZ HUNZPXL0N^NuNV.0. "HAZZHABAЁ*@/. HU-EH(\ @ PNP*nN^NuNV.0. "HAZZHABAЁ*@/. HU-EH(` @ PNP*nN^NuNVH0B*|`(m4`p,,R ->gp g -: gB` -NHH,pg$ -: gx -: @gf -EfBJ fR mRR g f0+| HUN X`HU/-EH(h @ PNPpfZe*|`P(m4pg:,>RJ-EgHU-EH(t @ PN`HUa2XZe .L0N^NuNVH00. . "HAZZHABAЁ*@/././. HU-EH(d @ PN-@Jl/././. HUNR-@JlR . tkg tlg tmg txgr tyg^ tzgJ t{g4 @tjgp` t g t f/a!f-H @0H"-nJ ->@g>HmN XJ,g$ ->//-,NPB,>Jg6HmN|X. m -: g",@ >/.NIX`& /HUHyRN >`L0N^NuNVH 0. . "HAZZHABAЁ @*PNIl(p,p-" . b@0;N,2<,. p-* "@` ` . F̀`/NIX L N^NuNVH0B(|*l4gB r  @HH€g|` p,Jg ,>f|HTN X>`h ,>g\ ,:fP ,>gRZ m" 9o/BHzN L0N^NuNVH0B  @(PgxJlgr rNJf /Hy_4NP "HAZZHABAЁ*@ ->g(/aXBHx"/a >HUaXR mfL0N^NuNV y ( f C` y ( fC fp`BN^NuNVH8*n0-H"HAZZHABAЁX(@&m B)K4||Sn|Jf|`|||D||||RZX m0-H @J f# HxBHzN L8N^NuNVH 0. ._mp`. "HAZZHABAЁX*@+|$> ->fHUNP,X| GmGH+|:/a~XBHx0. H/a * NId r  @HH€fHxB0. H/a g> ->f4>HxHUNP` ->glJy)gbp`(NIHU0. H/-EH(T @ PNPL N^NuNVH00. . "HAZZHABAЁX*@HU-EH(X @ PNX(m4NId|  @PNI ->f ->fBB0. H/a HUNZPXNId ->f ||NIL0N^NuNV.0. "HAZZHABAЁX*@/. HU-EH(\ @ PNP*nN^NuNV.0. "HAZZHABAЁX*@/. HU-EH(` @ PNP*nN^NuNVH `v y_HH*R_ "HAZZHABAЁX*@ y_HH.R_ y_HH,R_ ->fHUN X` @g -: gB` -NHH.  g0NId-@-m4 n| n|/.NIX g$ -: gp -: @g^ -Ef:J fJ mRR g f(+| `&HU/-EH(h @ PNP 9__e #r_ 9__f~HxBHzhN L N^NuNVH0B*|XB C @Jf(m4|p,g ->f^HUN X>`J ->g6Hx0-BH/NlPHx0-BH/NlPHxHUNPP>p,g:|(R>J-EgHU-EH(t @ PN`HUaTXZR m .L0N^NuNVH00. . "HAZZHABAЁX*@(m4/././. HU-EH(d @ PN-@Jl/././. HUNR-@JlV . tkg tlg tmg txg tyg tzgj t{g4 @tjgp` t g t f/azX .`NId|  @PNIB`NId|  @`HxHx0. H/a `HxB`B n/aBX/`Hx`Hx`HxB0. H/a /apX n `zL0N^NuNVH..B @g  g g g LN^NuNVH..B g@  g g g LN^NuNVH0.. "HAZZHABAЁX*@(m4NId-@||J-GfBB/ap `T|!z@  @( -Gf@`, -: g``@ -:g -Gf ` -Gf`|@|@|@" A-G_ @0H&  @0HgT X33 " X303 Vr 30" A0/.NIXL0N^NuNVH0*n(m4NId, ->!f-H @0H"-nJ ->@g>HmN XJ,g$ ->//-,NPB,>JgTHmN|X. m -: g >`$ /HUHyRN >/NIXL0N^NuNVH 0. . "HAZZHABAЁ܌ @*PNId*  @,|p-( . b@0;N>DN,.  @}| " AP` ` . F̀`/NIX L N^NuNVH *nHUNX. g fB`:HxHmN>PJf;|BSn;| BSn;| ;|p L N^NuNVH00.  lT0. "HA HABAЁ *@ @ f$0. ( @(PgJlfp`|J_f#_a*G`R , /NIX.0. H/aXJg0. H/a4Xp`$0. H/aLX/NIX >fBL0N^NuNV.0. "HA HABAЁ *@B*nN^NuNVH<*n0-"HA HABAЁ (@0-( @&P$k + /NIX-@0-H/aX)m'm 'mB+ HSNeX`HxHTNPJn g"0-H/aX (4HUNXHTN X/.NIXL<N^NuNV.*n -`o+y`*nN^NuNV0.  mp`4/. HzB0. H/0.  /HzNN^NuNVH00. ( @ P*h0. "HA HABAЁ (@`HxHTNP fJfp0 gBL0N^NuNVH8 ."HA HABAЁ *@ .( @ P(h&|``(HHg+H9@FHH~2Sn`TJfL8N^NuNVH80. ( @*P0. "HA HABAЁ (@0. ( @ P&h . vgF @vfZ n - /NIX-@0. H/adX g&6`P n. ?"(`p`H g6` BS`0. H/aX0. H/aX >f/.NIXBL8N^NuNVH8*n(m0-  &@ -gBHSN X9| - @p0@r "--@r9@ -S-@ .9@ .9@ .9@ .9@9|G9|L8N^NuNVH0*n0-  (@BHTN XL0N^NuNVH8BB ( @*P(m9| BSnp0,g|BSn9|  "HA HABAЁ &@ gp0 gHUNgRXHSN XR mp L8N^NuNV.*y( - /NIX-@a./.NIX/9oBHzN *nN^NuNV. . "HADDHABAЁ(*@+n - X/NX fB`\ m g m | m gf (fHx/9HNP+@$JfHyaNX`|,BBHUa m$p(Jg g/. HyaNP`f/. HyaNP+|(`Hx BHUa -@g8 ."HAHABAЁ`d @//./. HyaN m (g/. HybNPRJg*`/. Hyb&NP+|( (g^p*nN^NuNVpN^NuNVH8*n0-D((@0-x8&@0-H-@Jlf/9oBHz!N Rl0-H" Ҁ A 'Mp'm$tHx/9HNP-@JfHyb;NXB+@L8N^NuNVH0*n(n HT 8"<xN/Hyb^N |@;lB;lDBmF;lH;lJ;lL;lP;lR;lNB l&A . ." Ҁ"A"#hR`Hx/.HTa Jf4 (f-|-|`-|-|B .l:B+A+AHHl nBh/././.HTaRJgN/././. 8"<xN/a Jg /.HSaPHxHSaPJg B+@R+A`zHxB n0(S/0(2(ЁS//.  @p0@r "./HxHTa HTaXJgBA .0R ~mHybjNX/.Hx/9HN J+@fB l ." Ҁ AB ." Ҁ ABR` n <Cx"Q`R`L mpJhmp0-N-@Jop0-L".e-|p0-L"HA< g6 ."HAHABAЁ`d @//./HybNB` m (`g |@|Sn m |`-AHHr,-HH€gB " Ҁ A$Pgg*A-AfAB-H0Pf(0+hf0+hf0+hf 0+ h gL 8"<xN/-AHH/ 8"<xN/HybNp`R mL`-AHHrᡃ,- mp0(H.J gtp0+/p0+ S/p0+S/p0r2+ЁS//BHx HTa@ HTaXJg( 8"<xN/HybNP`p0r2+Ёr2+Nr2+ NS-@Bp0+r /B/.Hx 8"<xN/a `pL0N^NuNVH *n (g m (L N^NuNVH0*n`~Sn m (f(m$HUaX,g ,&cp&` p,`BL0N^NuNV.*n mھfHUa"XJfL/.HybNPB*nN^NuNVBn=|-n0.SnJ@gp n0nT` mcp0-//.HycN ` . gJmgJmg . g|p0-fnp`jJngRm> nHAm$Bm>0-@Rm@ n(HAmBm@ `^mHyc/.HS/aAfX ,ifNB,@ lpJhm lp0(Hɨ @ ad0+/HycNP` `^mHyc/.HS/a^0+HrN& "HAxxHABAЁ @ P0(H&|BBBBB/BHxHUa~ ` `^mHyc/.HS/a/.a:`d fAf ,if0-/.NgRXDle0 L/././.HjxN-@m .r ѭ2 .ѭ60.m:0.m< n `^mDHycHyaL/.p+/a:/./././.HycNp0*Br2*DЁr2*HNr2*LN-@p0*L".䒀S-A-|`+gHJ+gB +g0 `^m$HydHyaR/.p+/ap+` .r ѭ2 .ѭ60.m:0.m<-m60-gRJoN fD e: r -@YXm Э @0 Э @1mJgF*U`-|B`F n0/ n0(H/HyhN -|/`* n *PB-M |b d6HxBNP*@f -|7`p* +| ;|`YXm Э(@ n (@9nNId-@ n"H (@Dm.RH-|7-M /.NIX/. NX .`hB| nJP0,H".灀9@3v09vH29vR3wd3wdw`3w`p09wdH/ l NX-@JnHypNXJof 'm #o` #oJof #o 9ooo #oo#2d/.aXJg 3wdvL0lN^NuNV .2d#w#pJlBwN^NuNV.*|p`80-H2. Hf0. H/ m NX` JfB*nN^NuNV.N,. f~ /NX ..N^NuNVH *n`6 #gN @g` g4 f*nHx NXa.  g fB` Sd`L N^NuEEFEhbrEEEEEEEEEEELLLLfPf|fPf|LLLLLLLLLLLLLL2raw_usrreqrtfreeduplicate IP address!! sent from ethernet address: %x %x %x %x %x %x lolo%d: can't handle af%d qy*y~n0x x $HUM| dlinternet icmp_error(%x, %d, %d) icmp_input from %x, len %d icmp: cksum %x icmp_input, type %d code %d deliver to protocol %d icmp_send dst %x src %x 255@A3A==(ip_initforward: src %x dst %x ttl %x no route to %x (from %x, len %d) `gnsz$/:BKV`fnsx~%x %s:???????? %s -> %s [%x..%x)%x@%x<%s%sSYN,%s%sACK,%s%sFIN,%s%sRST,>%s<%s> rcv_(nxt,wnd) (%x,%x) snd_(una,nxt,max) (%x,%x,%x) snd_(wl1,wl2,wnd) (%x,%x,%x) ATTACHDETACHBINDLISTENCONNECTACCEPTDISCONNECTSHUTDOWNRCVDSENDABORTCONTROLSENSERCVOOBSENDOOBSOCKADDRFASTTIMOSLOWTIMOPROTORCVPROTOSENDCLOSEDLISTENSYN_SENTSYN_RCVDESTABLISHEDCLOSE_WAITFIN_WAIT_1CLOSINGLAST_ACKFIN_WAIT_2TIME_WAITREXMTPERSISTKEEP2MSLinputoutputuserresponddrop?tcp cksum %x tcp_pulloutofbandmgettcp_outputtcp_output REXMT?fff@???33?ٙ@@@@AABtcp_usrrequdp cksum %x udp_usrreqiinit/binit%(%  p4p0LDzHb28$jn2&2."6P\AKrL/DT2ԄD$F˘lK^%(%ˈː˪t K(*rV0{ \Ӿ LŠTL6:"7<>XC6?7t? ? @%d& < :X#;,?0;dPH@ӈӚ timeout table overflowfileexeceexeca rmalloci/o error mapping pagesexitinit diedexit: m_getclrprocno procsnewproc vforkissig psigpsig actioncore?px&??sleepwakeupsetrun0123456789abcdefpanic: %s %s: table is full %s%d%c: hard error sn%d rmallocrmalloc swapmap%s: rmap ovflo, lost [%d,%d) bad rmfreermget@@calloc ...flockifunlockino shared lockno exclusive lockrwipureadc accept f ff}f~@fm@m@tt t@tt@tt t t ttt@t ti@tjtktltm tn totp tq@tttutv@tw tx ty tz t{@t|t}t~tAccounting resumed Accounting suspended |`{}~ABCDEFGHIJKLMNOPQRSTUVWXYZddddddd22xxx}}}}ttrstrt^ ({)}!|^~'`ttwritettyrub bkclose: no buf Ycf2ZRHnoojfpNoRHYZPcf2ZRHptcwritedev = 0x%x, bsize = %d, size = %d, fs = %s alloc: bad sizefile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s realloccg: bad sizedev = 0x%x, bsize = %d, bprev = %d, fs = %s realloccg: bad bprevfile system full %s: write failed, file system is full mode = 0%o, inum = %d, fs = %s ialloc: dup allocout of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s alloccgblk: cyl groups corruptedpos = %d, i = %d, fs = %s alloccgblk: can't find blk in cyldev = 0x%x, bsize = %d, size = %d, fs = %s free: bad sizebad block %d, ino %d dev = 0x%x, block = %d, fs = %s free: freeing free blockdev = 0x%x, block = %d, fs = %s free: freeing free fragdev = 0x%x, ino = %d, fs = %s ifree: rangedev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebno = %d, fs = %s alloccg: block not in map%s: %s bread: size 0breadbreadabreadrabpbwriteblkdevbreallocdup biodoneiget: bad fsno imtinodeiputitrunc: newspaceitrunc1itrunc2mangled entryi_size too small..%s: bad dir ino %d at offset %d: %s wdir: newblkwdir: compact1wdir: compact2$L$S$W$[fs = %s update: rofs modbad block %d, bad blockisblockclrblocksetblockdev = 0x%x, fs = %s getfs: bad magicdev = 0x%x getfs: no fsLOCKEDLRUAGEEMPTY%s: total-%d, %d-%d ..rename: linked directoryrename: .. went away rename: .. not a directory ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%%%&mbinitmgetmfreemgetm_moremfreem_copym_copym_copymgetmget LLRUUR('x'unixsofree dqsoclose: NOFDREFsoaccept: !NOFDREFsosendmgetreceivereceive 2receive 3mfreereceive 4mfreesoisconnectedsbappendaddrsbflushsbflush 2sbdropmfreeuipc 1uipc 2uipc 3uipc 4piusrrequipc connipunp_disconnectvmdrum NDMAPvsexpandvsswapvstodbvstodb *ipvmemall sizevmemfreevmemfree vreadmemalldup mem allocbad mem allocmemall ecmapmemall mfindmemall intrans|wantmemfreebad mem freedup mem freemhashmunhashmunhashmunhash mfinddup page unlockpagein pg_filenopagein PG_FTEXTpagein u.u_ofilepagein mfindpagein intrans|wantpagein c_page chgdpagein vreadpagein pfnumbad c_pagepageout klsizecleanup CSYScleanup centerklustervrelvm rssexpandvgetptvgetuptexpand@?qi?x VX?ҝu?WARNING: should run interleaved swap with >= %dMb swstrategyswfreeargmapswapswap bad ptebig pushhard IO err in swapIO err in pushpid %d: killed due to no swap space killed on swap error sorry, pid %d was %sswapinswapoutswapout rssizeswapoutswdsptswdsptxfree rssizetextxalloctext rssizelost textno mem for mbconfigout of kernelmap for devices%s%d at %s %x mbmemmbiobad priority (%d) pri %d %s%d at %s%d slave %d out of kernelmap for devices%s%d at %s %x obiombmemmbiobad priority (%d) pri %d P2RcjpqsZDL  p2z̐̚,.ATpXL\BXD8TP2^_:_pq&&z{d{L L4J$NZXXjjkk Xkf (,:;;|̐pq`qsbzwH͠XtuHuxz͠wcksum: out of data asi4Sun Main Memory = %dK (0x%x) No Multibus memory Multibus Memory = %dK (0x%x) %d system buffers of %d bytes sys pt too smallno memoryavail mem = %d usrptmbclustersMultibus IOPB spaceMultibus IOPB spaceMultibus buffer spaceMultibus buffer spaceMultibus memoryMultibus memoryBuffers in main memory no buffer spaceSystem BuffersCan't invoke %s, error %d icodesendsig: bad user stack pid=%d, sig=%d usp is %x, action is %x, upc is %x syncing disks... done Unix Halted Rebooting Unix... dumping to dev %x, offset %d dump succeeded device bad device not ready area improper i/o error /etc/initmmrw::::::#:(:.:7:A:J:Q:W:]:f:l:r:x::::::::::::::::;;;;;&;9;E;K;O;T;^;q;u;;;;;;;;;;;;;;;<<< <<<$<5>>>>(>1>8>A>K>Q>X>_>h>s>y>>>>>>>>>>>>>>>???/?A?V?\?o???????????@@traplofaultUSER ADDRESS ERROR%s: Command aborted code %x USER PRIVILEGED INSTRUCTIONUSER ILLEGAL INSTRUCTIONUSER BUS ERRORsyscall%d: 0x%x%s(%s%x, syscall: error=%d Begin traceback...fp = %x, sp = %x FP loop at %xEnd traceback... Called from %x, fp=%x, args=%x %x %x %x %s: %s trap type %d, pid %d, pc = %x, sr = %x, context = %x Bus Error caused by %s exception function code %x, access address %x segment entry %x, page entry %x pagefault, pmp %x, pte %x %x hpte %x hseg %x bad addr, v %d tss %d dss %d sss %d D0-D3 %x %x %x %x D4-D7 %x %x %x %x A0-A3 %x %x %x %x A4-A7 %x %x %x %x indirexitforkreadwriteopencloseold waitold creatold linkunlinkexecvchdirold timemknodchmodchownold breakstatlseekgetpidmountold umountold setuidgetuidold stimeptraceold alarmfstatold pauseold utimeold sttyold gttyaccessold niceold ftimesyncold kill#38 -- 4.1a selectold setpgrplstatduppipeold timesold profil - nosys#45old setgidgetgidold signal#49#50acctold phys - nosysold lock - nosysioctlrebootold mpx - nosyssymlinkreadlinkexecveumaskchroot#62#63getpagesizemremapvforkold vread - readold vwrite - writesbrksstkmmapold vadvisemunmapmprotectmadvisevhangupold vlimitmincoregetgroupssetgroupsgetpgrpsetpgrpsetitimer#84old swapongetitimergethostnamesethostnamegetdtablesizedup2getdoptwrapselectsetdoptfsyncsetprioritysocketconnectacceptgetprioritysendrecvsocketaddrbind#105listenold vtimessigvecsigblocksigsetmasksigpausesigstackrecvmsgsendmsg#115gettimeofdaygetrusage#118resubareadvwritevsettimeofdayfchownfchmodrecvfromsetreuidsetregidrenametruncateftruncateflockportalsendtoshutdownsocketpairmkdirrmdirutimesgetdproprevokeunmountgethostidsethostidgetrlimitsetrlimitkillpg#147Vector 0Vector 4Bus errorAddress errorIllegal instructionDivide by zeroChk instructionTrapv instructionPriviledge violationTrace1010 emulator trap1111 emulator trapVector 30Vector 34Stack format errorUnitialized interruptVector 40Vector 44Vector 48Vector 4cVector 50Vector 54Vector 58Vector 5cSpurious interrupt@xnd:no netnd:ndreq sizend: no bdevswnd: version change @(#) ufs_nd.c 1.13 (C) SMI, 83/05/19dup alloc pmegneed pmeg in holepmegunloadctxfreemapout: invalid ptemapout: invalid segmentmapout: invalid pagemapout: pmeg countNoCartNoDrive WriteProt EndMedium HardErr WrongBlock FileMarkInvCmdNoDataFlakingBOT42GotReset DAJhJ JJJJJ J$J*J0J4J:J?JIJRJ]JfJnJxJJJJJJJ     ar*init tape online ar: Timeout waiting for Ready at %x ar*init arrdy on before reset ar*init arexc on before reset ar: Timeout waiting for Exception after reset ar*open(%d, %d) ar%d: no such controller ar%d: would not initialize ar%d: already open ar%d: can't switch drives in mid-tape ar*open SELECT gave EINTR ar%d: no such drive ar%d: no cartridge in drive ar%d: cartridge is write protected ar*open exiting ar*close(%d, %d) ar*close exiting ar*command(%x, %d, %d) ar*strategy sleeping for maxbufs ar*strategy queueing %x, maxbufs %d arstart qidle not setar*start unit %d found empty ar*start unit %d sc %x bp %x ar*start op completed bp %x addr %x size %x blkno %d flags %x err %d ar*start buffer done, maxbufs=%d ar: block %d requested at tape posn %d, bp=%x ar*starting old state %s=%x, new %s=%x, addr %x, size %x ar: start_cmd bad state %s=%x for newstate %s=%x ar: interrupt from uninitialized controller %x ar*intr EXC set, old state %s=%x ar: RDST did not complete ar: histate bad = %d ar%d: many retries, consider retiring this tape ar*arintproc buffer done, maxbufs=%d ar%d: %b error at block # %d punted ar%d: %b error at block # %d ar*intproc badint after CLOSE ar: interrupt without Rdy or Exc, state %s=%x, old %s=%x, bits=%b EnaReadyEnaExcepCatchReadyBurstXferResetRequestOnlineInterruptEdgeReadyAckExceptionDircReadyar: trying to re-sync Rdy with Archive ar: giving up on Rdy, try again ar*arintproc restarting ar: OOPS READ %x ar: OOPS WR %x ar*ioctl MTIOCTOP %d count %d ar*machine(%x, %x) state %s=%x ar*machine exiting in state %s=%x ar: RDST gave Exception, retrying ar: RDST failure ar*RDST %b %d %d ar*READ addr %x count %x ar: Read no READY ar*WRITE addr %x count %x ar: Write no READY ar*machine exiting done in state %s=%x ar*machine idling ar: triggerred at idle %x ar: invalid state 0x%x arFinIdleCmdWfmRfmRewTenseEraseSelDeselRdStCloseInitCloseTwoCloseThreeReadInitReadCmdReadBurstReadFinReadIdleWriteInitWriteCmdWriteBurstWriteFinWriteIdleCmdOkJ@Kpcg #"#,39Z5KO(O$OOOOOOOPPP#P4P=PMP^PnP}PPPPPPPQQQ'Q@QXQpQQQQQQRR&R6RXRkRyRRRRRRRRR?ddprobe: no ccb space ddc%d: can't get MBmem at %x to initialize controller ddc%d: Unknown controller type at mbio 0x%x ddattach ddattach: no space for iopb dd%d: <%s> ddattach: no space for disk label ddattach: err %x dd%d: can't get initialization memory dd%d: error %x reading label on head %d: %s dd%d: Corrupt label on head %d dd%d: Misplaced label on head %d dd%d: Unsupported phys partition # %d ddcmd: %s nointr=%d dd timeout ddopen: dev %d flag %X dd%d: unit not online ddopen: no buffer for disk label ddstratetgy ddcommand: dev=%d %s ddgo queueing error 1ddgo queueing error 2ddintr dd: intr from unknown unit ddintr: unexpected interrupt ddintr: bad bp faileddd%d: offline restoreretrydd%d%c: %s %s (%s) blk %d ddddcunknown errorunknown errorunknown errorRAM errorROM errorseek in progressIllegal format typeEnd of mediaIllegal sector sizeDiagnostic FaultNo indexInvalid commandSector not foundInvalid addressUnit not readyWrite protectunknown errorunknown errorunknown errorData ECC or CRC errorID ECC or CRC errorDrive faultCylinder address miscompareSeek errorData field not foundWrong type of data fieldDrive spinning too fastDrive spinning too slowRead/write controller errorunknown errorunknown errorunknown errorTape cartridge not in placeTape cartridge write protectedTape drive not on lineTape unrecoverable data errorNo data on tapeData Miscompare during diagnosticUnknown tape errorunknown errorinitializeerror statusformatread IDreadverifywritewrite from bufferseekrestore@DHLBTDDWv]zYRWWWWWWWWXX(X*X6XBXWXiXXXXXXYYYYY$Y1YPYaY~YYYYYZ Z Z"Z$Z&Z(Z*Z,Z.Z0Z2Z4Z6Z8Z:Z<ZQZeZgZZZZZZ[[[ [4[K[\[m[~[[[?[[[[[[[[[\\ \\\!\+SMD-2180 SMD disk controller at mbio 0x%x ipc%d: Unknown controller type at mbio 0x%x ipprobe: no iopb space WDC-2880 ANSI disk controller at mbio 0x%x SMD-2181 SMD disk controller at mbio 0x%x ipattach: no space for disk label ip%d: <%s> ip%d: can't get initialization memory ip%d: error %x reading label on head %d: %s ip%d: initialization failed ip%d: Corrupt label on head %d ip%d: Misplaced label on head %d ip%d: Unsupported phys partition # %d ip%d: unit not online ipopen: no buffer for disk label ipgo queueing error 1ipgo queueing error 2ipint: bad bp failedip%d: offline restoreretryip%d%c: %s %s (%s) blk %d ipipcdisk not readyinvalid disk addressseek errorchecksum error -- data fieldinvalid command codeinvalid track in IOPBinvalid sector in command?bus timeoutwrite errordisk write protectedunit not selectedno address mark -- header fieldno data mark -- data fieldunit faultdata overrun timeoutsurface overrunid field error -- wrong sector readid field or ECC error???no sector pulsedata overrunno index pulse on write formatsector not foundid field error -- wrong headinvalid sync in data fieldinvalid sync in header fieldseek timeout errorbusy timeoutnot on-cylinder at beginning of a seekrtz timeoutformat overrun on data??????????????unit not initializeddisk busy executing?ANSI bus timeout -- type 1ANSI bus timeout -- type 2ANSI bus timeout -- type 3ANSI bus errorillegal commandillegal parametertime dependent command errorcommand rejectseek errormapped header errorunspecified seek errorread/write faultunknown error 4funknown error 50bytes/sector errorinterleave spec errorinvalid head addressunknown errorreadwriteverifyformatmapswitchinitrestoreseekrtzspindownresetMultibus level %d interrupt not serviced! mgbombdone repeatsmbcopystmbcopymbbuf space too smallms: ENOTTY: %x, %x, %x Mouse sampling would not stabilize n0oox4|y\^ (^ @DEpq48(tm%d: can't get iopb space tm%d: can't get MBmem at %x to initialize controller tm%d: no response from ctlr tm%d: error %d during config mt%d: not online mt%d: no write ring tmgo: odd addresstmgo: bad lengthtmgo: gate wasn't open tmintr: queuing errortmintr: queueing error 2tmintr: can't clear interrupt tm%d: stray interrupt mt%d: hard error bn=%d er=%x tmintrmt%d: lost interrupt mttm ^_<    oct%doct`L_@_ rrs, tvU@ su dj_`(  vp@HFP^`dP0dStdWd`drddddddddeeee1eCeNeYedexeeeeeeeeefff+f;fFf[fffqf|fff?fffffffffggxyprobe: no iopb space xyc%d: unknown controller type xyc%d: Xylogics 440 xyc%d: self test error %x - %s xyc%d: address mode jumper is wrong xyc%d: Xylogics 450 xyattach: no space for disk label xy%d: <%s> xyattach: can't get bad sector info xy%d: error %x reading label: %s xy%d: drive type %d clash with xy%d xy%d: initialization failed xy%d: Corrupt label xy%d: Unsupported phys partition # %d xy%d: unit not online xyopen: no buffer for disk label xygo queueing error 1xygo queueing error 2xyintr: intr while busy xyintr: bad bp fixedfailedxy%d: offline restoreretryfixedfixed(forwarding %d/%d/%d -> alt blk # %d) errorxy%d%c: %s %s (%s) blk %d err at blk %d - %s xyxycno errorinterrupt pendingerror pendingbusy conflictoperation timeoutread err - header 2CRC/hard ECC errorcyl addr errorunknown 08sector slip errorsector addr errorunknown 0bunknown 0clast sector too smallmemory addr errorunknown 0funknown 10unknown 11seek err - header 1unknown 13write protectbad commanddrive not readyzero sector countdrive faultbad sector sizeself test error aself test error bself test error cunknown 1dsoft ECC errorfixed ECC errorhead errordisk sequencer errorunknown 22unknown 23unknown 24transfer errorundefined errorforwarding bad blockbad block forward failednopwritereadseekresetformatread allstatuswrite all g gecec%d: Ethernet address %x:%x:%x:%x:%x:%x ec%decintr: impossible valueec%d: send error ec%d: can't handle af%d mgetec0R(ghen en%dmgetmfreeLARGE LEN %d trailer length mismatch, w %d off %d en%d: can't handle af%d en4.1c BSD UNIX (GENERIC) #2: Thu Jun 30 14:57:46 PDT 1983 R@RD`$@K$__ \\RRRR`$`$K$K$_H`^ g}g g~\\AAJd'T d* p`$<pRR2pK$.&p8root device? bad/missing unit number use ip%%d root on %s0 root on %s0 no suitable root bad swap space sizexyipddnd@ EKE@<H\% Vp-7 AH JShb[Bjc GFlAt px DJ q@A| DI  B!I CEXFC p  #x,8A83~\9 SBlLJ qR[rf7qXIdy @ "dB  @2`B B!J0IBIII| ItIlIdR(#I\)B1 zr9CCM TD`B&hEpe$xr$rJ~_A s0  ,sG2 F F2C&A s IGF'CC.EC>5FCh<GCCHCJSZ0beAZjt3(wIBHPP_gIh @H8j @<E  \p x J$MF0F\<`IDM sXLcf|rL o t =t^fP tM vvLj"gMl v |v "v ! v xv, dv3LB vL awVbNVa8gokMxv2 1w( w0 w4 *w8 w@ wTM wX w\ w`o &wb wwd XwhpL _. wl!M* wp3@P; wtCoG2 P8Y 8wxa w|i wo Zwv w~4  Vw wQQa wR^QPP %d F'U5$R?rzQ&x`n<RyNgUp\X Zw&YWnYt{F wQY x x$`!`+N\6 JI]U|eP_F]i Ax(q~cXzgRY ^x0d>5c^ ~  ~(`@d ~ f~ h~Pfg j ,hT !(k /kb ?:o F?k T J~ [,i j@o q $ ~o l 3g |H | n0 4$ x d | x l   !y* . < H T `J k e$ t ~,q    y~ p pp Mq ! F ( l y D R| } ( ( -! :. A GM R|D c h\ kxt uSu r "> P  ` x b \ ;y  Gf N     $  / n 9  B4P M   V a n| y k    Y ' s X  B     z ? [. j & 0, Cn S6 Y`( aY sr  \ 9  ]d # ,  ` = z 8 -n9zIm<Xaq6l Mz&9H @ P  28D+ T . > *j 6 @oGLPP /Y o` $e\q =t~ x {| +  -+ d  #8 <p @ HkC+ /*+0% N / 06 4A Q8J5QZ+,a <f @m|u D H+(So (P c"\. P L8  oD+$  Ht +) . :rG+M U [ ebj_t z,~ t-@  [ $f+  ( , 0+2< j0-x X4 EL 8%(&-4f?0>6E-LrCYa1ht:"qLz2.^{K  ː>XX8%2aO eӾ = p!*)d&1#˪8/?F\K(T"]PeqKpA00<aHbr^-%dQ5D$YDTj%dL&2/m7<=GˈMU˘bylj?su{H@CL?K^4TLF6 Ӛӈ )28q@?6#wDz+ \6VAI(#QXŠ^n:f l;x7 R Ԅ)Fxn( ;, t; !P'1[7t9? BLT]dny_qL$YKrm2&, < @ P9 ` p hx o Ɉhl(1 Ɍ9 AiH JɐQ W ɘa ɨj ɸr y cN*\>Ɋo ϤȢ0Xv B" ȮXZ#3 +$b5 =IlHO lZcmpu}xH na D$Z-H L7y@s  b(b6$Dr+yf2;hxDeYxMLVT0[XcHjT%Bt{(h\E>|T U,Kvx^$N,XH,   MvlP$*0=0hIYFQlZ03Ncll rZ{<z|oR  KLqn1 f0Hp>  PDRH%r.r7$BKS*X`hc jrkpzIcwD)PoV,pI+'HdoJ*'6b"JBG"N!LZm#bgjFrJ{(Hj;>|.vLZL&\A/2:2Q   U &"/8 =XI<<T=$_RCi_sx{+ JJp Z87>+OK2;'|GX$`I"/ .2;9HvE<8MPWPZb<jZPtl4|ZlQYumcWn<xRe><irZ i|f!p"R+X4E<XFkOP,Yfnlc+kot-o} nojpNt9p=suq  uH(q`8z S͠~wH/x sb w t" '6} /6 5 E ?& H~ N} Tl \J dD m w {܎ ) >p  ~ '  \ yr   ڌ   !L! v$!>!0*!*k!3!<$!DP!N!V$!`d!i!s!~!Z!T!!}X!&!I! !!O0!p! _! !!#4!M"Ғ" "zP"#:"+ #"4}">t"F"M"U."]b"f"n6"u%"&""r""0J"0"*'x"L"z"""Zz"2 ###",#%(#4$#?!p#I*$#Xt$#c(#r #~V$#+#*#>#Q&H#'#'>#(#~0#5<#@d#R?n#9Z#?#?#/&$=4$ s~$6w$:>$&7$/$7`P$@ $HBJ@$RS$[u*$g $o_$zf$l*$ T($$a* $W$`b$K$`$o$.dp$$W^$_$cf$d&$i%}L%e%br%"%"`%+Ee%4 D0%:b+@%@5%HvF%P+4%VT+%`+%js%s Hۨ%{}z%6{d% ۸%{%%%ub%%%% % o%q~%\%v&&  &0l&&#l~&, y&6  &@A&Kߜ&T 4&[&d f@&j iD&u 0H&~ \L& tP&_&h&&.&̚&2& p& sZ&GR& J&j'q' k'H' '#%\'-iN'68'><D'FL'OCP2'W`Z'`'i<'qZ'y,'[L''h''/'T' '&'^'`'2' X'cj'>k '>(_:( B(:(4($5(,̐(4A(<_(Ev(OT(Xd8(` ((hk(p,(x$(';('L(&(((( =(( up((;|(f(j(4(z()jp) ?)))j)")+ W)5,)=)C>)IDN)Qz)X|)_jn)e)n()wa2T)~h)<)p)*):)k>)F2D))q2X))d)d) )*uX* H2@*2`*A*&2*0C2d*:*A*K*Rr*XS*a *jp*uY70**i7*4*B*ڪ*?8*lӌ*G*~*U*T*+F+ +@(+&Dj"+1@,+83d+D\6+LD+Vۼ+cjX+l H+tVi+~+ ~++b++2+ +@+E+ pH+ X+`+@+j, 8, ^,, 8,* eP,7iZ,> ,E,K,QQP,XRz,d:,j ,o ,xb, `,fD,,wA0, ,T.,D,0t,hA,A, N, `,=A4- -BF-E-MA-' h-0o-8-@J-J-S p-[$J-b.&-j -s%K-}@-.)-#"-; - x-K$-wK -?3-1-#,-9Z-0-/-Kb-X2.  .e.LR.$ Z..*".55.=L.KgR.S  .\ $.eK^.o+.w (.".. 0.XR.]z. 8.Y.S".8S.Wv.S&. R. S. a. q/kBT/ LJ/D/lb/$\D/-T/7 /@~M/G_R2/O:V/YUf/bh/l & /tf/| y /  /0}`/x4/  h/Ty/m\/ k p/  /z/o/  /  (/ \/-n0/ ; 00o0N\0 & 80dt20'|0/@ol07~0Arn0L Q 0U_"0a0j0s t 0~r^0<0p0n00 | 010z^0^20;&00f_0_H0w1L1 ` 1 G 1!1* ! 121:=1B_@1I._1Q_1\  1d$1m1u H 1Mn1 C 1m1 d1  1%11  1j1,_1y`1]H1O1&1`2M_2 (2Nx2 02#2+24`^2>Ĭ2G`b2QF2Z 82cp2l 2saa`23^22"P22`$2 (22]21<2 l2O`2|2 p2p2 t3RgV3ͦ3`3!3) x33*3:%g3A=J3K_ 3Ug3_3hȘ3q 3yH333h:3h>3 93R3|g3g3 e3h3+03qz3*3dh,4Z4 b&4(4o4#  4) q41BR4:p4Gy~4Mstarttrap_resumerei_protoscb_netisr_DMPADDR1_DMPADDR2_cpfault_calimit_mbcopyemu1010_copyctxzerodiv_qs_sirtab_swtch_Vfmap_Swapmap_Xswap2map_whichqsfmterr_CMAP1_hardstop_msgbufmap_CMAP2brkpt__insque_clkticksgoodbye_consout_sudisable_edata_DMPMAP1_DMPMAP2_forkutlbuserr_main_rawintr_msintr_noproc_longjmp_softclock_hardclock_splimp_ESysmap_Sysmap_endbadtrap_scb_usrpt_CADDR1_camap_CADDR2_Forkmap_cabase_ctxutlspurioustrapv_setrq_spl0_syscall_spl1_spl2_spl3_spl4_spl5_spl6_vmmap_spl7emu1111_suibuf_xswaputl_clkmouse_Mouse_clknomouseprivviosoftint_iointr_Ctxmap_Usrptmap_ipintr_Xswapmap_remrq_suwptrchkinst_cnt_mmap_runrun_ufault_mbio_iopbs__setubyte__getubyte_clkrateillinst_sirmask_splx__setuword__getuwordlevel1level2level3level4level5_Sysbase_mbutl_msgbufaddrerr_Syslimit_u__remque_hpagmaptrace_pushutl_suend_panic_IOPBmap_idle_ecamap_cvtopag_Mbmap_MBBUFmapsyscall_trap_hsegmap_mbbufspace_vfutl_swaputl_xswap2utl_ndintr_scanc__setusword__getusword_splnet_Pushmap_mclrefcnt_null_hash_inet_netmatch_null_netmatch_afswitch_nmbclusters_mfree_mclfree_inet_hash_mbstat_if_ifwithaf_rootdev_if_attach_if_rtinit_if_ifonnetof_mpid_lbolt_nswdev_pfctlinput_avenrun_hostnamelen_runin_if_ifwithaddr_rawintrq_hostname_ifrequest_bcmp_tz_if_slowtimo_nchrdev_boottime_kmapwnt_panicstr_nswap_ipintrq_physmem_if_ifwithnet_rablock_boothowto_argdev_tick_runout_dumpdev_selwait_bcopy_ifinit_nblkdev_rasize_if_down_updlock_ifconf_maxmem_hz_swapdev_copyout_hostid_wantin_time_ifnet_dumplo_ifqmaxlen_hand_timeout_curpri_sbreserve_raw_disconnect_raw_bind_m_free_rawcb_raw_connaddr_raw_detach_m_getclr_raw_attach_m_freem_sbrelease_sofree_m_get_raw_ctlinput_raw_init_soisdisconnected_soisconnected_sbappendaddr_raw_input_socantsendmore_m_copy_raw_usrreq_sbwakeup_rtinit_rtnet_rtrequestlmodt_rtalloculmodt_rtredirect_bzero_routetoif_rtfree_rthost_rttrash_printf_arpmyaddr_arpinput_arpattach_etherbroadcastaddr_arpwhohas_looutput_arptimer_arpcom_arpipin_in_lnaof_in_cksum_arptab_arptnew_arptfree_arpresolve_arpt_age_loif_ipcksum_loattach_ipq_ip_id_ipstat_if_makeaddr_in_netof_in_pcbdisconnect_in_pcbbind_in_pcbdetach_in_setsockaddr_dmmax_in_pcbnotify_zdmap_in_pcbconnect_dmmin_zeroin_addr_dmtext_in_pcblookup_in_pcballoc_rip_input_tcp_input_icmp_input_tcp_ctlinput_udp_ctlinput_inetsw_nd_init_udp_init_inetdomain_nd_slowtimo_tcp_slowtimo_ip_slowtimo_tcp_fasttimo_tcp_usrreq_udp_usrreq_rip_output_ip_output_domains_tcp_init_ip_init_nd_input_udp_input_tcp_drain_ip_drain_icmp_send_icmp_reflect_iptime_icmpprintfsldivt_ip_protox_icmp_error_ip_deq_tcp_abort_ip_ctlinput_ip_forward_udb_pffindproto_m_cat_imin_ipprintfs_ip_stripoptions_ifinet_ip_freef_ip_reass_inetctlerrmap_m_adj_udp_abort_m_pullup_tcb_ip_enq_ipaddr_ipqmaxlen_ip_dooptions_ipforwarding_ip_optcopy_ipnorouteprint_tanames_tcpconsdebug_tcp_debug_tcp_alpha_tcp_debx_tcpstat_tcpstates_tcp_iss_tcp_trace_prurequests_tcptimers_tcp_betaffixifflti_tcp_savetifdoublei_tcp_templatefsinglei_tcp_close_tcpprintfs_sbappend_tcp_output_tcp_reass_sonewconnfcmpiieeeusedfmulifsubi_tcpnodelack_tcp_drop_tcp_pulloutofband_sohasoutofbandfaddi_sbdrop_tcp_canceltimers_socantrcvmore_tcp_dooptions_soabort_tcpcksum_tcp_respondffltis_tcp_initopt_tcp_setpersistuldivt_m_more_tcp_outflags_tcp_newtcpcb_tcp_timers_tcpexprexmtbackoff_tcp_backoff_tcp_attach_tcp_disconnect_tcp_sendspace_sbflush_soreserve_tcpsenderrno_tcp_usrclosed_soisdisconnecting_soisconnecting_tcpsenderrors_tcp_recvspace_udpstat_udp_in_udp_output_udpcksum_nbuf_klseqllmult_linesw_usetup_desscan_domaininit_setupclock_bclnlist_ntext_bswinit_swapmap_nproc_sum_roundrobin_inodeNINODE_freemem_rootdir_rate_desfree_avefree_maxpgio_bswlist_binit_bhinit_buffermap_maxfree_swdevt_ecmap_mount_sched_cinit_saferss_maxslp_iunlock_multprog_swptstat_inode_avefree30_buffers_icode_newproc_klout_buf_nscan_swfree_procNPROC_deficit_kltxt_ninode_pidhash_firstfree_startup_cdevsw_cmap_forkstat_pageout_cmhash_setredzone_nswapmap_nclist_klsdist_bufpages_bufhash_ihinit_minfree_cpu_cfreecount_schedpaging_klin_argmap_text_swbuf_mbinit_schedcpu_proc_startrtclock_inittodr_textNTEXT_iget_brelse_rqinit_total_kernelmap_lotsfree_cfreelist_ncmap_bfreelist_nswbuf_mbmap_bdevsw_ecmx_mountfs_cfree_read_rmdir_lstat_fsync_shutdown_okill_nosys_ssocketaddr_sigvec_ossig_connect_sysacct_ogtty_oswapon_vhangup_killpg_sstk_recv_ftruncate_truncate_ovlimit_write_ostat_setreuid_sethostname_gethostname_sync_ostime_otime_chmod_setgroups_getgroups_writev_smmap_ioctl_lseek_dup_mincore_saccess_revoke_sigsetmask_getdtablesize_execv_pipe_obreak_wait_recvfrom_outime_oumount_fchmod_setpgrp_getpgrp_osetpgrp_chown_utimes_flock_umask_reboot_ofstat_onice_readv_getgid_osetgid_symlink_oftime_send_getdprop_sbrk_ocreat_getpagesize_mremap_sendmsg_unlink_unmount_fchown_ovtimes_getpriority_setpriority_vfork_chdir_setdopt_getdopt_bind_sethostid_gethostid_rexit_madvise_ptrace_getsockopt_setsockopt_socket_smount_getitimer_setitimer_otimes_portal_fstat_wrap_rename_link_socketpair_accept_settimeofday_gettimeofday_execve_select_mprotect_chroot_getrusage_owait_fork_sysent_sigstack_sigpause_opause_setregid_sendto_open_munmap_close_stat_ovadvise_listen_recvmsg_readlink_getuid_osetuid_mkdir_sigblock_setrlimit_getrlimit_getpid_oalarm_dup2_profil_ostty_mknod_nsysent_callout_cp_time_dk_time_setsoftclock_dk_xfer_callfree_dk_seek_untimeout_ncallout_tk_nout_itimerdecr_psignal_tk_nin_setpri_aston_dk_busy_hzto_calltodo_dk_mspw_dk_wds_lastf_soclose_dupit_file_soselect_setjmp_selscan_closef_sleep_nfile_nselcoll_munmapfd_falloc_ufalloc_selwakeup_ffs_unsleep_itimerfix_ilock_binval_tablefull_setrun_funlocki_wakeup_timevaladd_getf_fileNFILE_seltrue_unselect_bflush_copyin_iput_vtopte_both_distpte_acctbuf_swpexpand_chksize_expand_vmemfree_grow_acctp_exit_suser_subyte_rmalloc_suword_namei_rmfree_schar_inferior_vrelpt_spgrp_vrelu_bdwrite_vinifod_vpassvm_fork1_uchar_vrelvm_bread_vsexpand_wait1_rdwri_procdup_getblk_realitexpire_pfind_ctxfree_xalloc_getvtimes_uaccess_access_swkill_ruadd_strlen_vgetvm_getxfile_fubyte_baddr_acct_fuword_setregs_leavegroup_groupmember_entergroup_donice_scale60_procxmt_gsignal_stop_sendsig_itrunc_maknode_okill1_issig_core_psig_slpquefdivi_ccpu_vmmeter_nrscale_setthetime_timevalsub_resettodr_timevalfix_boot_uprintf_printn_ttlowat_ttstart_harderr_tthiwat_traceback_putchar_cnputc_prf_ttyoutput_rmget_rminit_passuc_max_imax_suibyte_cax_cacur_vmaccess_min_nulldev_clearseg_camax_nodev_calloc_vmemall_mastertemplate_direnter_ialloc_irele_dirempty_iupdat_dirpref_dirremove_unixdomain_pfslowtimo_pffasttimo_pffindtype_flocki_sosend_blkclr_geteblk_rwip_bawrite_mfind_soioctl_uiomove_mapioctl_bmap_rwuio_bwrite_ureadc_nullioctl_munhash_mem_no_breada_soreceive_ipcreg_suiword_useracc_chgprot_traceoff_fuiword_traceon_ipc_soshutdown_piconnect_soconnect_sockname_soaccept_sobind_soqremque_solisten_sogetopt_socreate_sosetopt_getmdev_mctls_savacctp_wmemfree_wmemall_compress_forceclose_iflush_update_tctls_fctls_xumount_sbupdate_acctresume_acctsuspend_unmount1_mpurge_flushtty_wflushtty_maptab_ttyclose_ttyretype_putc_ttypend_ttyecho_ttydefaults_ttyblock_ttyopen_ttbreakc_ttread_catq_ttyout_ttrstrt_nextc_b_to_q_partab_ttyrub_ttyinput_getc_ttwrite_ottioctl_ttioctl_ttnread_nldisp_ttselect_ttyrubo_ttychars_ttwakeup_unputc_bkinput_bkclose_bkopen_bkread_bkioctl_ptcopen_ptsopen_ptsstart_ptcread_ptsread_pt_ioctl_ptcclose_ptsclose_ptyioctl_pt_tty_ptsstop_ptcwrite_ptswrite_ptcselect_ptcwakeup_q_to_b_putw_cwaiting_ndflush_ndqb_getw_syopen_syread_sywrite_syselect_syioctl_setblock_alloccgblk_hashalloc_fragextend_fragtbl_alloc_ifree_free_isblock_fserr_badblock_clrblock_mapsearch_fragacct_brealloc_around_ialloccg_realloccg_alloccg_blkpref_inside_allocbuf_incore_geterror_biodone_bfreemem_getnewbuf_blkflush_bfree_biowait_disksort_openi_xrele_owner_ifreetulmult_getfs_indirtrunc_ihead_ifreeh_ovbcopy_dirchk_dirrewrite_dirbad_dirbadname_blkatoff_syncip_syncprt_bufstats_getfsx_stat1_sostat_chmod1_chdirec_chown1_open1_fragtbl124_fragtbl8_ostat1_m_expand_m_pgfree_memall_m_clalloc_unixsw_uipc_usrreq_sodisconnect_sbwait_soqinsque_sbselqueue_unp_attach_unp_disconnect_unp_connect_unp_sendspace_unp_drain_unp_bind_unp_usrclosed_unp_abort_unp_recvspace_unp_detach_unp_drop_vtod_vstodb_mwait_vsxalloc_vsswap_vsxfree_vschunk_swap_memfree_pagein_vslock_mhash_vsunlock_munlock_munlink_meminit_mbmemfree_ptetov_mlock_zmemall_mapout_cleanup_klicnt_dpageout_kluster_preptofree_klocnt_ctxunload_getbits_nohash_noklust_newptes_fifo_klok_vpasspt_xfree_xrepl_xlink_vgetu_copyseg_vmdup_vgetpt_ptexpand_vusize_kmcopy_mapin_vrelswu_swapout_ctxpass_vinitpt_vgetswu_bigp_cexp_swapin_loadav_nbig_slowscan_fastscan_vmtotal_bplist_swstrategy_swread_rswbuf_swwrite_physio_minphys_physstrat_swdone_xunlock_xccdec_xswapwant_xswaplock_xlock_swdspt_swpt_xunlink_xwait_xuntext_settprot_mbdinit_mbbufmem_mbmemmap_configure_setconf_mb_hd_addintr_cold_physmbmem_iopbmap_dkn_mbbufmap_mbconfig_mbcinit_suread_ddstrategy_ndstrategy_xystrategy_arstrategy_tmstrategy_ipstrategy_xyioctl_msclose_tmclose_msread_tmread_xyopen_octclose_suwrite_cnmmap_tmdump_octopen_ipopen_suioctl_ndwrite_vpopen_cnopen_ddopen_aropen_xyread_mmmmap_ndioctl_vpclose_cnclose_arclose_tmwrite_ipread_octread_xydump_su_tty_ipdump_msioctl_tmioctl_ipwrite_octwrite_ddread_arread_cnread_ndopen_dddump_ipioctl_octioctl_mmwrite_mmread_cgmmap_msmmap_suopen_suclose_ddwrite_arwrite_vpwrite_cnwrite_ndread_mstty_octreset_cons_nddump_ddioctl_cgopen_msopen_arioctl_vpioctl_cnioctl_tmopen_oct_tty_xywrite_cnpoll_cnstart_cn_pendc_cngetc_peek_poke_cnintr_isbad_ocsum_swab_ctxinit_dumpsys_initname_version_fusword_initscb_bootflags_uinit_pmegreserve_bootf_etext_waittime_astoff_pmeginit_susword_exit_vector_fuibyte_dorti_kernprot_dumpmag_addupc_mbmemall_dumpsize_peekc_mmpeekio_pokec_mmrw_kernacc_nofault_pagefault_trap_type_showregs_syscalltrace_syscallnames_ndmapbuf_ndflushp_ndsize_nduout_ndsenddata_ndsmatch_genericsize_nddiskstrat_ndiodone_ndclear_setswapsize_ndswapsize_mbbuffree_ndsin_nderrreply_ndsout_ndumatch_ndlociodone_ndgetnp_ndstat_mbbufall_ndoutput_ndrootif_ndcopyctom_ndstart_ndcopymtoc_ndnull_nd_pmegalloc_pmegfree_ctxhead_context_pmegload_kernpmeg_ctxalloc_pmeg_ctxsetup_pmegunload_pmeghead_ctxfreelistd_packd_unpkg_intf_rcpffixisfloatflavorfmodiptwo_arprobe_arsleep_ar_softc_arintproc_armachine_ardebug_arstart_arstart_cmd_arattach_arinit_ardriver_arstatename_arcommand_armaxbufs_ar_stat_bits_ar_cmds_arintr_araddrs_ardinfo_arphys_cgintr_cgdriver_cgprobe_cginfo_cgstd_ddsize_ddprobe_dsdaddrs_ddwatch_dderror_ddslave_swlong_ddunits_ddcdriver_dddebug_ddgo_ddstart_ddattach_dddone_ddustart_ddcommand_dsderrors_ddrstart_ddctlrs_mbgo_DSD_cmdlist_ddwstart_ddcmd_ddintr_ddintrkludge_mbdone_ddticks_ddcinfo_dderrlvl_ddwait_dddinfo_ddwakeup_ipwstart_ipcdriver_ipdone_ipctlrs_ipint_iperrlvl_ipcommand_ipgo_iperrors_ipaddrs_ipticks_ipcinfo_ipdinfo_ipprobe_ipwait_ipattach_ipwatch_ipslave_ipustart_ipunits_ipcmd_ipsize_iprstart_ipstart_mbcopyst_intcnt_mbmhgo_ms_softc_ctmbuf_tmtimer_tmgo_tm_mb_tmintr_tmaddrs_rtmbuf_tmcinfo_tmphys_tmattach_mt_softc_tmdinfo_tmdriver_tmprobe_mttotm_tmslave_tmscp_mtutab_tmstart_tmdone_tminit_tmseteof_tmcommand_octinfo_oct_speeds_dmtooct_octtodm_oct_timer_octstd_octparam_octintr_octscan_octprobe_octsoftCAR_octattach_octdriver_octmctl_octstart_suattach_surptr_sudriver_suparam_suintr_susoftCAR_su_wr5_suprobe_su_clk_sumctl_supoll_sustd_su_cnt_su_speeds_suinfo_sustart_dmtosu_su_timer_sutodm_suact_vpstrategy_vpprobe_vp_softc_vpminphys_vpgo_rvpbuf_vpdone_vpdriver_vpbits_vptimo_vpcmd_vpintr_vpblock_vpaddrs_vpcinfo_vpwait_xydinfo_xydone_xyprobe_xyerrlvl_xywatch_xyerrors_xyslave_xyunits_xystart_xyecc_xythrottle_xygo_xyintr_xyattach_xyustart_xycdriver_xyctlrs_xywait_xyrstart_xysize_xywstart_xyaddrs_xycommand_xyticks_xycmd_xycinfo_ectrailers_ecread_ecget_ecintr_ec_softc_ecput_ecstd_ecdocoll_ecattach_ecdriver_ecprobe_ecreset_ecinfo_ecstart_ecinit_ecoutput_pupproto_entrailers_en_softc_enattach_enstd_endriver_eninfo_pupsrc_enprobe_eninit_enreset_pupdst_enoutput_enstart_enintr_nport_swpf_swsize_getchar_genericconf_getsb[elJI @bnbnbx3t\F' <̄ |@"|"QN.| |7(B̄o#4dNTNNNVH0*| Hy3N+X(U/-anX. f(-L-|78 nJg n"nRR` g,Hy3N+XHy78N.hX/Hy78aP`Hy78Hy3N+PHxHy78NdP,Jm /Hy78a&PR3 3o~`|NqL0N^NuNVH Hx Hy/. N . f$ g& g  gHy3NnX/9Hy3N+PHx  f <`p //. N f`/9Hx@/. N g` 9@*@  g f gB`/9Hy3N+P/9HU/. N g`R/9Hy3N+PBdBR`/9Hy3N+P/. yNXN\Hy3NnXNqL N^NuNVH *nB-gTB 3 @Jg, 3 @f 3 @0H`R`R 3 @JgJf `NqL N^NuNVH8*n(| BA &HJg8 fB  fR`Jg " Ҁ A R  gJg`B` " Ҁ AB f`J gZ " Ҁ A R-B 3 @Jg( 3 @0H g 3 @R`B " Ҁ ABNqL8N^NuNVH *nHxHU0-H4 @ PNP`NqL N^NuNVH *nHxHU0-H4 @ PNP`NqL N^NuNVH *nHU0-H4 @ PNXNqL N^NuNVH *nHU0-H4 @ PNXNqL N^NuNVHNqLN^NuNVH0*n B ."-!N1" -!N/$ ."-!N1"- F" - N/Ԁԭ ."-!N0v"-!@N1"-!(Ԁ -!,+B+m A+HHUNHXA(H ."-!@N0v" Ҁ A <C("QL0N^NuNVH0*ngJfNHy4hN+XB`RHy4sN+XBL0N^NuNVH8*n Jg nJf`/. HxaPJfJ .L0N^NuNVH0*nA(HJ m lxAN . -P .`|R /g(M`JgR /fTB/. HUa^P-@gJ.g/. /a6P*L`jHUHy4N+P`-| -| ."-!P-@Jg"+!,'@A'H l .R"+!"+4m + ` +!F4Ы S!'@HSNHXA(Hp0,ѕJgV L8N^NuNV.JgHy4N+Xp`^WJm l ."HA@@HABAЁ*@ @g+n . "<N1+@BB*nN^NuNVH8Jm n N.`nWJm4 l* ."HA@@HABAЁ*@ @fp`*&mJng -4-@JoA (H -",P-@/HUaP",d+@ ,HF-@ l .R",P"-4m ,0` ,HF4Ь4SL-@` -"<N1+@B-|A+H+nHUNHXg& -Ю4m .Ю+@ .A&HSRHH-@+K .L8N^NuNVH Jmp`B nr`Bg...N. n Sg . R @  f .` WJm4 l* ."HA@@HABAЁ*@ @fp`gf8+n+n -"<N1+@HUNHX. .ѭ `z -Ю4o -4-@..nRB`Vl,//. /-N. ݮ ݭݭĞ` ,-n .V/a X n R SJn .L N^NuNVH Jm: n0..` . R @HH/N-X SJf .`WJm4 l* ."HA@@HABAЁ*@ @fp`fg ."<N0vJg/.Hy4N+P+n+n -"<N1+@HUNX. .ѭ L N^NuNVH8J4dg0B "HA@@HABAЁ @BR mB4dB ."HA@@HABAЁ @JgR mHy5aX ."HA@@HABAЁ(@ @*n` (gRJf (gHy5N+XBp`B&|4`//.N1pPJgJfHy5$`|( 49@B`( ,gHHy54` 9n HHЁ0. 0l am fn HHWЁ`)GHH0)@ 0m* 9n$"HA HABAЁHHЁ0)@Jm o Hy5L` ,g Hy5``HUN/X)@`Jg )fHTNXJfRJf . RBB`fA )H)| )|BHTNHXHTHUanP.gJ g Hy5~`hHT/aPBB . R .VL8N^NuNVWJm6 l, ."HA@@HABAЁ-@ @fp` nf /NX nBBN^NuNVHy5aXN^NuNVB ."HA@@HABAЁ @Jg /.aRXR m/.Hy5N+PNNN^NuNVH<@*n -"HA,,HABAЁ(@ -( -=@ l -5 @` -&@)K()|)| )|BB)|)|B$Hy BHTHxaJgp`VB`By!Hy BHTHxaJfj yھ!f`BF=|$| `0F0.SnJ@fJFg /,Hy5N+P`(/,Hy5`p09!",f0.y!g>R mhJngp0./Hy5N+PHy5N+X`,p09!)@p09!)@p09!)@ p09!)@ -! @)Pp09!)@p09!)@p09!)@ Hy BHTHxaJfBL<@N^NuNVH0  f <` <. n,(*(*h ("HA,,HABAЁ(@` HU/HT/a.JfRJf n (ĐL0N^NuNVH<..*n ,.(n-m(B&|$K-Jz` nBRSJf-| J$g `vSn n(f|jn n .@ nB n| nB( n|&<Sn f"+|$`.+|$`$ $f,` g *f+|$ n| g f $g -"-N/" N1-@ -Ѯ . op`p "-N0v-@ fV  #    3    B9  fgHx/.HTN. -$ g2 g* gB`LBBHUHxaJf2`` n(gvSn`@BB+ $f (` r( ".@n fm `n|B+| B+ -"-N/" N0v"-N1Э@ n | B+ B+B+B+B+ n n| nB( n|`vSnJg gp-@p+` n(gvSn`@B*B* @ -"-N/" N0v"-N1Э@n .@n .@ | B* |@ B* | B*n .@B*B*B*B*B* nB n| nB( n|!`vSnJ*g *gp*-@p*-@ n| g0/.Hy6N+P fR mV` n| fgHxHT/.N. BLA .D*H/.HUHlN. A 7@p0 6 y oHy6 N+Xa`Pp0g8 .-@g y ".F7@p06p0 fL8N^NuNVH<*|(|B y -@p08 y oB`Xp0@f6A-H-|@`@A-H -@ @5P .X&@`:p0fA-H-| .T$@ j gA&HA0-H gZ n0 >mD j f: +M f0 k0f& +f ,f +f -"fHxHmHjN. A +P" f" g <6#` <6&/N+XHxHmF/.N. p08pL<N^NuNV.*|-|AF-H .Bg` -BR".f `H+n.B`aaJfR .m .fHy6)N+Xp`+nBHx/. /.N. B*nN^NuNVHBF . -@ ` n>TGB@@ . S Jf0F@LN^NuNVH<*n "<@N1"HA((HABAЁ`(@ -( -=@ l -6L @ ` -&@)K$p+.B)| )|)|9|,B`B  lBy!Hy ,", N//HTHxaJfF yھ!fazX`r Sr g:Jg Hx,aXX-| nHH, o/a4XR` n  oR`-T .R @HH,g/aX` Xg` dgn cg` lfHH,  ogo ugn sg~` xg`L0N^NuNV. fJlHx-a^X .D-@A*H .". N0p7 @ .". N1-@JfSHH/aXAb*nN^NuNV.../ y NX..N^NuNV. y N. g f~ fHxaXHx aX~/aX ..N^NuNVH `$ #g @gD`~ B`HSd*na.  g g g f*nHx a.X`L N^NuNV` n"n RR .SJfN^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^Nu"o /B/gS @`"Q g2gNuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@L(J1"VGbHk s:{%H&',/t/ jB.0v .-F11pi h;$1L5 ~~&.,6A{/HaQdpY ~af6Lh8%o 7`x";%6)  5 -0p1+/2brelsrt0.ostartmovcclrbeginHIGHboot.obootconf.osys.o_openi_find_sbmap_dlookip.ond.ondd.oDiagRetxy.odd.oprf.oDiagRetmachdep.oatol.obzero.obzero.olmult.oneg_resultpos_resultzero_resulta_negb_neglmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.o_openfirst_edata_main_endentry__rtt_read_exit_printf_lseek_devsw_retry_bootflags_bootf_copyunix_blknos_line_parseparam_b__stop_open_x_gets_iob_ndstrategy_ddstrategy_xystrategy_ipstrategy_devread_xyopen_ipopen_ddopen_devclose_ndopen_devwrite_devopen_nullsyslmult_atol_write_getcharlmodt_readdir_bcopy_putcharldivt_strcmp_getc_close_strlen_ipstd_ipparam_ipcmd_ndinit_ndread_ndhwreset_bzero_ndcksum_ndxmit_ndrecv_xystd_xyfwd_xyparam_xycmd_swlong_ddstd_ddcmd_ddparam_printnulmodtuldivt_prfulmultptwob[wlJq PbyVbnbx$,4<D=@F' |Bo#~N@0NNNV׌.BאHy}NuPXBHnHy}a -@HxHnHy}az -@Hx(Hnה/.NH .Jo&/Hnה/.NJ g0Hy}NuPXJlHy}NuPXHy}NuPX`߮א`..׌N^NuNV./.Hy}NuPP/. Nx$X/./. NKP.Jo ..N^NuNV.*nHxHU0-H~ @ PNP*nN^NuNV.*nHxHU0-H~ @ PNP*nN^NuNV.*nHU0-H~ @ PNX*nN^NuNV.*nHU0-H~ @ PNX*nN^NuNVN^NuNVH0*n B ."-!N{" -!Ny$ ."-!N{"- F" - NyԀԭ ."-!Nzz"-!@N{"-!(Ԁ -!,+B+m A+HHUNA0XA(H ."-!@Nzz" Ҁ A <C("QL0N^NuNVH0*ngJfNHy~NuPXB`RHy~NuPXBL0N^NuNVH8*n Jg nJf`/. HxaPJfJ .L0N^NuNVH0*nA(HJ m lxAN . -P .`|R /g(M`JgR /fTB/. HUa^P-@gJ.g/. /a6P*L`jHUHy~NuPP`-| -| ."-!P-@Jg"+!,'@A'H l .R"+!"+4m + ` +!F4Ы S!'@HSNA0XA(Hp0,ѕJgV L8N^NuNV.JgHy~NuPXp`^WJm l ."HA@@HABAЁ*@ @g+n . "<N{+@BB*nN^NuNVH8Jm n Nw`nWJm4 l* ."HA@@HABAЁ*@ @fp`*&mJng -4-@JoA (H -",P-@/HUaP",d+@ ,HF-@ l .R",P"-4m ,0` ,HF4Ь4SL-@` -"<N{+@B-|A+H+nHUNA0Xg& -Ю4m .Ю+@ .A&HSRHH-@+K .L8N^NuNVH Jmp`B nr`Bg...Nw n Sg . R @  f .` WJm4 l* ."HA@@HABAЁ*@ @fp`gf8+n+n -"<N{+@HUNA0X. .ѭ `z -Ю4o -4-@..nRB`Vl,//. /-Nx ݮ ݭݭĞ` ,-n .V/a X n R SJn .L N^NuNVH Jm: n0..` . R @HH/NwX SJf .`WJm4 l* ."HA@@HABAЁ*@ @fp`fg ."<NzzJg/.HyNuPP+n+n -"<N{+@HUNA^X. .ѭ L N^NuNVH8J~g0B "HA@@HABAЁ @BR mB~B ."HA@@HABAЁ @JgR mHy%aX ."HA@@HABAЁ(@ @*n` (gRJf (gHy8NuPXBp`B&|~`//.N{tPJgJfHyD`|( ~9@B`( ,gHHyT` 9n HHЁ0. 0l am fn HHWЁ`)GHH0)@ 0m* 9n$"HA HABAЁHHЁ0)@Jm o Hyl` ,g Hy`HUNxX)@`Jg )fHTNAXJfRJf . RBB`fA )H)| )|BHTNA0XHTHUanP.gJ g Hy`hHT/aPBB . R .VL8N^NuNVWJm6 l, ."HA@@HABAЁ-@ @fp` nf /NAX nBBN^NuNVHyaXN^NuNVB ."HA@@HABAЁ @Jg /.aRXR m/.HyNuPPN@*N^NuNVH<@*n -"HA,,HABAЁ(@ -( -=@ l - @` -&@)K()|)| )|BB)|)|B$Hy BHTHxaJgp`VB`By!Hy BHTHxaJfj yھ!f`BF=|$| `0F0.SnJ@fJFg /,HyNuPP`(/,Hy`p09!",f0.y!g>R mhJngp0./Hy NuPPHyNuPX`,p09!)@p09!)@p09!)@ p09!)@ -! @)Pp09!)@p09!)@p09!)@ Hy BHTHxaJfBL<@N^NuNVH0  f <` <. n,(*(*h ("HA,,HABAЁ(@` HU/HT/a.JfRJf n (ĐL0N^NuNVH<..*n ,.(n-m(B&|$K-Jz` nBRSJf-| J$g `vSn n(f|jn n .@ nB n| nB( n|&<Sn f"+|$`.+|$`$ $f,` g *f+|$ n| g f $g -"-Ny" N{-@ -Ѯ . op`p "-Nzz-@ fV  #    3    B9  fgHx/.HTNx -$ g2 g* gB`LBBHUHxaJf2`` n(gvSn`@BB+ $f (` r( ".@n fm `n|B+| B+ -"-Ny" Nzz"-N{Э@ n | B+ B+B+B+B+ n n| nB( n|`vSnJg gp-@p+` n(gvSn`@B*B* @ -"-Ny" Nzz"-N{Э@n .@n .@ | B* |@ B* | B*n .@B*B*B*B*B* nB n| nB( n|!`vSnJ*g *gp*-@p*-@ n| g0/.Hy.NuPP fR mV` n| fgHxHT/.Nx BLP.-`BHxDHUa(P SJfBL N^NuNV.*nBdHx4HUaP*nN^NuNV  fp0`p,-@ n-h-n-hJdg,BdB` n!n`0 n .Ѩ .Jo* Po n!|P/./.adP-@Jn fp`HJf .g #dJlB .-@ n!n n!n .N^NuNVH<*n 9B\(@ -&@A $H-|B . ,g 0gHxHRNyP . 4 . *刁* -*爁* -*刁*5n 5nHj Hy aP|| ,gA=Pp.-@ f .gBJgd gZ g f0B`n-m`-m/.Hy /-NyX `/.HyHNuPPp`, , fp0*//-Hy NyX p0*L<N^NuNVH<*n 9B\(@ -&@A $HHx"HTNyP yB"yBP 9BT/HTaTPTHlHla@P||.<B@J,gSnJnP/-HyXNuPPpLJg0HyDNuPX` JgHysNuPXB,p`|HxHTaPJf B,$Hx HTaPJ,$gjHxHTaPJg2JgHyNuPXHxHTaP`Hy`,f,gHy`,gHy`fB,-m`Hx HTa2PHxHTa&P .SJfB,#JgHyNuPXBL8N^NuNVH0*|l(mBHUaPHxHUaPHxHUaP|%B-#JgHyNuPXL0N^NuNVH0*n(|l  fp`p-@J,#gB,#B`N)m)mJo(/.HTa>PJgp`*J,#gJl -` -ĐL0N^NuNV.*n-m .  @* n(g gJg/Hy"NuPP+U* n n`HyCNuPXHUahXJg-fp0-/HybNuPPp`8|#`. n(gb n nHUaXJgBB*nN^NuNVH8*n(mJg/HTHUHypNuP  b@0;NJt:^@JtJt.*|$p`Z,g+U*` |`+U*Jg/HyNuPPB`|`|!`|$`|"`p-rA`p-r`,fJ,gHyNuPXA&HB,g~|,fJg,g`xSnAe+UBJg.p0- /p0- /Hy,p0-/HyNuP,f,g`D+U R*`|`Jg/-/-HyNuP  ` ,fJgHyNuPX,g l -` <.&mB`Rm` p,*R m+U*`|@`HJg:/-/-HyNuP ` ,fJgHy)NuPX,g.<&m`[ SJf+U*Jg/HyA .D*H/.HUHlNx A 7@p0 6 y oHyNuPXa`Pp0g8 .-@g y ".F7@p06p0 fL8N^NuNVH<*|(|B y -@p08 y oB`Xp0@f6A-H-|@`@A-H -@ @5P .X&@`:p0fA-H-| .T$@ j gA&HA0-H gZ n0 >mD j f: +M f0 k0f& +f ,f +f -"fHxHmHjNx A +P" f" g <` </NuPXHxHmF/.Nx p08pL<N^NuNV.*|-|AF-H .Bg` -BR".f `H+n.B`aaJfR .m .fHyNuPXp`+nBHx/. /.Nx B*nN^NuNVHBF . -@ ` n>TGB@@ . S Jf0F@LN^NuNVH<*n "<@N{"HA((HABAЁ(@ -( -=@ l - @ ` -&@)K$p+.B)| )|)|9|,B`B  lBy!Hy ,", Ny/HTHxaJfF yھ!fazX`r Sr g:Jg Hx,aXX-| nHH, o/a4XR` n  oR`-T .R @HH,g/aX` Xg` dgn cg` lfHH,  ogo ugn sg~` xg`L0N^NuNV. fJlHx-a^X .D-@A*H .". Nzt @ .". N{-@JfSHH/aXAb*nN^NuNV.../ y NX..N^NuNV. y N. g f~ fHxaXHx aX~/aX ..N^NuNVH `$ #g @gD`~ B`HSd*na.  g g g f*nHx a.X`L N^NuNV` n"n RR .SJfN^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^NuNVH0*n(n .. rN{.`0H2HЁ8TSlL0N^Nu"o /B/gS @`"Q g2gNuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@L{F|,P{Z{d<i{x||{<|~~@0 O@n@*HuPJ@J Kyx$] VGc6r\1k GP,Vh5A0> hF:NlNA~UZZ]oe]DnAxc    A^&AjU 'AMytxFBwzzExwF{{tJN iG;M${P& /~Q6m<?{yF $dMNBTWx[@Y.cyXi ls_~w^4=,-M5cgdahde, f:f 8n 7l";o`*X1r8 64A w@IztP{Wud\yc|hsrt0.ostartclrHIGHcopy.oconf.osys.o_openi_find_sbmap_dlookip.otm.o_c68t86ar.ond.ondd.oDiagRetxy.odd.oprf.oDiagRetmachdep.oatol.oswab.obzero.obzero.olmult.oneg_resultpos_resultzero_resulta_negb_neglmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.o_openfirst_edata_main_endentry__rtt_read_printf_getdev_write_open_gets_arstrategy_tmstrategy_ndstrategy_ddstrategy_xystrategy_ipstrategy_tmclose_devread_xyopen_ipopen_devsw_aropen_ddopen_arclose_devclose_ndopen_blknos_b_devwrite_devopen_tmopen_iob_nullsys_exitlmult_atol_lseek_getcharlmodt_readdir_bcopy_putcharldivt_strcmp__stop_getc_close_strlen_ipstd_ipparam_ipcmd_tmaddrs_bzero_tmeof_tmscp_tmcmd_tminit_swab_ar_softc_armachine_ardebug_arcmd_ar_stat_bits_ar_ctrl_hdr_ar_cmds_araddrs_ar_set_hdr_ar_bits_ndinit_ndread_ndhwreset_ndcksum_ndxmit_ndrecv_xystd_xyfwd_xyparam_xycmd_swlong_ddstd_ddcmd_ddparam_printnulmodtuldivt_prfulmultptwob[lJ/ف 2byWbPbPLTdl (0 x@CDT@ |D@!.HN@ _.HNuNVF'Hy PNXHy NXHyB8NXaHyB8NXHy NXHnN8XA-H`R n  g  gJg d-| ( nJgP/.NX-@ n (n .-@/ n//.N Jf* nJg* hN nJfVHy N`D `N^NuNV.Hy NXB`8 ."HA HABAЁ @//.Hy N R ."HA HABAЁ @JfHy NXN #BtlrHy NXNd#B(/9B(Hy +NPB(Hy @NXN #BpHy MNX BplHy ONXB 9Bt  @*P`*Hm/.Hy _N R g 8JfHy iNXN #>xHy uNX 9>xlx"HA88HABAЁ"9Bt  AА*@ fHy wNX*Hy NX+@Hy NX+@Hy NX+@ Hy NX+@ BtfHy NX퀁+|@Hy $NXHmN8XA#B,#B0#Bx#B$# B -?#B 9BtЭ @#B 9BtЭ @#B 9BtЭ @#B 9BtЭ @# B|JBfHy ;NX#BJBfHy JNX#BJBfHy YNX#BJB|fHy hNX#B| 9B|gHy |NX#B `BB -#BlB /9B/9B/9Bx/9B0Hy N Bf Bg/9B/9BHy N B|gJBtg/9B|Hy NPHy NXHxaXBa~X*nN^NuNV Jg < ` < /Hy NPN^NuNV Jg <` </Hy NPN^NuNV Jg <` </Hy NPN^NuNVHyNXHxaXHxaXN^NuNV 9Bt"HA HABAЁ @-PHy#NXHyKNXa>JgHyZNX-@-|>-|` n0T .SJfB>By>By> .g" 9B0йBxS"9BU> A0 y -PB`HJf/.HyyNPB`/././.af R .BmR 9B0йBx".m y -PJg .쐮/HyNPB .> @ PgD .g 9BU".ಀg 9B0йBx"9BN&U-@"9BN-@ ."9BN-@/./ .> @0/ .> @0/Hx` .g 9BU".ಀgp/9BB`( .gZHx .> @0/ .> @0/ .> @0/Hx aR ~ma> .g <` <//.HyN HyNXN^NuNVB`f lhHxHx/. 9BS/ 9B0йBxS/Hxa^Jf" | <C>"QJy>gT .BmHyNX-|>-|` n0T .SJfB>By>By>/9BB 9BS/ 9B0йBxS/HxaaN^NuNV |> <C"QB`@ lBHxHx/. 9BS/ 9B0йBxS/HxaLT .BmN^NuNVH0(| 9Br rN.B/9BB/. /.HxaJf/9BB/. /.HxaJfB`* " ҀeHx/9BB/. /.HxaJfFHx/9BB/. /.HxatJf"*L " Ҁd4 gHyNX .B0m @ Pg` 9BU".gB > @0f( .> @0 f Hy\`R ~m ~m Hyl` 9B0йBx"9BN&U-@"9BN-@ ."9BN-@ .䰹B0l Hy` .> @0 . йB".> A0/./.HyN p`VB`" .T//./. /.aDѮR .BmJf/. /.HyN .L0N^NuNVH0(|.<Hx/./. /.HxaJfHx/./. /.HxaJf.<B` .rN < @,*L`* " ҀeHxHx/./. /.HxazJf8HxHx/./. /.HxaVJf*L " Ҁd: g/./. /.HyNB`~HyNX`R .m8B`t .> @0f, .> @0". ҮfHyA`R ~l .> @ Pf ~ld 9B0йBx"9BN&"9BN&BS-@ 9B"9BN&" .N-@ 9B"9BN&" .N-@"9BN-@ ."9BN-@ .谹B0l HyQ` .> @0 . Ю".> A0/././.Hy{NpL0N^NuNV 9Bt"HA HABAЁ @-PHyNX .g.HyNXHyNX-|-yB`,HyNXHyNX-|@-|/.HyGNPNx-@/.HyUNPNx-@ .g8 ."9BNJf ."9BNJgHyaNX` .䰮n././.HyN /.HyNP`NHyNX-@apHyNX/.NXHyNX .S/NXHy NXa Jg-n`HyNX/.NX 9B"9BN&" .N-@ 9B"9BN&" .N-@"9BN-@ ."9BN-@ .йBn /././.a 9BѮ`/./././.aR .찮m(B .> @ Pg .> @0"9BN"9BN-@ .> @0"9BNѮ .f .> @0Ѯ .찮m @0/ .> @0/Hx` .g 9BU".زgp/9BB`( .gZHx .> @0/ .> @0/ .> @0/Hx a R ~maBN^NuNV. 9Bt"HA HABAЁ @-PaHyNXB .>*@ Ugz .g 9BU".gJ 9B0йBx"9BN&U-@"9BN-@ ."9BN-@/./.p0-/p0/Hy$N` 9B0йBx"9BN&"9BN&BS-@ 9B"9BN&" .N-@ 9B"9BN&" .N-@"9BN-@ ."9BN-@/././.p0-/p0-/p0/HyANR ~mtJfHyeNX ~mHylNX`~HyNXaJgfHyNXHyNX:Hy NX;@ .gp0-/p0/Hy N aLJf:`09Bm 9B0йBx"9BN&U-@"9BN-@ ."9BN-@/./.Hy2N .g /./.p0-/p0/Hx`V .gP/9BB`(HyDNXmp0-/p0-/p0/HyZNaHJg 9B0йBx"9BN&"9BN&BS-@ 9B"9BN&" .N-@ 9B"9BN&" .N-@"9BN-@ ."9BN-@/././.HyoN .g.Hxp0-/p0-/p0/Hx apa*nN^NuNVHyNX y -PB`*/.Hxa2P 9B0S/HxaPR .B0m y -P ./HyNPN^NuNVHyNX-@HyNX-@HyNX-@HyNX-@ y -P-n`Jfn ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N/HyNHx/. ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N//.a .Ѯ .Ю".m y -PJg .䐮/HyNPN^NuNVHyNXHxaXXN^NuNVHyNXHxa8XN^NuNVHy NXHyNX-@Hy.NXaJgrBa\"9B0N-@aH"9BN-@a4"9BN-@a "<N-@-|` nR .r ".䲀eHx/./././.Hxa:-|` nUR .r ".䲀eHx/./././.Hxa-| .r ".䲀d AgN/./././.HyWN ./ n/HydN `R`N^NuNVHylNXa"9B0N-@a"9BN-@a"9BN-@HxHx//./.Hxa`NVHy{NXBaXN^NuNVNx-@HyNXNxѮ ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N//./.HyNN^NuNVNx-@HyNXNx ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N//./.HyNN^NuNVHyNXHyNXHyNXHyNXHy$NXHyCNXHyfNXHyNXN^NuNVHnN8X .yg .Yfp`BN^NuNVHxHx ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N/HxaN^NuNVHxHx ."9BN/ 9B"9BN&" .N"9BN/ 9B"9BN&" .N/HxaN^NuNVaP/.(/.$/. /././././. /. 9Bt"HA HABAЁ @ PN$N^NuNVNB-@ fHyNXHyB8NXN^NuNVNxN^NuNV/.aLXJfHy `Hy NXB` n0(B$fpN^NuNV-|BHy!NX nB nBhHxHxBBBHxN` n hھf/a`XJf n hھgHy!NXHy!"NXN_JfB`<-| nB nBhHxHx/. 9BS/ 9B0йBxS/HxN` n hھf /aXJfT m mHy!LNX`pHy!dNX-|/.Hy!yNPJB$f nJhg n0(/Hy!NPBB .".Ё @Jg` .a/Hy!NP .".Ё @/( .".Ё @/Hy!N -| .".Ё @ .B"@"#hR mNJf Hy!`JgHy!NXN_Jg*HxHxBBBHxN`-|HxHx/. 9BS/ 9B0йBxS/HxN`T mpN^NuNV-|Hy"NXJ f8 9Bt @-P nJg//9B,NPJf\# J g$/9 Hy"#NPN_JfB J f,Hy"JNXHy"NX``~Hy"NXN_Jg-nB nBRR m/9B/9B/9Bx/9B0/9B,Hy"/.N n1yB2 n1yBz n1yB n1yB n1yB& n1yB n1yB n1yB n1yB~B 9 @".Ё @ .".Ё"@"#hR m n1|ھ/.aXHxHxBBBHxN`-|HxHx/. 9BS/ 9B0йBxS/HxN`T maN^NuNV.Hy"NXB`b 9Bt @ ".Ё//.Hy"N Hy" 9Bt @ ".Ё/NPJg&R 9Bt @ ".Ё @Jf~Hy#NX-@JmRnJ 9Bt @ ".Ё-@Hy#/.NPJf$Hy#NX/.N8X-|`Hy#3NXN_-@JgB .a/Hy#VNP .@".Ё @/Hy#eNP .@".Ё @/(Hy#wNPHy#NXN_JgJHy#NX".@$.҂ A Hy#NX".@$.҂ A!@R m,/.Hy#NPB .@".Ё @JgX .a/Hy#NP .@".Ё @/( .@".Ё @/Hy#N R mHy$ NXN_JgJ# Hy$.NX$.N^NuNVBn=|-n` n0nT0.SnJ@fJngB`pN^NuNVBn=|-n` n0nT0.SnJ@f n1nN^NuNV. . bt@0;N :T`THy%NX yB((. gHy%NX @gHy%NX  gHy%NX gHy%NX gHy%NX gHy%NXHy%NXB` 9BtJg g,Hy%NX`# BBBBBBHx`LBB-|@ 9B$йB n@ nB n| nB( nyB nyB nyB n| n| n| nB( n| Hx@B/9BBBHx`/./9BB/./. Hx`B/9BB/./. Hx`l/./.B/./. Hx`TBBBB/. Hx`B/././././. Hx`(/././././. Hx`BBBBBHxa ..N^NuNVH-|-|BB nn  nB nB( . n@ 9Bp*JBtfp`  n( .  n@ nn f Btg f4 nn . n@ . n@ .Ю`> nn .r⠀B n@ . n@ . n@ .йB$ n@ 9B( n@ n| 9B n@ nB( nB( nB( nB( nB nB( .r⠀B yB( . yB(@ . yB(@ yB(| nJg g yB(|BR m nJ(gp`B n (Agr`Bg n(/( /( n(Ё/($ @/ n(/($h @/Hy&N n (Ag g R m n g* g n/Hy&=NP``Jf nJ(g n(/(g <&` <&/ n(g <&` <&/ n(/( /( n(Ё/($h @/Hy&PN B` n(/( /( n(Ё/($ @/ n(/($h @/Hy&NpLN^NuNV. . b`@0;N &@`@Hy,hNX yB((. gHy,qNX @gHy,NX  gHy,NX gHy,NX gHy,NX gHy,NXHy,NXB`| yB(B(-|@ 9B$йB n@ nB n1| nyB# nyB nyB nyB n| n| n| n| n| nB( nB( nB( nBhHx@B/9BBBHx`/./9BB/./. Hx`B/9BB/./. Hx`l/./.B/./. Hx`TBBBB/. Hx`B/././././. Hx`(/././././. Hx`BBBBBHxa ..N^NuNVH-|-|BB nn  n nB( 9Bp n@ n1n f. n1n n1n nB( nB( nB(`J n1n n1n .r n@ . n@ . n@ .йB$ n@ 9B( n1@ nB( nB( nB( nB( nB( nB( nB( nB( .r yB( . yB(@ . yB(@/.a\X yB(|# nJ(g (fB lR` n (g& (g n(/Hy,NP/.aX nJ(g (AgJg n0(/(/0(/( @Od (d <,` n(+l @ / n(/(+0 @/Hy,N n (Agl (g R mV n (gF (g> R l2BJgHy,NXBBBBBHxa` n( g, g n(/Hy-NP`bJf nJ(g n(/(g <-V` <-h/ n(g <-D` <-U/ n0(/(/0(/(+0 @/Hy-N B` n0(/(/0(/( @Od (d <-` n(+l @ / n(/(+0 @/Hy-iNpLN^NuNVHx .\/ .\/N Hx .P/ .P/N Hx . / . /N Hx ./ ./N N^NuNVH0 BtgHy2NX`HxBBBBHxa-@B/.Hy2NPNx-@*|ReHxBBBBHxaP-@*|(|BBgRR mJg/.Hy2NPNa.R`dL0N^NuNVH0*yB((| . b@0;Nn8J\b|`Hy3NXp-. gHy3NX @gHy3NX  gHy3NX gHy3+NXHy32NXBBBBBHx ap, . @g <3E` <3O/Hy34NP gHy3UNX  gHy3^NX gHy3oNX gHy3NX gHy3NXHy3NXB`Hp-.BBBBBHxa8 BtgBB 9BS/ 9BS/ 9B0йBxS/Hx `B/./././. Hxa. Btf `Hx/./././. Hxa`Hx/./././. Hx`vHy3NXp`jBBBB/. Hx`R/.`/././././. Hx`2BBBBBHx`"#HxHx/././. Hx aL0N^NuNVH -|BB*yB(Hx/.NTP n n n. (( n9Bo(?툁( n9Bs(( n(( nn nn Btf n nyB' n n1n n1n n1n . n1@p--@p-gB lR`BB-||| BtfBR mp-gB lR` n(f nJ(glJgV/././. n(28 @/ n(/ .1 @/Hy3N R m n(fB nJ(f8Jg,/././. .1 @/Hy3NB`X/././. n(28 @/ n(/ .1 @/Hy4 NpL N^NuNVH0*yB( (@ . b@0;N@F@Rr`:,< SJnHx`HTNTP,,HlaX-@ @)P|||9|HlaX-@ @)PHl&aX-@ @)P:,< SJn:,< SJn`,< SJnJ,f:,< SJnHy7NX 9B0йBx9@DyB{JB,FyBGyBIB,H|K /HxBBBB`RB`RB,[yB^nZn]n\n_ /HxB/./. Hx`B 9Br /B/./. Hx`|[yB^ .@Z .@]n\ /HxB/./. Hxa.Jg `|@[yB^B,ZB,]B,\B,_ /HxB/./.`DBBBB/. Hx`>/. .r //././. Hx`/. .r //././. HxaL0N^NuNVH8*yB( (@A&&HBHxHSNTPBkn 9Bs+ +    7nnn/.aX-@ @'P/.a:X-@ @'P|B,:*< SJn:*< SJnBB ,g fDJf>*< SJnJ,g$p,p,B,Jg:*< SJn fB`Jgz /Hx BBBHxaJgD/././. p,Y/aX/p,Y/ .6 @/Hy7N R m\Jf:Jgl/././. .6 @/Hy7N``J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVA-HA#B=|B-n-|Hn/. NPSm .R @BHH`HnBNTP .N^NuNV4.-nB`b yB S m. .R @HH yB"(R!AS AHH` /9B .R @HH/NTPR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH; @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH; @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|;<-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|;= PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|;?`J.g-|;AJ.g"/.NX".-A< o-@ .Xf -|;CL`-|;TLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|;e`-|;h`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn .R l .R`p//./.Nh-@Jg -|;k`J.g -|;m`J.g-|;oAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9;(/9;$ .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9;0/9;, .".Nfp+`p-S n.HH; @gpE`peS n`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn *LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nr .B`T0-f(mfHn-HH/NPJmJn -|`-npe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N*XJl~0-g /-N:XBBBB BmB- L N^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NXPJlB`pN^NuN|HxN@eBNuNV/. Hyt /.N~ N^NuNV/. Hy@t/.N~ N^NuN|Hx6N@eNuNVH0J,f8 <0#, <,#0#08#,4 .^rN.*y4B@ g`(*(U g " Ҁe " Ҁd(M *@b8f,gB`R@ @o "<N#@BN:X(@ 9@" Ҁe 9@/N:X(@g y8 98Xg y8  9@" ҀY(#8 <, A ` " Ҁ#44c A#< A 94*A L0N^NuNVH0*n(MY#4 (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ < L0N^NuN|HxN@e#>tBNu /й>t/@HxN@e 9>t#>tNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL`CDC-9730-24>`CDC-9730-124`Ampex-Scorpio`Ampex-CapricornbBASF-6172OtherJG`Fujitsu-M2312K (Sun D84)4`Fujitsu-M2284 (Sun D169)`Fujitsu-M2294`Ampex-Capricorn4`CDC-9730-160Other@Tandon TM 703,Tandon TM 503Atasi 3033Atasi 3046,Seagate ST419OtherOtherOtherJ]Q]xZfdEfiA*rEwE~FdaF8PfTYz[[[_D_D^^mm Disk Initialization, Diagnosis, and Repair (Maybe) When asked if you are sure, respond with 'y' or 'Y' diag> What? specify controller: %d - %s which one? Specify controller address on the Multibus (in hex): Device address: %x Which unit? Specify drive: %d - %s which one? # of data cylinders? # of alternate cylinders? first head? (usually 0, 2 for Lark fixed) physical partition? (usually 0, 1 for Lark cartridge) # of heads? drive type? ASCII identification? # of sectors? size of gap1? size of gap2? interleave factor? # sectors per group? ncyl %d acyl %d nhead %d nsect %d gap1 %d gap2 %d interleave %d timing %s onoffinformational messages %s onofferrors %s onoffclear DISK FORMAT -- DESTROYS ALL DISK DATA! are you sure? # of surface analysis passes? cyl %d %d ms format complete - %d bad %s(s) tracksectorUse the label command to label the disk. No bad sector/track table found -- assuming none bad data readback error! %d/%d: bad alternate track %d/%d: bad track: already mapped BAD TRACK TABLE OVERFLOW - DISK UNUSABLE! ALTERNATE AREA OVERFLOW - DISK UNUSABLE! mapping to %d/%d %d/%d: track error, but no sector errors! %d/%d/%d: bad sector: BAD SECTOR TABLE OVERFLOW - DISK UNUSABLE! already mapped ALTERNATE AREA OVERFLOW - DISK UNUSABLE! mapping to %d/%d/%d fix -- DESTROYS SOME DISK DATA! Formats a range of tracks. Enter track numbers as 'cyl/track' trackFormats a range of sectors. Enter sector numbers as 'cyl/track/sector' sectorstarting %s? ending %s? can only format on track boundaries! ending %s must be greater than starting %s format will NOT include ending %s # of surface analysis passes? OK to format from to ? Current mapping: track %d/%d mapped to %d/%d sector %d/%d/%d mapped to %d/%d/%d None. Map table full - no mapping may be added. Do you wish to add a mapping? mapping may be removed only by complete format of the disk. cylinder to be mapped? track to be mapped? OK to map %d/%d? mapping to %d/%d sector to be mapped? OK to map %d/%d/%d? mapping to %d/%d/%d seek test seek test done - %d ms starting block? # of blocks? increment? # of blocks per transfer? %d/%d/%d %d ms write read test # of sectors per transfer? This writes on disk, type Y to proceed: %d|%d|%d|%x !%x@%d position test status +=%d=0x%x=%d/%d/%d -=%d=0x%x=%d/%d/%d -- commands are: diag (to re-initialize), quit format, label, verify, partition, map fix (for partial formatting) clear (to clear drive faults) read, write, seek, test, position errors (off/on), info messages (off/on), timing (off/on) status, + (add), - (sub) Command aborted Interphase SMD-2180Interphase WDC-2880Interphase SMD-2181Xylogics 440 (prom set 926)Data Systems Design 5215Xylogics 450statuspositionpartitiontimediagnoseinfoerrorsclearlabelverifyformatfixmapseekwritereadtest?help+-quitFujitsu-M2312K (Sun D84)> C _lFujitsu-M2312K (Sun D84 - 3 User)AF.| x<Fujitsu-M2284 (Sun D169)> /A(OtherFujitsu-M2312K (Sun D84)> G?`Fujitsu-M2312K (Sun D84 - 3 User)=@F+xFujitsu-M2284 (Sun D169)> 2?@OtherTandon TM 703> ,V@Atasi 3033> (GaOtherFujitsu-M2312K (Sun D84)> G?`Fujitsu-M2312K (Sun D84 - 3 User)=@F+xFujitsu-M2284 (Sun D169)> 2?@Fujitsu-M2351 Eagle (Sun D474)>  `7 OtherHHCORRUPT LABEL!! MISPLACED LABEL!! verify label NO LABEL!! Do you wish to search for backup labels? No backup label found. Backup label found. id: <%s> Physical partition #%d Partition %c: starting cyl=%d, # blocks=%d No logical partitions!! Do you wish to restore the primary label? label this disk... OK to use logical partition map '%s'? Use partition command to define logical partitions, then re-issue label command. Are you sure you want to write? %s cyl %d alt %d hd %d sec %dSelect partition table: %d - %s OtherWhich one? OtherName this partition table: Do you wish to modify this table? Partition %c: starting cyl=%d, # of blocks=%d Change this partition? starting cylinder? # of blocks? Verify partition table '%s': Partition %c: starting cyl=%d, # blocks=%d OK to use this partition table? Use the label command to write out the partition table. &&&&&&&''' '''!'#'%'+':'O'Z'w''''''( ((=(X(c(x((((((()))0)M)h))))))))))))****** * **#*7*C*^*y*******++status: unit-3-ready unit-2-ready unit-1-ready unit-0-ready done busy IP: Unknown controller type!!! %s retry #%x, %s, cyl=%d, head=%d, sector=%d unknown status %x %s worked, cyl=%d head=%d sect=%d%s%s retry=%d error-corrected reseek-performed%s failed #%x, %s, cyl=%d, head=%d, sector=%d readwriteverifyformatmapswitchinitialize?restoreseekzerospin down??resetdisk not readyinvalid disk addressseek errorECC code error -- data fieldinvalid command codeinvalid track in IOBPinvalid sector in command(spare #17)bus timeout or drive powered downwrite errordisk write protectedunit not selectedno address mark -- header fieldno data mark -- data fieldunit faultdata overrun timeoutsurface overrunid field error -- wrong sector readid field ECC error(spare #23)(spare #24)(spare #25)no sector pulsedata overrunno index pulse on write formatsector not foundid field error -- wrong headinvalid sync in data fieldinvalid sync in header fieldseek timeout errorbusy timeoutno normal complete at beginning of a seekrtz timeoutformat overrun on data??????????????unit not initializeddisk busy executing(spare #42)ANSI bus timeout -- type 1ANSI bus timeout -- type 2ANSI bus timeout -- type 3ANSI bus errorillegal commandillegal parametertime dependent command errorcommand rejectseek error(spare #4C)unspecified seek errorread/write fault----------------...".?.T.j......// /+/@/P/t////////0000M0`0m00000000000000000001 1&1A1\1k1{111111status: unit-3-ready unit-2-ready unit-1-ready unit-0-ready done busy weird status %x %s retry #%x, %s, cyl=%d, head=%d, sector=%d ??restore unknown status %x %s worked, cyl=%d head=%d sect=%d%s%s retry=%d error-corrected reseek-performed%s failed #%x, %s, cyl=%d, head=%d, sector=%d ??readwriteverifyformatmapswitchinitialize?restoreseekzerospin down??resetdisk not readyinvalid disk addressseek errorECC code error -- data fieldinvalid command codeinvalid track in IOBPinvalid sector in command(spare #17)bus timeout or drive powered downwrite errordisk write protectedunit not selectedno address mark -- header fieldno data mark -- data fieldunit faultdata overrun timeoutsurface overrunid field error -- wrong sector readid field ECC error(spare #23)(spare #24)(spare #25)no sector pulsedata overrunno index pulse on write formatsector not foundid field error -- wrong headinvalid sync in data fieldinvalid sync in header fieldseek timeout errorbusy timeoutno normal complete at beginning of a seekrtz timeoutformat overrun on data??????????????unit not initializeddisk busy executing(spare #42)ANSI bus timeout -- type 1ANSI bus timeout -- type 2ANSI bus timeout -- type 3ANSI bus errorillegal commandillegal parametertime dependent command errorcommand rejectseek error(spare #4C)unspecified seek errorread/write fault4<4@4F4K4Q4V4[4a4h4q4x44444444445 5525A5I5T5f5n5v555555555566606B6T6f6n6}666666dmatest only allowed on Xylogics 450 %d :%d differ status: busy error double-error ready drive status: %snot readyready off-cyl write-protected dual-port-busy seek-error drive-fault Xylogics mapping not supported! %s retry #%x, %s, cyl=%d, head=%d, sector=%d %s worked, cyl=%d head=%d sect=%d %s failed #%x, %s, cyl=%d, head=%d, sector=%d nopwritereadabortslipseekresetformatread allstatuswrite allset drive sizeself testbad cmdmaint buf loadmaint buf dumpno errorinterrrupt pendingerror pendingbusy conflictoperation timeoutread err - header 2CRC/hard ECC errorcyl addr errorunknownslip errorsector addr errorunknownunknownsector switches wrongmemory addr errorunknownunknownunknownseek err - header 1unknownwrite protectbad commanddrive not readyzero sector countdrive faultsector switches wrongself test error aself test error bself test error cunknownsoft ECC errorfixed ECC errorhead errordisk sequencer errorunknownunknownunknownseek error8h8s888888888888!8"9#9#$9,%9<&9M'9b(9q4959697989A9B9C:D:E: Q:5R:GS:\T:mU:}V:W::dsd controller initialized %s retry %x (%s) cyl=%d, head=%d, sector=%d %s worked, cyl=%d head=%d sect=%d%s%s retry=%d %s failed %x (%s), cyl=%d, head=%d, sector=%d unknown errorinitializeerror statusformatread IDreadverifywritewrite from bufferseekRAM errorROM errorseek in progressillegal format typeend of mediaillegal sector sizediagnostic faultno indexinvalid commandsector not foundinvalid disk addressunit not readywrite protecteddata ECC/CRC errorID ECC/CRC errordrive faultcyl address miscompareseek errordata field not foundwrong type of data fieldindex too earlyindex too later/w controller errortape not in placetape write protectedtape not on-linetape data errorno data on tapedata miscompare in diagnosticunknown tape error0123456789ABCDEFBad number, re-enter: Bad number, re-enter: %d/%d/%dBad number, re-enter: -+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$>pDb[lJ/ρ 2byWbPbPLTdl (.@ @ a|#jP(q|-y`28>,H PhW`is zTT{qx:bjvFhhhT#\*.\2\:x@GLPYr\F_chou?~ t,xz0 h!(F/X50<XDJPU^4etl sz~ ?>jD(D&D.6@J<O^jbm<qz$3$8x ``p<xF<ll| @&~@, D1&7>x>_DFOWzd`A h i>xo,f|N(I: > @PfF8KE[]xqae``5E zB ~B -#B/ B6< BCa.M B XD`: i q[z VB$ B(}EfLFA*y ( B, B0 dB8YF@T Bl E_Jw`& Bp,M7D[?^FEafN V[Yz^]h q Bt}HJ4q| DBx 9B|t y8d < B  B$~jP`x[_! |^zNa|"*H2:B" IFRZ Bejo7iy$l B$h+lsx+0 j28o}8py`{Tj1;d,` 6-66j<qBH PB,YRb(hi BqyfT;nfhl6D?<r  Bz:L* ;* >p  .< 3 ' / b 7j > E Kx R\ X\ _ eY ns wH }Q R6  Z l  | X ~ 8 8d :  & stack.odiag.oDiagRetlabel.oip.oiq.oxy.odsd.oprf.omachdep.oDiagRetrand.osetjmp.osetjmp.ostrncmp.oswab.obzero.obzero.oatoi.olmult.oneg_resultpos_resultzero_resulta_negb_negsprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ofstat.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.ostart_main_endlmult_getbn_C_help_strncmp_printf_C_label_s_huge_drive_C_partition_putbn_getbadulmult_dkbad_altmap_C_fix_C_format_C_errors_C_test_C_position_C_verify_putblk_C_info_physpart_pgetn_nhead_s_basf_setjmp_longjmp_s_lark_maygetchar_nsectlmodt_errno_tryabort_groupsize_pgetbn_ctlrtab_timing_C_write_smd440a_basehead_devaddr_C_time_C_clear_DSDcmd_C_diag_commands_ascii_id_ncyl_abort_jmp_transferldivt_s_ask_C_map_drivetype_st506_getblk_fmttrack_s_norm_unit_fmtsector_C_read_C_sub_random_errors_C_seek_C_status_currmap_controller_putbad_smd_IQcmd_acyl_interleave_getn_gets_s_st506_getx_passdata_gap1_gap2_strlen_IPcmd_devcmd_rand_confirm_specs_C_add_XYcmd_infomsgs_islabel_dkmap0_dkmap1_dkmap2_dkmap3_dkmap_sprintf_strcmp_currparts_mk_cksum_ck_cksum_IP_errlist_IPexec_bus_IP_cmdlist_IQ_errlist_IQexec_swabiopb_IQ_cmdlist_swab_XY_errlist_XYexec_C_dmatest_bzero_XY_cmdlist_swlong_DSDexec_dsderr_ptr86_DSD_cmdlist_dsderrs_atob_atoi_atox_printn_getchar_putchar_srand__pfile__print__flsbuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_fstat_close__lastbuf_malloc__iob_isatty_fclose__sibufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodtcerror_gtty_ioctl_stty_realloc_sbrkuldivt_brkb[lI< K**bxEstty dec set path=($path /etc) set noglob; eval `tset -Q -s`; unset noglob b[lڧG^ )sfbxb[lI **bxFset history=32 b[l˻ =byP*bxGPATH=/etc:/usr/ucb:/bin:/usr/bin:. stty dec export PATH TERM b[lٺ7+*M*Obx (" ph$G"I#HTHS/N4 /N׀XNuNuNVH o n h +fSX R&@B o2 n h -f$ n h (vfR`RSX oJHy n /(NP#& f* n /(HyHy N HxN׀X` # `& oJHy n /(NP#+df* n /(HyHy N HxN׀X` # t+dB&Ba vB!NaL*J&@gN&Hy& NnXNB#+`a J&@gHyNŒXaNnRJ+`fJ&@gHy!NŒXaJ&@gHy*NŒXNJ&@gHy1NŒXa2NnRJ+`frNJffa/9+dNNXo,Jf/9+dNNXJg8/Hy9Hy N /9+HyHHy N /9&LHy[Hy N /9!HyqHy N /9+XHyHy N /9 HyHy N /9&HHyHy N /9&HyHy N /9*PHyHy N /9&HyHy N /9HyHy N /9HyHy N /9+pHy"Hy N /9&Hy@Hy N /9 HySHy N /9+hHykHy N /9+lHyHy N /9HyHy N /9&DHyHy N /9+\HyHy N /9HyHy N /9+xHyHy N /9+HyHy N /9+|Hy$Hy N /9$HyBHy N /9HyVHy N /9HytHy N /9 HyHy N /9HyHy N Hy NNXHxN׀XNqLN^NuNVH0(|& a6. -@ `N*@ 9L&Pf9&QHH`T+|`+|`+|` +|NqHy&RavX+@`D+|Hy&Qa\X+@`* Eg Fg Lg Sg`B`BBHy&PaX+@`N*@'B- y+t Lf y+t(HH`\+|`+|`+|` +|Nq 9+tT/aX+@`H+| 9+tR/a~X+@`* Eg Fg Lg Sg` y+tJg y+t -gR+t` y+tJf`/9+taX+@`&B+m -Hy&PaX+@`N*@n y+t (Lg*Hy&PaX+@B+m -@` y+tB(/9+taVX+@V+t`N*@nB y+t Lf y+t(HH`\+|`+|`+|` +|Nq 9+tT/aX+@`H+| 9+tR/aX+@`* Eg Fg Lg Sg``j y+t pfD y+t (cf6 y+t (@f(B+m -@Hy&PaDX+@`B+m/9+ta(X+@`lN*@nB+m/9+taX+@`> g g g g: 'g -g`B+L)M(MB fp` &fB``NqL0N^NuNVH *|&PB y& S m" y& (R!@S @HH`/9& NX. g>Jf :fBp`4 f&Pf`Ba` fR`|Bp&`NqL N^NuNVH *nBHH, 0m( 9n "HA HABAЁІ0.`SJg -gB` `NqL N^NuNVH0*y&"g6/9+dHUaPJg /-N X(m+y& #&*L`NqL0N^NuNVH0*nHUNX.JfB`&Hx R/NP(@HUHTNP `NqL0N^NuNVH8*|0&UgRHH+HHЁ+HHЁruN((@Jge(|(`Y(P`NqL8N^NuNVH8&|kB+k(|&P  g  fR`Jg  g  g`B  g  fR`#+t9kHH9kHHЁ9kHHЁruN(-@ n*Pg&U(|kfJf -`<`S bfJ,fJf -d` wfJ,fJf -e` lfJ,fJf -f`X e-|(`` y+t =fHykNX"-@-n-ng| n&Pf4R+t/9+t .X/NPJgHyka|X n `:(|kfJf``P &e-|" .f``~#&P+tB`NqL8N^NuNVH<-|B lB "HAHABAЁk$@ "HAHABAЁmȵdB`R`*y&"gHH`Z -S$HBHBBBЂk$ -rNԀ B JgB`+|`L-|`BB`< g g !g "g #g $g*m`R*y&"gHH`B Jf` -S$HBHBBBЂk$ -rNԀ B(Pg -g&(y&"g f -f`(l`g*HTNX @&hg+k+k(K+L R`2 gJ g@ g6 'g, -g"*m`*y&"g0(m f"JfgJg 'g HUNX*L`NqL m!m m!m+y& #&*mHTNXR+`R+X`(l`HUa.XHUaxX*@*m`NqL8N^NuNVH0*y&"g g g fJg m g m f mJf m g m &g m !gz m "gp m #gf m $g\ mJgLR!R+` mJ g m/( NX(m m+h m!M)y& #&`*m`<*m`NqL0N^NuNVH8B*n(m fB`*mg f`(lg f`HTHUNPJgf .`PJgHyHUaPHTa@X&@B-+K +k+kBRR&HR+``rNqL8N^NuNVH0(n fR `d l f (lR `NN*@+yR+|B B+|+l+L l!M)M `NqL0N^NuNVH8*n f (m f ` f(lf `|` g g 'g`(l&m g g ff `:R&R+`JgTHyHUaBPHyHTa4P-l .gHy/.aP n-h`HyHSaP m!L m!K l!k k!l)m'm/- NX `&k`. ` m g `r(l&L-|&kg gSf `H f m +f*mf .` f*nJgTHyHUa,PHy(HTaP-l .gHy./.aP n-h`Hy3HSaPHUalX-@+HH @P/+ NX l!M k!M m!L m!K-m+l)n-m+k'n/-aX(@'l'l'L /.NX nJnS RR+` `NqL8N^NuNVH8*y&"gJ f>(m g2 o(&mg f + fHSHUaP&k`*m`NqL8N^NuNVH<*n(n *mg f`(lHTHUNPJg\HUaX&@ l!l l!l$L(l%y& #&/, NX)k)k)K R+`R```xNqL<N^NuNVH *n/. Hy N P &"rNx/HyDHy N Hy HUaPNqL N^NuNVH0*nHH`` -`HyX/. N P`Hy[/. N P`Hy^/. N P`|Hya/. N P`hHyd/. N P`THyfHy N P/-HyHy N `$ b@0;NNdz/-Hy/. N `/-Hy/. N `-HH. dg eg ffB-(|0JgHH-HH၀",f g f R/Hy/. N `/Hy/. N dfHy/. N P efHy/. N P ffHy/. N P`P`L 'f -`Hy/. N P`Hy/. N P`Hy/. N P`|Hy/. N P`hHy/. N P`THyHy N P/-HyHy N `$ b@0;NNdz/-/-Hy/. N ` -f>Jf/-Hy/. N `/-Hy/. N `4`A(H&|g`S,HyN\X//.NP&@Rg`/-N XHnNX+@RR+``fHUaXHy !HyaPJg2Hy $Hy aPJgJg m f m (fg`/-afX 9#f 9-fHy 'Hy aPJgHyHnNPJfHyHnN*PJg nA(H&| *g`S&|g`/-N XHnNX+@-m n+h n h!M n/(N X n!y& #&R+|R+``B9!`HUa Xa4`t ,b@0;Nz8|*m`0NqL8N^NuNVH8BB*y&"g R+G*m`*y&"g(m f fJ gJ g l ,/aX-@ m -/atXoT - f`H-HH @P&l )m +K .,)m+G.,)m+GR*PR*L`J .`NqL8N^NuNVHJl .D` .`NqLN^NuNVH8&n n f n (+gB`XJo lB`J*k n (hf fp`*gfB`f Jfp``B`NqL8N^NuNVH0*n(M g`0Sn(R l!l l!l)y& #&NqL0N^NuNVH *ng f*m` `NqL N^NuNVH *y&g"# & |w <C"Q2 `HxHxNP`NqL N^NuNVHB l  @BR`B9(B9!NqLN^NuNVH8 .*@&M(n HTaNXJg`^g ,f``SB .`$ .+ @`2 .+ @f` dg eg fg`NqL8N^NuNVH B l8 *@ af"HH".(f  @BR`NqL N^NuNVH *nHUajXHUaX.m  @B m/adXHxHUaP.m  @B` afF 0m@ 5n: @f4B l*  @ #g  @BB9(R`NqL N^NuNVH0 n*h(|g`B9 NqL0N^NuNVH8&n*k(|Jg ,g`B(| B ,g`  g  fR`g`NqL8N^NuNVH nJgNB lD/. /aPJg& + @HH". g f ` R`p`NqLN^NuNVH *n df& -0m -7nJ-f-HH0`2 af& -0m -5nJ-f-HH(`p`NqL N^NuNVH0(|& *y&"g -gN(M*m`NqL0N^NuNVH0*n(MJfB`TJg` ,+g ,-f8 af. 0m( 5n"HH(. @B/aXp`B`NqL0N^NuNVH0J g n(HH/Hy a*P-@`-| n(HH/HyaP.JlJm (|*|wg`J9 g*|x,(| g``B9xJmL o"Jf`aw (w`dw 0wB9wRJmP o"Jf`jax .(x `dx .0x B9x RHyxHywNPHywNX n!@NqL0N^NuNVH J&"f`~*y&"g  g !g "g #g $fHHg8Jgr m  g( m !g m "g m #g m $f@JgHy .HUNP m!m m!m+y& #&*m`HH.*m`FNqL N^NuNVH8*n(m f`HTaX(@  fHTa*XHxanX&@-| G`. f$HTa:XHxaJX-@HxaPJf`|HyHnNPJfHyHnN*PJf`HH` .ѮR&` .R ` .".NJ-@R+h` .".N8-@R+h` .R+l` .R` .R&D`~ gnH gln, g^n g>`H g0`: g~`, )g8n g` *g8`(M*m l!l l!l)y& #&R+`` *f Hn/.Hy HnNļ` g g g )f Hn/.Hy HnNļ`JfZ n"n"i#h n"n"i#h n!y& n/(N X nB#&R+``Jl( .D-@ n n ` n` n n ` nHn/.Hy HnNļ n/(N XHnNX n!@NqL0N^NuNVH8*n (n #g`(HUaXJf`&|(g`&|*Xg`NqL8N^NuNVH-n-n .R @ ngB` .R @Jfp`NqLN^NuNVH0*nHUa&XJfB9!`(|!g`NqL0N^NuNVH *nHH`r 0m 7n J-fp``l 0mP 6nJJ-fp` 6f, -@f$ -(fHx:HmN`PJgB`Zp`V -@fB`J` ag dg| nHH @HHf n _fp`B`NqL N^NuNVHJg\ n/( n/( n/( n/( n(HH/ nHH/Hy NŒ n-h`NqLN^NuNVH *nBJg HHހ` rN. `NqL N^NuNVH8*n JfB`PHUaX"(@&LJfB`6HU/NPJg n  `P&e(|"fB`NqL8N^NuNVH *|"&dJg /N XBP`NqL N^NuNVH0*n(n Jg  g  fR`JfHy <x<`NqLN^NuNVH *n af R 0m 6nR @f RJfp`B`NqL N^NuNVNrBN^NuNVH0 .". N8-@/NxX*@fB`(M .VrNr.`BSl L0N^NuNV/.N*XN^NuNVA-H#+Hn/. N(P n0( gp`BN^NuNVH *n.f `JfBL N^NuNVA -H# t+Hn/.N(P09  gp`BN^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NzPJmJn -|`-n `f +|+`D/.NxX+@f,mJf,0-g-HHx@+@`m+n  `f09 gHy tNNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVA-HA#+=|B-n-|Hn/. N(PSm .R @BHH`HnBNxP .N^NuNV4.-nBxT`b y+ S m. .R @HH y+"(R!AS AHH` /9+ .R @HH/NxPRxT nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| `J.g-| J.g"/.NX".-A< o-@ .Xf -| L`-| LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNx-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| `-| `Jl-| n P @-h-h/./.N߄PJf/./.N߬PJfHnHn .R l .R`p//./.Nь-@Jg -| `J.g -| `J.g-| AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr Nx`S n0A .ذbJn/9 /9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N߄PJf/./.N߬PJfHnHn *LZ`0SR`*0xXb1 nRJfxXc0R 9nB <xXL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nb .B`T0-f(mfHn-HH/NzPJmJn -|`-n tf9 HH/NXJgm+|K+|K+n 0-gl(m m R Э "-d f -,/HT-HH/Nb .+L`/.NxX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nb . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nb g m p`BL0N^NuNV.*| `` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N*XBBBB BmB- L N^NuNVN/.NxXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| `` eB` 0,f -+fp`B, wf0Hx/.NPP.JgJm/NXHx` afvJgp`p//.NP.lB kf6Hx/.NPP.Jg Jm/NXHx/.NP.Jm.HxB/Nv `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNlHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NHPJlB`pN^NuNlHxN@eBNuNlHxN@eNuNlHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.Nn N^NuNV/. Hy@t/.Nn N^NuNlHx6N@eNuNVH0Jxf8 <x#x <x#x#xx#xx .^rNr.*yxBx g`(*(U g " Ҁe " Ҁd(M *@bxfxgB`Rx xo "<Nx#xBN*X(@ 9x" Ҁe 9x/N*X(@g yx 9xXg yx  9x" ҀY(#x <x A ` " Ҁ#xxc A#x A 9x*A L0N^NuNVH0*n(MY#x (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNr.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ x L0N^NuNlHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLg 9ed @Re` ye ("f*B` yeRe 9eeS "fB`BHya P-|Re#e#6HUafX*@ ye  fSe#eaN g 9eTR mBHya P`-yF HcHya X/96NÀXB .#-@ nJg ./g PJfHn/.N<`2 n//.NJyoTSy`J0H4 @< FfPJla#lB$|`X Rf0*GfXJRm 0Hf<*lB`JFf"09H b@0;N..0H @0H〙*K0H @0H倗#e=F0H @<0H @0H2HЁR=@ nkl*0.H @>0HV @0D@2@g0H @0H @>0.HS b@0;N (08BL\fpz`Hy lNXR3`n0HZ @0H<JFm< Fkl60H @0HV @ Pf0H @>`40HZ @<UYAԹd`(Jg#` -` -"NJ#e` -"NҰ` -"N͞` -Е` -` -"` -"` -lp`B` -o` -n` -m` -f` -g` -`l -"`` -`VJgJg`JfJg`Jg -`0 `*#e` D`Jfh`` F`#e`L`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVA-HA#h=|B-n-|Hn/. N(PSm .R @BHH`HnBNxP .N^NuNV4.-nB`b yh S m. .R @HH yh"(R!AS AHH` /9h .R @HH/NxPR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| `J.g-| J.g"/.NX".-A< o-@ .Xf -| L`-| LA`-H-H`P .P-@@ .P-@P".DN͞ЮLЮ@ @S"n .P".DNҰ-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| `-| `Jl-| n P @-h-h/./.N˄PJf/./.NˬPJfHnHn .R l .R`p//./.N-@Jg -| `J.g -| `J.g-| AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 | .".NgP .S-@HJlD-@HJHg6 .Hr N͞0S n .Hr NҰ`S n0A .ذbJn/9 /9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N˄PJf/./.NˬPJfHnHn *LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NԚ .B`T0-f(mfHn-HH/NβPJmJn -|`-n Lf9 ^HH/NμXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/NԚ .+L`/.NϰX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NԚ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NԚ g m p`BL0N^NuNV.*| 8` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NbXBBBB BmB- L N^NuNVN/.N԰XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| 8` eB` 0,f -+fp`B, wf0Hx/.NPP.JgJm/NXHx` afvJgp`p//.NP.lB h f6Hx/.NPP.Jg Jm/NXHx/.NP.Jm.HxB/Nv `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNԤHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NπPJlB`pN^NuNԤHxN@eBNuNԤHxN@eNuNԤHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NϦ N^NuNV/. Hy@t/.NϦ N^NuNԤHx6N@eNuNVH0Jdf8 <h#d <d#h#hp#dl .^rNҪ.*ylBx g`(*(U g " Ҁe " Ҁd(M *@bpfdgB`Rx xo "<NҰ#xBNbX(@ 9x" Ҁe 9x/NbX(@g yp 9pXg yp  9x" ҀY(#p <d A ` " Ҁ#llc A#t A 9l*A L0N^NuNVH0*n(MY#l (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNҪ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ t L0N^NuNԤHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL -<> .<> /<> 0 1 #:  <  9 ;      !                   "%&'()*+,-./012345678$=  llaaLCC7)  $-!~(*/%+- <>&^|  ?,():)||&&>><<>=<=!===bt n f r \\+-*/%<>&^|?:!~(),defined\ Illegal character %c in preprocessor ifIllegal number %syacc stack overflowsyntax error-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ |b[ l/ځ4**bxhpx0! __.SYMDEF 422241511 0 10 100660 6694 ` jh#+D2;B HK S!["(d# k#p$4v$|%'>'>()<)*z01|1|1|>$>$>$>$>$DEx FG\G\#J)K1K9L^@MEMLNSOD\QfQpQzQQVWXVZ|[x\\]R]^_`a\bcl"d/d:eTHftVgaglgwlllllqr^s>struv4www{~&(00:0D0NYp_nz*T8hhh f B)Z09B8IPxX`f(mwl \L( &&"Ɯ):17|AJɾRɾ[ɾdɾmѶuV|Vl L$`"+ 2:BI|R|]d!l!t!{"""""-34v556T7>8(89h:: ;6;\H>U?_@Bi@rA{B$BCnD D D D D IJvKNOxPP Q^S@ST|&T|/U>;UDUMW@SW\XeYBnYwZ[X\ ]]^L_ _`aFaaaaaa a a kP kP %l +m: 2m AoZ MoZ YoZ es tu< u< u< y z { ~2  ~   r r r l l    \ $Z .Z 5Z = Dl Kl Sl Z b h( u ~ F    &   d    p p V V V V 8  ! + 3 9L @L FL M S Y _ h o x            Ԍ Ԍ Ղ Ղ פ <  ـ " ܈ ( $ -V 7N > F O Vv \ e@ k q| y    6  X    &   &     : : V V % * 0 7` ? F L X a l s | _nice_ptrace_stime_times_umask_umount_utime_vadvise_vfork_vhangup_vlimit_vtimes__doprnt_abort_abs_acct_atol_bsearch_calloc_cfree_chmod_chown_chroot_chrtab_clearerr_crypt_encrypt_setkey_dysize_ctime_localtime_asctime_gmtime_ftime_dup__error_execlp_execvp_fabs_fchmod_fchown_fcntl_ffs_fgetc_flock_freopen_getfsent_setfsent_endfsent_getfsfile_getfsspec_ftell_ftruncate_gcvt_getchar_getdopt_getdtablesize_getegid_geteuid_getgid_getgrgid_getgrnam_getgroups_gethostbyaddr_bcmp_gethostid_gethostname_getitimer_getnetbyaddr_getnetbyname_getnetent_setnetent_endnetent_optind_optarg_optopt_opterr_getopt_fputc_fputs_getpgrp_getppid_getpriority_getprotobynumber_getprotobyname_getprotoent_endprotoent_setprotoent_getpw_getpwnam_getpwuid_getpwent_setpwent_endpwent_getrusage_gets_getservbyport_getsockopt_getuid_getw_getwd_chdir_inet_lnaof_inet_makeaddr_inet_netof_inet_network_initgroups_getgrent_setgrent_endgrent_remque_insque_intss_kill_killpg_link_lsearch_lstat_madvise_mincore_mkdir_mknod_mktemp_access_mmap_mount_mprotect_mremap_munmap_nlist_fseek_pclose_popen_dup2_pipe_portal_profil_psignal_putchar_puts_putw_raddr_srand_rand_initstate_srandom_setstate_random_readlink_readv_reboot_recv_recvfrom_recvmsg_cclass_backref_re_exec_re_comp_rename_rexec_rexecoptions_socketaddr_ruserok_rresvport_rcmd_accept_connect_listen_rhost_rin_rmdir_mkpwunclear_mkpwclear_ruserpass_getenv_getlogin_getpass_fdopen_fprintf_index_printf_fwrite_fread_scandir_alphasort_qsort_fscanf_sscanf_scanf__getccl__instr__innum__sctab__doscan_atof_seekdir_select_send_sendmsg_setbuf_setbuffer_setdopt_setegid_seteuid_reset_setexit_setgid_setgroups_sethostid_sethostname_setitimer_setpgrp_setpriority_setregid_setreuid_setrgid_setruid_setsockopt_settimeofday_setuidfcmpisfaddisfmulisfdivisfsubis_shutdown_sigblock_sys_siglist_sigpause_sigsetmask_sigstack_sigvec_sleep_alarm_pause_setjmp_longjmp_socketpair_gsignal_ssignal_sstk_strcatn_strcmpn_strcpyn_strncat_strncmp_strncpy__strout_wdleng_yyportlib_swab_swapoff_swapon_symlink_sync_LogMask_LogStat_openlog_syslog_LogFile_closelog_LogTag_SyslogAddr_ovbcopy_bcopy_bind_bzero_gethostbyname_gethostent_endhostent_sethostent_getservbyname_getservent_endservent_setservent_atoi_fgets__filbuf_fopen_creat_inet_addrlmultulmult_errno_sys_nerr_perror_sys_errlist_sys_nerr_rewind_sendto_socket_system__sigfunc_errno_signal__exit_execl_execle_execv_execve_fork__sighandler_syscall_tell_telldir_lseek_time_gettimeofday_timezone_tmpnam_getpid_sprintf__pfile__print__ctype__fcvt_ecvt__cleanup__flsbuf_fflush_fclose_exit__sobuf__lastbuf__sibuf__iob_ldexp_modf_frexpffixiffltifdivifdoubleid_packfsingleid_unpkg_intf_rcpfcmpiieeeusedfmulifsubifaddiffixisfloatflavorfmodiffltis_isnan_isinflmodtulmodt_strlen_tolower_toupper_truncate_ttyslot_rindex_strcmp_ttyname_closedir_fstat_isatty_opendir_close_open_readdir_read_stat_strcat_strcpy_stty_gtty_ioctl_ulimit_getrlimit_setrlimit_uname_ungetc_unlink_unmount_ustat_utimes_valloc_getpagesize_realloc_free_malloc_brk_sbrkldivtuldivtptwo_wait_write_writevcerror_exit_monstartup_monitor_countbasemcount_minsbrk_numctrsOnice.o 422239966 0 10 100770 97 ` NHx"N@eNuP _nicecerror Optrace.o 422239966 0 10 100770 134 ` $BHxN@eNuNPP )_errno_ptracecerrorOstime.o 422239967 0 10 100770 98 ` NHxN@eNuPW _stimecerrorOtimes.o 422239967 0 10 100770 98 ` NHx+N@eNuP _timescerrorOumask.o 422239967 0 10 100770 98 ` NHxPbP yk (X/ulmult_free_calloculdivt_malloc_cfree chmod.o 422239971 0 10 100770 98 ` NHxN@eNuP  _chmodcerrorchown.o 422239971 0 10 100770 98 ` NHxN@eNuP, _chowncerrorchroot.o 422239971 0 10 100770 99 ` NHx=N@eNuP( _chrootcerror chrtab.o 422240009 0 10 100770 1592 `  $$~$$~$$>A@>A>ab#C8DH00IFF9    I**I~ @$BBBBBB$8D @@|~ D8 $D~|@@XdB$AAAA>"AAA#   @ @  @$BA@@@@@@A>~AAAAAAAA~~@@@x@@@@@@@|@@@@@>A@@OAAAA>AAAA~AAAAADD8ABDHPpHDBA@@@@@@@@@AcUIAAAAAAAaQIECAAAA>AAAAAAAA>~AAA~@@@@@>AAAAAAYE>~AAA~DBAAA>A@@>A>AAAAAAAAA>AAAAAAA"AAAAIIUcAAAA""AAAA" @@@ 88" <>BB>@@@@|BBBB|BBBB>BBBB>B>@@@@|BBBBB(@@@@FHPpHFvIIIII@|BBBBBBBBB>\b@@@@>@<B<~ BBBBB=AAA"IIIII6B$$BBBB" @~ ~   *~~~~~~~~~~ _chrtabclrerr.o 422240037 0 10 100770 82 `  NV.*nm*nN^Nu_clearerrcrypt.o 422240010 0 10 100770 3180 ` Hl$(NVHB  @HHSЮ @  "@ 8 @HHSЮ @  "@R mBB`r9 HH-@B  @  "@R m 9 HH-@B   @  "@R m R T @HHmzB "HA00HABAЁ І @ d"@HH "@ "HA00HABAЁ І @ |"@HH "@QR mR mLN^NuNVHB  @HHSЮ @  L"@R @mBJ g p-@`-nB  l @  "@R mB ."HA00HABAЁ І @HH"  AHH k AHH" AR 0mB "HAHABAЁ.  @HH" AHHЁ" AHHЁ" AHHЁ" AHHЁ"Ё" AHHЁ @HH* . " A " A " A " AR mB  L @HH" AHH AHH" l AR mB  @  L"@R mR mB  L @HH.  l @  L"@" l AR mB  @HH K @ .І"@R @mLN^NuNVHB  @BR BmB`6 @l6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     @&@2@J@d@v@@@@@@@@@@@:@F@T@@@@@@ @.@@@n@@@@@@@@@4@H@b@r@@@@@@@@@@,@^@@@@@@@`@@@@@"@Z@p@z@@@@P ~_crypt_encrypt_setkeyctime.o 422240010 0 10 100770 1658 ` (@`NV/.aX/aXN^NuNVH HnNX0.< n"-AHnaX*@.-|w*</ Jg Kf, -JX @, -J\ @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN-@Jl QS*| .r*n`8R`4Jg8  g  gd(Hy%HUaP*@gBfB <,`RJfRfBL0N^Nu/etc/networksrr# @@@P"@*@0P<@J@R@Z@`Ph@z@@@P@@@P@@@F@fPn@x@~@@@@@@p0D%m3t:+AIQ_getnetent_setnetent_endnetent_inet_network_fopen_fgets_fclose_rewind getopt.o 422240013 0 10 100770 1336 ` `HxNVH hfb 9dl&Ю @ P -f 9dЮ @ PJ(fp` Hyl 9dЮ @/NPJfRd` 9dЮ @ йh @HH.# :g//.NP*@JfJ`gJHy( n /NPHy(HyoNPHy(/NPHy(Hx NP 9dЮ @ Rhйh @JfRd#hp?`R :f 9dЮ @ йh @J(g 9dЮ @ йhR#`|Rd 9dmVJ`gHy( n /NPHy(HyNPHy(/NPHy(Hx NP`B 9dЮ @#Rd#h`8 9dЮ @ Rhйh @Jf#hRdB L N^Nu--: illegal option -- : option requires an argument -- @@2@N@T@dPp@x@@PP@PPP@PP PP P@@$@0@:@P@`@n@~@P@@@PPP@PP PP P@P @@@,@2@B@H@NP d #:+3`;C.IP_fputs_optind_optarg_strchr_optopt_strcmp_opterr_getopt__iob_fputcfputc.o 422240040 0 10 100770 152 ` DNV n S m n (R!@S @ HH`/. /.NPN^Nu8Pf __flsbuf_fputcfputs.o 422240040 0 10 100770 164 ` PNVH0*n(n `(Sm",R AHH` HT/NP.HH,f L0N^Nu2P f_fputs__flsbufgetpgrp.o 422239977 0 10 100770 100 ` NHxQN@eNuP _getpgrpcerrorgetppid.o 422239977 0 10 100770 88 `  HxN@ Nu _getppidcerrorgetpriority.o 422239978 0 10 100770 104 ` NHxdN@eNuP_getprioritycerrorgetproto.o 422240061 0 10 100770 225 ` <0NVH ..BNXN*@Jg -fN L N^NuPP,P+8=_endprotoent_getprotoent_setprotoent_getprotobynumber getprotoname.o 422240062 0 10 100770 295 ` `<(NVH8*nBNXN(@Jg,HU/NPJg&l`XJgHU/NPJfN L8N^NuPP(PDPPP+3C_endprotoent_getprotoent_setprotoent_strcmp_getprotobyname getprotoent.o 422240062 0 10 100770 1011 ` (`NVJfHy HyNP#`/9NX .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`,(n `f `/9HxHyN -@g @ #gHy/.aP*@gB# Hy/.aP*@gB`R  g  gHyHUa\P-@Jg @BRHUNX#(#,$(y$JgF*n`8R`4Jg8  g  gd(HyHUaP*@gBfB < `RJfRfBL0N^Nu/etc/protocolsrr# @@@P"@*@0P<@J@R@Z@`Ph@z@@@P@@@P@@@D@dPl@r@v@|@@@@q pD$1t8+?GO_atoi_getprotoent_endprotoent_setprotoent_fopen_fgets_fclose_rewind getpw.o 422240047 0 10 100770 507 ` 0`NVH J(fHy$HyNP#(J(fp`/9(NX*n y( S m y( (R!@S @`/9(NX, g g`B*n ~SgHH, :g f`pHH, :g0 0m 9n "HA HABAЁІ0.`fF_atoi_getpwent_setpwent_fopen_fgets_endpwent_fclose_rewindgetrusage.o 422239978 0 10 100770 102 ` NHxuN@eNuP_getrusagecerrorgets.o 422240048 0 10 100770 241 ` l$(NVH *nSm 9R @`HyNX. g Jm`Jl fB`B .L N^NuPPP.P4P y.__filbuf_gets__iob getservbyport.o 422240063 0 10 100770 267 ` P< NV.BNXN*@Jg$ -fJ g/. /- NPJfN *nN^Nu PP6PBPRLL+r7?_getservbyport_endservent_getservent_setservent_strcmp getsockopt.o 422239978 0 10 100770 103 ` NHxvN@eNuPp_getsockoptcerror getuid.o 422239979 0 10 100770 99 ` NHxN@eNuP _getuidcerror getw.o 422240049 0 10 100770 175 ` \NVH0*nA(H~`$Sm -R @` HUNXSl0-gp` .L0N^Nu2P }__filbuf_getw getwd.o 422240014 0 10 100770 1187 ` L`NVtA-HBBHnHyLNP=n-nHnHyNNP .f 0.ngHyPNX-@fNHyS/.NP/.HyhaP/NXBN^NuNVH0*n(n BJgjRR`HyjNXJlHym`Hnv n/NP0.nvfp .xf0/.NX nJfHy/.NP .`p/.NX-@f/.NXHy`" n f`P/.NX-@f/.NXHy`Hnv .P/NP .xf0.vnf/.NX/. .P/aP/HyaP-@`N/./.NP/.NXJlHy/.NP`|߹ m`SS SJn L0N^Nu/...getwd: can't open .....getwd: can't chdir to ../getwd: read error in ..getwd: read error in ../getwd: can't change back to .@@ P8@>P\@bPp@zP@P@P@PP@P2PDPL@hPzP@PP@PP @P @*@Z%^,!4: C_closedir_readdir_chdir_fstat_getwd_strcpy_stat_opendir chdir.o 422239970 0 10 100770 98 ` NHx N@eNuP _chdircerrorinet_lnaof.o 422240067 0 10 100770 132 ` H NV... f `"  f ` ..N^Nu_inet_lnaofinet_makeaddr.o 422240067 0 10 100770 167 ` X NV l .r` .r` m .က -@-@A  @"|X" <XN^NuF@N@_inet_makeaddr inet_netof.o 422240068 0 10 100770 140 ` P NV... f r` r`  g ..N^Nu_inet_netofinet_network.o 422240068 0 10 100770 474 ` L$(NVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎ep`p n XR`4JgHH @g n XA .쐈* bBB`A  Re L N^Nu<PZPzPPP m"ulmult__ctype__inet_networkinitgroups.o 422240015 0 10 100770 534 ` ,`HNVH BJ mA . RNN*@JgdB Э @Jg/. Э @/NPJf^A . R f@/.HyHy(N Hn/.NPJlHyNXp`R`tBL N^Nuinigrp: %s is in too many groups setgrp(P.PZP@PPP@P$.8@H.N_setgroups_initgroups_fprintf_getgrent_setgrent_strcmp_perror__iobgetgrent.o 422240044 0 10 100770 818 ` x`NVJfHyHyxNP#`/9NXN^NuNVJg/9NXBN^NuNVH *n.. ` HHgRJfJgB L N^NuNVH0Jf"HyHyxNP#fB`/9HxHyN *@Jg#Hx:HUalP*@#Hx:HUaXP*@/NX##Hx:HUa0P*@Hx HUa"P(|`,d(Hx,HUaP*@JfB <L0N^Nu/etc/grouprr@@@P"@*@0P@@H@NPV@@@@P@@@P@@P@@"@B@J@h@q 2:(t/+6>F_atoi_getgrent_setgrent_endgrent_fopen_fgets_fclose_rewindinsque.o 422240081 0 10 100770 141 ` ,$ o"o !I""P#HNu o"P h #HNu Uinsque.o_remque_insque intss.o 422240049 0 10 100770 137 ` $NV9HH/NXN^NuPP .3_intss__iob_isatty kill.o 422239980 0 10 100770 97 ` NHx%N@eNuP _killcerror killpg.o 422239980 0 10 100770 99 ` NHxN@eNuP _killpgcerror link.o 422239980 0 10 100770 97 ` NHx N@eNuP _linkcerror lsearch.o 422240016 0 10 100770 220 ` l$NV-n n ".NЮ -@/././N ` .Ѯ/./. nNPJf .f nR .N^NuP.P dlmult_strncpy_lsearchlstat.o 422239981 0 10 100770 98 ` NHx(N@eNuP _lstatcerrormadvise.o 422239981 0 10 100770 100 ` NHxKN@eNuP _madvisecerrormincore.o 422239982 0 10 100770 100 ` NHxNN@eNuP _mincorecerrormkdir.o 422239982 0 10 100770 98 ` NHxN@eNuP _mkdircerrormknod.o 422239983 0 10 100770 102 ` NHxN@eBNuP cerror_mknodmktemp.o 422240017 0 10 100770 310 ` <(NVH N.*nJfS` r N0 r N.S XgR|a` zf <` RB/.NP f .L N^Nu/ P"P4PR@fP p"x*ulmodtuldivt_access_getpid_mktempaccess.o 422239969 0 10 100770 99 ` NHx!N@eNuP _accesscerror mmap.o 422239984 0 10 100770 97 ` NHxGN@eNuP _mmapcerror mount.o 422239984 0 10 100770 102 ` NHxN@eBNuP _mountcerrormprotect.o 422239985 0 10 100770 101 ` NHxJN@eNuP_mprotectcerror mremap.o 422239985 0 10 100770 99 ` NHxAN@eNuPx _mremapcerror munmap.o 422239985 0 10 100770 99 ` NHxIN@eNuP _munmapcerror nlist.o 422240018 0 10 100770 783 ` TPNVH0B(n B`4 TJg2B,BBlB,/NX*o-E RJfHy/.NP-@JfB`/.HxHx HnN g& g  g/.NXp`P  f <`p ЮЮЮЮ-@Ю-@..Jg,<l,B/./.N /.Hx/HnN*ݮA(H mJgp,fB .Д//.N /.Hx .R/HnN*n `f UJgdB` Ѕ @AfBR Ѕ @JfAJf,+ll;llSf/.NX`x Jf `4L0N^Nur.PN@XP~PPP PdPPP t;N $(e/7_nlist_fopen_close_fread_strlen_fseek_fclose fseek.o 422240042 0 10 100770 627 ` 0(NVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/N "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/N -@ nBJg n S m n (R!@S @`t/.NX`f n0(gV/NX n0(gB nh n"H#h/./. n(HH/N -@ fp`BLN^NufP PPPlPP Le#_lseek_fflush__filbuf_fseek popen.o 422240049 0 10 100770 888 ` PNVHHnNXJlB` n rf .` .. n rf .` .,N*f^/NX n rfp`B//NP/NXB/.HyHyHyNHxNX g^  @ /NX/. /NPLN^NuNVH8 n(HH./NXHxHxNP(@HxHxNP&@HxHxNP*@HnNX," Ag f f-|HTHxNPHSHxNPHUHxNP .L8N^Nu/bin/shsh-cPLPXPt P~P@@@PP@PP P P( P: PHPV@ P P PA z &-5;;BJRXX_pclose_popen_execl_pipe_wait__exit_fdopen_fork_close_signal_fclose_dup2dup2.o 422239972 0 10 100770 105 ` /@Hx)N@eNuNP Xcerror_dup2 pipe.o 422239985 0 10 100770 109 ` NHx*N@e o BNuP _pipecerror portal.o 422239986 0 10 100770 99 ` NHxN@eNuP( _portalcerror prof.o 422239986 0 10 100770 99 ` NHx,N@eNuP cerror_profil psignal.o 422240019 0 10 100770 389 ` 0PNVH *| d . @*PJ gHy-NP-@fB`l/.NX`RJfvRffB`pRf .L0N^Nu@(#)raddr.c 4.5 82/12/19/etc/hostsr/etc/hosts# /etc/hosts.localr@@P,@2P>PRPj@P@@PP PPP@@PP t+#+!3;$CKR_exit_inet_addr_fopen_fgets_perror_strcpy_malloc_strlen_fclose_raddrrand.o 422240019 0 10 100770 187 ` <$ NV#l/4**bxhpxRP`L N^NuNVJf. y "P PPPPPP P P.@8PJP^PlPPPPPPPP"P.@8 PFPXPlP|@PPP@P@P P(PHPP PPP@P@PP(@.@4PRPjP~PPPPPP @@2 P P t&v-6?FdQXahFqFwt~+-;Z$._read_socketaddr_connect_write_index_ruserok_fprintf_errno_rresvport_sleep_syscall_bcopy_sprintf_bind_fopen_socket_fgets_gethostbyname_strcmp_accept_rcmd_close_perror_listen_strlen__iob_fclose accept.o 422239969 0 10 100770 99 ` NHxcN@eNuP _acceptcerror connect.o 422239971 0 10 100770 100 ` NHxbN@eNuPt _connectcerrorlisten.o 422239980 0 10 100770 99 ` NHxjN@eNuPZ _listencerror rhost.o 422240065 0 10 100770 1179 ` tTNV-| n PHH @gt n/NX-@m` .N^NuNVH0*n`(n `f L0N^NuNVH0*nB`(n Jgf-MR`HyHyNP-@JfXHyNXHxNX`< .#g4HyHnaP-@Jg nBHyHnalP-@JfV/.HxHnN Jf fB/.NXHyHyNP-@fp` n/ .R/NPJfrHnNX-@ g/.NXHyHnaP-@`R n  g  g n Hy n/aZP-@Jg @B n/NXR/NX-@ n//NP n ` /.NX`RJfRfB`Rf$ .L0N^Nu@(#)rhost.c 4.5 12/19/82/etc/hostsr/etc/hosts# /etc/hosts.localr P2P@@P@PP@@ PB PJ@P@VPxPP P@@ P P$P< P %t,+3;C!KS$[c_exit_inet_addr_rhost__ctype__fopen_fgets_strcmp_perror_strcpy_malloc_strlen_fclose rin.o 422240022 0 10 100770 768 ` 4 NVH-y4-y8BBSm 9R @`HyNX, fN -fR` .fR`/NXJgPJgR/9H/9D N///9@/9< .".NNN-@-A`NJg .". -@-Az`$/9P/9L .".N-@-ARm .".N. LN^Nu@$@H@$ @@ P& P, P> PD PVPv P@@P@@PPP@@P P !*?0[6<E.KT_exitffixiffltifdivi_rinieeeusedfmulifsubifaddi__filbuf__iob_isdigitrmdir.o 422239988 0 10 100770 98 ` NHxN@eNuP _rmdircerrorruserpass.o 422240066 0 10 100770 8391 ` hh`NV/./. /.a0 n Jg nJf/./. /.a n JfN-@HxNX n /./.Hy8N HyNXHx n /HxN Jn HxNX n P  f n `,Hx n /NPJgHx n /NP @B n JgD nJf< n //.HyGN HyNXHyZNX n N^NuNV./.aX*@gHH @gHx,HUNP-@Jg n JfܐR/NX n ./HU n /N R/.NXR/NX*@/.HUNPHxNX n n/ nHH/HUa *nN^NuNVH0(yJgdHxHy[/N JfHx=/NP*@f&X` ./HU n /N Jf`4 X" //. X/N JfA L0N^NuNVHy`NX-@Jf-|e/.HygHnN HyqHnNP#PJf g HnNXN^NuNV yP0(fb yP S m yP (R!@S @`B l^  @BR`B`aa-@g g fax fHyT/.NPJf``@0;Nx88a8Jg< n Jf8HyTNXR/NX n HyT n /NP`HyT n /NPJfD`Hn yP(HH/NPJmBp0.?g4HysHy(NPHyHy(NPHxNXanJgr nJfjHyTNXR/NX n HyT n`6a0`6 g6 .U cHyTHyHy(N a-@f/9PN`/9PNX-@ g0 g g g ,g fXBN^NuNV. nB/. HyNP nJf ...N^NuNV nB/. HnNP`-|T "f8 yP S m yP (R!@S @`/9PNX-@ g6 "g* \f> yP S m yP (R!@S @`/9PNX-@ nR`V/9PNX` g g g ,g \f> yP S m yP (R!@S @`/9PNX-@ nR yP S m\ yP (R!@S @-@ fD nBJ9Tg -|`(HyT n/NPJf n (`P nJfp `B nJg "@RR mHyHyaP//.NPHy/.NPHy`-n` n $g R nJf nPBHn/.aP/HnNPHn/.NPJ.g .R-@ nJf .N^NuNV./. HyaPHyaXB  @ "@R 0m/.HytaPBHytaPHytaX..N^NuNV./. HyabPHyaVXB  @ "@R 0m/.Hy6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  Name (%s:%s): Password (%s:%s): MACHHOME.%s/.netrcrError - .netrc file not correct mode. Remove password or correct mode. Unknown .netrc option %s $/etc/utmpr%ldCan't make key Can't make key defaultloginpasswordnotifywriteyesynoncommandforcemachineHPVPl@rP|P PPPPP@PP$ P,@2PfPPPPPPPP4 PD@LP`PPP@P@@P@P@& P2PB@V@f@@@P@P(P6@BPN@ZPp@P@P P@P PP@PP@,@2@8P> PR@XPb@hP@PP@"@0@N@TP@@@P@P@(@F@LPd@t@@@@P@@@*P2@<PD@PP@@@@ @ @ $@ B@ L@ \@ f@ ~@ @ @ T@ l@ v@ x@ @ @ @ @ @ @ @ @ (@ >@ D@ V@ `@ v@ @ @ @ @ @ @ @ 4@ L@ @ @ @ @ @ @@(@<@P@d@x@@@@@@ @@(@:@R@\@@@@@@@$P@@F@LPh@nP@PP@PPPPPP<@T@^P@@P PP0@6P< PHP@&@.@6@>@F@N@V@^@f@n@v@ !*3<DvKT2ahrqLy"FtN!$.`3[_read_exit_strncmp_printf_getpass_strncpy__ctype__strcat_index_fprintf_mkpwunclear_errno_environ_fflush_getlogin_sprintf_fopen_fstat_strcmp_mkpwclear__filbuf_perror_fread_strcpy_malloc_strlen__iob_getenv_isatty_ttyname_fclose_ruserpass getenv.o 422240012 0 10 100770 193 ` lNVH8*n(yJg/HUa"P&@Jg ` =f `0BL8N^NuNVH0*n(n gJf ,=gBL0N^NuPr `_environ_getenv getlogin.o 422240013 0 10 100770 425 `  HXNVH N.fB`BHyNP,mB "HAHABAЁ//N HxHy/N g /NX`/NX *|  fSB <L N^Nu/etc/utmp P@"PHPV@^PrP~P@@@ "!;(1_read_lseek_getlogin_open_close_ttyslot getpass.o 422240046 0 10 100770 915 `  NVH HyHxHyNP/NP-@f -|`B/.NPHxHxNP-@Hn n(HH/NP0.H-@nHn n(HH/NP/.HyHy(N Hy(NX*| n S m n (R!@S @` /.NX. g gd`BHyHy(NPHy(NX=nHn n(HH/NP/.HxNP g /.NX <L N^Nu/dev/ttyr%s @@P$P2 PBPR PpPP@ PP PP@P@&@, P2P: P@P`Pp Px P P@ L&.4:@IQ.W__getpass_fprintf_setbuf_fflush_fdopen_stty_gtty_open__filbuf_signal__iob_fclose fdopen.o 422240038 0 10 100770 275 ` 0NVH0*n (|`eB`^0,fBn  rg"l afHxB/.N `l -+f ll L0N^NuPPXP .#_lseek_fdopen__lastbuf__iob fprintf.o 422240077 0 10 100770 199 ` @0NVA-H#Hn/. NP n0( gp`BN^NuPP'fprintf.o_fprintf__pfile__print index.o 422240014 0 10 100770 99 ` , NVH *n.f `JfBL N^Nuv _index printf.o 422240082 0 10 100770 231 ` @< NVA -H#Hn/.NP09$ gp`BN^NuPP P(P %.+printf.o_printf__pfile__print__iob rdwr.o 422240051 0 10 100770 369 ` 0NVH0*n(nBJ f<`D-n Sm ,R @` HTNX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NPSf0, fR .e .L0N^Nu>PP[n fN%_fwrite__flsbuf__filbuf_fread scandir.o 422240024 0 10 100770 729 ` |XNVHPL P PPP PP<PpP` 7Z'F-*6=VHPX a_qsort_realloc_closedir_readdirldivt_scandir_fstat_alphasort_strcmp_malloc_opendir qsort.o 422240019 0 10 100770 701 ` $PNV## . ".NЮ//.aPN^NuNVH0.9 . -@찇cH" .N" N-@ .Ю-@-@*n . (@`./.HUa P`/.HU yNP-@gJljǻe``HT߮/.aP`NHT߮/.HUa ߮*n`0HT/. yNP-@gJogHTHUaP`ǹbʻfL .". m/. .Ї/aP-n `/./.aP .Ї-@`HU/.HTaH (n`$L0N^NuNVH0-y*n(n SfL0N^NuNVH8-y*n(n &nHH-@SfL8N^Nu@@P>@^PhP@@@@` _qsortulmultuldivt scanf.o 422240052 0 10 100770 302 ` < NVHn /.HyN N^NuNVHn/. /.N N^NuNV.*n=|A-M-MB`RJf-nHn/. HnN *nN^NuPP2PxPx >.:#*_fscanf_sscanf__iob__doscan_scanfdoscan.o 422240037 0 10 100770 2756 ` PNVH0*n (nBBHH.Jg& gz gp gf %g, n S m n (R!@S @`HH. %gB *g LX-H`HH.B-|`* ."HA HABAЁЇ0-@HH.  @fJf-|u0 lf-|`BHH.` hg [f HUaX*@  @g  .-|Jfp`Hn/./././/.aJg JgRJg|Jg` n S m n (R!@S @` /.NX-@ g g g g/./NP`/.NX-@g g*/./NP .L0N^NuNVH c g s g [ f././././. Jg n `B/a`BBB e g f f-|| o f|` x f|A*HBB n S m n (R!@S @` /.NX. g g g -fFR n S m n (R!@S @` /.NX.S` +fS n S l/.NX` am fo Am FnR f .` f .Ю` .-@-G  @g0` am fnW`7߮.. n S mB n (R!@S @.Sm  @f< g .f fJgR` eg Ef~Jfx fpJgjJgdR n S m n (R!@S @` /.NX. +g -g 0m 9oJg .D-@ g/./NP nB` n JgAgJgAfB`B .退 bJ@0;N^jj@@@@@@@@@@@@@&&DHnNXN n P p`2HnNX n P !A` n P0` n P `L N^NuNVH8*n(n nB&M c f u0f-|B s f-|Sm ,R @` HTNX.v @HHg f-| c fB`` [ fV-|`L v @HHf>gSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg v @` v @R mHH. ]g*Jg v @` v @RJfS L N^Nu@(#)doscan.c 4.2 (Berkeley) 82/12/03P>P PP PDP, P P P&PP: PP PP*P P@@Z P~P@@"@2@n s%`-X5A=FvNW:`_atof__getccl__ctype_fsinglei__instr__innum_ungetcieeeused__sctab__filbuf__doscanatof.o 422240073 0 10 100770 1258 ` XNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9/9 .".Nl< 0N///./. 9"9NN-@-A`RHH.  @f .gZ`t/9/9 .".Nl< 0N///./. 9"9NN-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g(  @/(/ .".N-@-AJg R mJl/./. .".N`/./. .".N-@-A/.//N -@-AJl ` .".L N^NuCp@@9@AׄBAy7D]?@$@$@@"@*@p@v@PP@@ P PP@@PP&@,@2 P8 PRPP@ PLPd PzP n%+4x;AJ?PVatof.o_exp5_twoe56_atofffltifdivi__ctype__ldexpfcmpiieeeusedfmulifaddiseekdir.o 422240025 0 10 100770 286 ` t0NV.*nHUNX-@ . gJ-@ . -@B/./N B -lHUNX-@Jf*nN^Nu@(#)seekdir.c 4.8 4/13/83PDP^P J&_lseek_seekdir_readdir_telldirselect.o 422239989 0 10 100770 99 ` NHx]N@eNuP _selectcerror send.o 422239989 0 10 100770 97 ` NHxeN@eNuP _sendcerror sendmsg.o 422239989 0 10 100770 100 ` NHxrN@eNuP _sendmsgcerrorsetbuf.o 422240053 0 10 100770 174 ` \NV.*nJg0-g /-NXms+n f mB `+m+| B*nN^Nu"Py _free_setbufsetbuffer.o 422240053 0 10 100770 173 ` XNV.*nJg0-g /-NXms+n f mB ` +m+n B*nN^Nu"Py _free_setbuffer setdopt.o 422239990 0 10 100770 100 ` NHx^N@eNuP _setdoptcerrorsetegid.o 422239990 0 10 100770 100 ` //HxYHxN@ NuP _setegidcerrorseteuid.o 422239994 0 10 100770 100 ` //HxYHx~N@ Nu _seteuidcerrorsetexit.o 422240083 0 10 100770 242 ` (40 #(H,BNupL,.(Nu@ @@ @(&setexit.ojmp_buf_reset_setexitsetgid.o 422239990 0 10 100770 95 ` ///YHxN@ Nu _setgidcerror setgroups.o 422239991 0 10 100770 102 ` NHxPN@eNuP_setgroupscerrorsethostid.o 422239992 0 10 100770 102 ` NHxN@eNuP _sethostidcerrorsethostname.o 422239992 0 10 100770 104 ` NHxXN@eNuPO_sethostnamecerrorsetitimer.o 422239992 0 10 100770 102 ` NHxSN@eNuP_setitimercerrorsetpgrp.o 422239993 0 10 100770 100 ` NHxRN@eNuP _setpgrpcerrorsetpriority.o 422239993 0 10 100770 104 ` NHx`N@eNuPC_setprioritycerrorsetregid.o 422239991 0 10 100770 101 ` NHxN@eNuP(_setregidcerror setreuid.o 422239995 0 10 100770 101 ` NHx~N@eNuP`_setreuidcerror setrgid.o 422239991 0 10 100770 100 ` Hx//YHxN@ Nu _setrgidcerrorsetruid.o 422239995 0 10 100770 100 ` Hx//YHx~N@ Nu _setruidcerrorsetsockopt.o 422239993 0 10 100770 103 ` NHxiN@eNuP_setsockoptcerror settimeofday.o 422239994 0 10 100770 105 ` NHxzN@eNuP_settimeofdaycerror setuid.o 422239995 0 10 100770 95 ` ///YHx~N@ Nu _setuidcerror sfloat.o 422240090 0 10 100660 1422 ` \ANqH?UUðcACBBDfJgvJffҀ`j`f<< gb<D FmQFf쨴fҀd$RE Em`VkgL[SEngBEd RE Eg, LNuJffg <`B`"<`UO/$ĀjA<B㉰dA c?|Jf?|$NwH<*ばcABDBCC g@JgN<<46H@HAւCHCЃD~NLHxNX-@HyNXJg8/.HxNP/.NXN^NuNVHxHyNP`PJg" .c .`-n-|HzHxNP-@/.NXN`N^NuP @&P:PFPZ@`PPPP #+2_alarm_setjmp_longjmp_sleep_signal_pauseOalarm.o 422239965 0 10 100770 98 ` NHxN@eNuP _alarmcerrorOpause.o 422239966 0 10 100770 98 ` NHxN@eNuP cerror_pausesetjmp.o 422240083 0 10 100770 134 ` $$ o HBNu o /L.Nu setjmp.o_setjmp_longjmpsocketpair.o 422239998 0 10 100770 103 ` NHxN@eNuP_socketpaircerror ssignal.o 422240026 0 10 100770 290 ` T NVH0..*n m* n" Y @(P Y @ ` L0N^NuNVH .. m n Y @*PfB`"fp` Y @B/NXL N^Nu(@8@t@@P _gsignal_ssignalsstk.o 422239999 0 10 100770 97 ` NHxFN@eNuP  _sstkcerror strcatn.o 422240027 0 10 100770 109 ` 4 NVH8*n(n ..&MJfSgSlSB L8N^Nuj _strcatn strcmpn.o 422240027 0 10 100770 125 ` D NVH0*n(n ..SmfJfB`JmHHSHHL0N^Nu _strcmpn strcpyn.o 422240028 0 10 100770 117 ` < NVH8*n(n &MB`g` BRm`Rm L8N^Nu _strcpyn strncat.o 422240028 0 10 100770 109 ` 4 NVH8*n(n ..&MJfSgSlSB L8N^Nu _strncat strncmp.o 422240029 0 10 100770 125 ` D NVH0*n(n ..SmfJfB`JmHHSHHL0N^Nu _strncmp strncpy.o 422240029 0 10 100770 117 ` < NVH8*n(n &MB`g` BRm`Rm L8N^Nu _strncpy strout.o 422240054 0 10 100770 362 `  NVH0..*n (n`@HTHH/NPSSm ,R @HH`HT/.NPRJl^ -f 0fSmHH",R AHH`HH",R AHH`SlHTHH/NPSl`,Sm ,R @HH`HT/.NPSJfL0N^Nu"PLPPP f__strout__flsbufstuff.o 422240054 0 10 100770 95 `  NVp N^Nu  _wdleng_yyportlib swab.o 422240029 0 10 100770 152 ` HNVH0*n(n .. rN.`0H2HЁ8TSlL0N^NuPF ldivt_swabswapoff.o 422240000 0 10 100770 136 ` $NHyN@eNuPP>6 SYS_swapoff_swapoffcerrorswapon.o 422240000 0 10 100770 134 ` $NHyN@eNuPPtSYS_swapon_swaponcerrorsymlink.o 422240000 0 10 100770 100 ` NHx9N@eNuP _symlinkcerrorsync.o 422240000 0 10 100770 97 ` NHx$N@eNuP  _synccerror syslog.o 422240084 0 10 100770 2352 ` P@NVH0Jl BBaP .n-n `A*HJo" 9f< .0> 9g&N/HyHUN HUNXJg(y`Jf: ` .R @gj  gd %f nRHH mfJm 9o/9HyHUN HUNXAeJfS B/. /./././.HnHn N 9glHxHyBHn NX/Hn /9N,JlZHyNX`J 9 @/Hy`@%B`@Hn NX/Hn /9N nJf,L0N^NuNV## JlfHy HyNP-@/9NX-@JgJgHxHyNP3BBHxHxN#Jm4BHxHy/NJl/9NX#JlHyNX n (3 n/( Hy/(N `Hy$NXJl\##HxHyANP#JlHyNNX#N^NuNV/9NX#N^Nu@(#)syslog.c 2.15 12/16/82 p%d error %dsyslog: send%ssyslogudpsyslog: socket/bindsyslog: can't find serv/host/dev/consolesyslog: Cannot open /dev/consoleloghost @ @@@b@pPx@ PP@@PPPP @ PPZ Pd@vPP@P@PPP@P@P@"@(@2@8@>PJ@PPnPt P~PP@PP@P@@@PPP P@$@*P2@>@H@R@\@f@lPt@~@P@@P@,@ !*7>BG+PW_h{ovFF{-;$psyslog.o_SccsId_SyslogHost_LogMask_sys_errlist_write_LogStat_openlog_errno_syslog_LogFile_bzero_bcopy_sprintf_bind_socket_closelog_LogTag_gethostbyname_getservbyname_sys_nerr_SyslogAddr_sendto_open_close_perror_strlen_getpidbcopy.o 422240074 0 10 100770 272 ` lT o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNu >8\: @)0bcopy.oretbloopbwdbytes_ovbcopy_bcopybind.o 422239969 0 10 100770 97 ` NHxhN@eNuPF _bindcerror bzero.o 422240075 0 10 100770 131 ` 8"o /B/gS @`"Q g2gNu {bzero.o_bzero gethostbyname.o 422240059 0 10 100770 291 ` `<(NVH8*nBNXN(@Jg,HU/NPJg&l`XJgHU/NPJfN L8N^NuPP(PDPPP(-7?_endhostent_gethostent_sethostent_gethostbyname_strcmp gethostent.o 422240060 0 10 100770 1057 ` $`(NVJfHyHyNP#`/9NX .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`<(n `,f" `./9HxHy(N -@g @ #gHy/.aP*@gBHy/.aP*@gB#,L/.NX yL #H#D`R  g  g#<#P@(y@Hy"HUaP*@f8`8R`4Jg8  g  gd(Hy%HUaP*@gBfB <<`RJfRfBL0N^Nu/etc/hostsrr# @@@P"@*@0P<@J@R@Z@`Ph@z@@@P@@@P@@,@0@:PB@N@X@n@t@x@~@@@@@pD(3t:+AIQ_gethostent_endhostent_sethostent_inet_addr_fopen_fgets_fclose_rewind getservbyname.o 422240062 0 10 100770 327 ` |<0NVH0BNXN*@JgJ//.NPJg(m`XJg//.NPJfJ g/. /- NPJfN L0N^Nu PP&PDP^PjPLLr(7?_endservent_getservent_setservent_getservbyname_strcmp getservent.o 422240064 0 10 100770 1060 ` ,`NVJ"fHy,HyNP#"`/9"NX .&N^NuNVJ"gJ&f/9"NXB"N^NuNVH0J"fNHy.HyNP#"f2BL0N^NuNVH0*n`L(n `<f2 `>/9"HxHy@N -@g @ #gHy0/.aP*@gB#DHy3/.aP-@Jg @BR n  g  gHy6/.aVP*@gnB/.NX#L#P#TH(yHHy9HUa P*@f8`8R`4Jg8  g  gd(Hy`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$Nu d&'N3V9b?lmultulmultneg_resultpos_resultzero_resulta_negb_neg perror.o 422240018 0 10 100770 445 ` H`NVH *| 9l  @*PJg*LZ`0SR`*0@D@J@X P^ PdPv@|@P@@@P@@@@ PP@@$@2@:@@@N PdP~P@@@@@ Jn&"f(.4=?CIecvt.o_cvtffixifdivi_fcvt_ecvt_modffcmpiieeeusedfmulifaddi flsbuf.o 422240039 0 10 100770 1190 ` xNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9&HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuXPP P P PPP@PX PP:Pd PxPPP\ f&y,L4;;BLT.Z3bj__cleanup_write__sobuf__flsbuf_free_fflush_fstat_close__lastbuf_malloc__iob_isatty_fcloseexit.o 422240012 0 10 100770 139 ` $NVN/.NXN^NuPP _exit__cleanup__exit data.o 422240037 0 10 100770 528 ` 0@  .$__sobuf__lastbuf__sibuf__iobfrexp.o 422240078 0 10 100770 864 ` ,,PNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE software "%+07@>C8KS@Ybjts|x. j@4H6 "&,5<<BhH M?Vb\.ck:rx>jBzNl (nSAVE03ffixiusetopffltid_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerofdivifdoubleisigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_packfsingleid_rcpgnshaddingd_unpki_packeswapdmexittopzerog_intendasf_rcpshsubusela_geninfi_unpkd_normf_packNSAVEDunpfcmpiieeeusedf_unpkfmulimsignCODESAVEMASKfsubigennanxit_2_dgotnanuselngenzeroextremassgna_ovflfaddisignffixisnormutopbigdrcpbigd_useld_extemexitasexitfloatflavorFETCH03gotcmpm_gennanfmodiffltis isinf.o 422240081 0 10 100770 186 ` \$NVJ gB` g fpN^NuNV . gB` .fJ gpN^Nu (isinf.o_isnan_isinflmodt.o 422240088 0 10 100660 485 ` xDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LB*M<Qptwodiv_big_bdiv_neg_aSAVElmodtulmodtdivide_by_zeropotdiv_recallRST strlen.o 422240028 0 10 100770 92 ` $ NVH *nB`RJf L N^Nu$ _strlentolower.o 422240032 0 10 100770 101 ` , NV... Am Zn ..N^NuH _tolower toupper.o 422240032 0 10 100770 101 ` , NV... am zn ..N^Nu _toupper truncate.o 422240001 0 10 100770 101 ` NHxN@eNuP_truncatecerror ttyslot.o 422240033 0 10 100770 553 `  ThNVH0BNX*@Jf^HxNX*@JfLHxNX*@Jf:BL0N^NuNV.*|HxHU/.N grB`Hx/HUNP(@Jf(M`RBHyNP,mB/aX*@Jg"RHUHTNPJf/NX `l/NX`\  f B <`4dR`V*nN^Nu/etc/ttys PP0PP@`P~P@PPPP@@ ;'0[9_read_strcmp_open_close_rindex_ttyslot_ttyname rindex.o 422240024 0 10 100770 100 ` , NVH0*n.f(MJf L0N^Nu _rindexstrcmp.o 422240027 0 10 100770 112 ` 8 NVH0*n(n fJfB`HHSHHL0N^Nu _strcmpttyname.o 422240033 0 10 100770 582 `  lxNVH0/.NXJgHn/.NPJmp0. fHyNX(@JgHTNX*@Jgj fHyHyNPHmHyNPHnHyNPJm0.nf .fHTNX <` HTNXBL0N^Nu/dev/P$PH@NP`Pv@|@P@P@PP@P Z&!.43<[E N_strcat_closedir_readdir_fstat_strcpy_stat_isatty_ttyname_opendirclosedir.o 422240009 0 10 100770 187 ` 0$NV.*n/NX*BHUNX*nN^Nu@(#)closedir.c 4.5 4/13/83P"PZy;_closedir_free_close fstat.o 422239974 0 10 100770 98 ` NHx>N@eNuP _fstatcerrorisatty.o 422240015 0 10 100770 118 ` $NVHn/.NPJlB`pN^NuP 3_gtty_isattyopendir.o 422240018 0 10 100770 250 ` T0NVH B/.NP. g `/NXB`Hx NX*@Jg*B L N^Nu@(#)opendir.c 4.5 4/13/83P&P6P ; "_open_close_malloc_opendirclose.o 422239971 0 10 100770 102 ` NHxN@eBNuP; _closecerroropen.o 422239985 0 10 100770 97 ` NHxN@eNuP _opencerror readdir.o 422240021 0 10 100770 239 ` NVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^Nu@(#)readdir.c 4.5 4/13/83P _read_readdir read.o 422239986 0 10 100770 97 ` NHxN@eNuP _readcerror stat.o 422239999 0 10 100770 97 ` NHx&N@eNuP _statcerror strcat.o 422240026 0 10 100770 96 ` ( NVH8*n(n &MJfSf L8N^Nu _strcatstrcpy.o 422240028 0 10 100770 92 ` $ NVH8*n(n &Mf L8N^Nu! _strcpystty.o 422240029 0 10 100770 171 ` @$NV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuP4P  _ioctl_stty_gtty ioctl.o 422239979 0 10 100770 98 ` NHx6N@eNuP _ioctlcerrorulimit.o 422240033 0 10 100770 323 ` <(NV . g g8 gX#p`^HnHxNP ."<N`< . r -@-@HnHxNPJmB`HnHxNP .N^Nu&P8PJPjPPL F$^/_ulimit_errnoldivt_setrlimit_getrlimit getrlimit.o 422239976 0 10 100770 102 ` NHxN@eNuP^_getrlimitcerrorsetrlimit.o 422239993 0 10 100770 102 ` NHxN@eNuP_setrlimitcerroruname.o 422240002 0 10 100770 132 ` $NHyN@eNuPP' K_unameSYS_unamecerrorungetc.o 422240056 0 10 100770 144 ` X NV.*n g:0-g -b -fJfRRS m B`p*nN^NuA _ungetcunlink.o 422240003 0 10 100770 99 ` NHx N@eNuPu _unlinkcerror unmount.o 422240003 0 10 100770 100 ` HxN@dNNu P _unmountcerrorustat.o 422240004 0 10 100770 132 ` $NHyN@eNuPP _ustatSYS_ustatcerrorutimes.o 422240004 0 10 100770 99 ` NHxN@eNuP% _utimescerror valloc.o 422240033 0 10 100770 177 ` <$NVNS-@ .Ю/NX-@Ю".F-@N^NuPP!_getpagesize_valloc_malloc getpagesize.o 422239977 0 10 100770 104 ` NHx@N@eNuP_getpagesizecerrormalloc.o 422240017 0 10 100770 1094 ` HNVH0Jf8 <# <### .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<N#BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^Nu @@@$@0@6@:@@@D@RPZ@`@@@@@P@P@ @P&@.@:@J@Z@`@|@@@@@0P@7 yF&._realloc_free_sbrkldivtuldivt_mallocObrk.o 422239966 0 10 100770 223 ` @0(NHxN@e#@BNu /й@/@HxN@e 9@#@NuP@ @2@:@P _end_brk_sbrkcerror ldivt.o 422240088 0 10 100660 531 `  DJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL/9/9 N// .NNNNN.`.<//././.N..N^NuNVBaXN/.NXN^NuJfJJg@Jf8 9Rg,#"y"X RPBNu PRNuHxHyHxN Nu@$No space for monitor buffer(s) No space for monitor buffer(s) mon.outmcount: counter overflow @(#)mon.c 4.6 (Berkeley) 3/8/83 %M% %I% (SUN) %E% " PJ Pd P~@P P@P@P@@PP@$@NP^ P@@PPPPPPPP P P$@,@2@8PD@J PX P^@p@zP@@  h,2Y;BKRX;cjFpy?.e;Z_exitffixifflti__cleanup_monstartupfdivifdoublei_write_monitor__exit_sbrk_countbasemcountldivtieeeusedfmuli_creat_minsbrk_close_profilffltis_numctrsb[lSR*p*pbx*40<$G"I#4HTHS/N /NXNuNu<@(#)crt0.s 1.2 (crt0.s) (SUN) 1/26/83@P(P@ ~r40&_exitstart_main_environmcountb[lKF*x*xbxl8h$G"I#HyHzNDPHTHS/N /N8XNuNV . "HAHABAЁrdN-@ 2l-|2 . RrN ".Ё-@/NX-@ fHx Hy HxN `*BNX#/./././. /.aN^NuNV.JfLBBBBNHxHyLNP./9/9/N /NX`##-n n  n!n  n!n# . # . .߮Jon . . .l>/9/9 N// .NNNNN.`.<//././.N..N^NuNVBaXN/.NXN^NuJfJJg@Jf8 9Rg,#"y"X RPBNu PRNuHxHyTHxN Nu@(#)mcrt0.s 1.3 (SUN) 3/8/83p@No space for monitor buffer(s) No space for monitor buffer(s) mon.outmcount: counter overflow @(#)mon.c 4.6 (Berkeley) 3/8/83 %M% %I% (SUN) %E% @P @.P:@fPPP@ PP@P(@.P8@>@F PRP`@h@PP@@PP P PP P(PFPP P`Ph@p@v@|P@PP@@ P@(@8@8 hD~"r+28>HNYW^gnt;ZF?.e;Z_exit_monstartupstart_main_environ_etextffixifflti__cleanupfdivifdoublei_write_monitor__exit_sbrk_countbasemcountldivtieeeusedfmuli_creat_minsbrk_close_profilffltis_numctrsb[l8gm0+**bxt|x0 XW!$G"I#HTHS/N# /NXNuNu!"-%L^?M ;AGIK_H \/2Z')BC@EF<=S]1367:[NR abeDJ>ZVX`+049#(* [Z8 dgszTW5cfhijmnoptuvwyY|qrxl{}~kNV/./. /.BBHx!N N^NuNV.HxBHxB/. /.N *@ . g< g 6g HgHyNX `/.NtX+@`+n`*nN^NuNV tmHyNX 9t\ @ RtN^NuNV tt$cHyNX y$ X$ y$ HX$ y$ X$ y$ X$BN^NuNVY$ y$#Y$ y$ "9®#Y$ y$#HY$ y$#N^NuNV/.NX-@ @ gHy`Hy,N`^ ќg <eHy?NX n"y"NR y!@/N8XP/.NXN^NuNV 9Ѡ @JmHyU`HyqN`, ќgNR"9Ѡ A /N8XN^NuNV <eHyNX 9ќ# y!|PN^NuNVH< 9Rќ*@-M 9Q$@`J&M`: o0A-H-S& n -k n'h n!nPe$n-MeA(H`" f-T/.HyNP`,Pe 9/HmN#PA#L<N^NuNVHJyoLSy`B0H4 @< FfRJlN#lB$|4`X Rf0*GfXJRm 0Hf<*lB`TJFf"09H b@0;NNbb0H @0H〙*K0H @0H倗A#@=F0Hb @<0H @0H2HЁR=@ nl*0.H @>0HN @0D@2@g0H @0H @>0.HU b@0;N  0:"D:`<BNZl0R^l*6T^*6^jRB\(<   j   @ v L(< X dv 8  VVVVVVVVf  ,pvN|^*6^HyNXR3`n0Hx @0H<JFm< Fl60H @0HN @ Pf0H @>`0Hx @<UYAԹd`Jg#`B m!@ U`#<`NB U/( m/(N> m` U/( m/( m/(N> m!@ U a"m"`/-NĄX`^B/N P#@#`BHxNjP#@#`B/`/N(`8#/-`/-/N P`/HxNjP#@B`T/-/`BNXNR#NR#HNR#@/`vNR#@/NtX//-HxmN /NZ`FJtgNR#@/N0X` #@/-`a JtfHyVNX m fJg #NR#H/N8X#tNR# f/-N`b/9NtX//-HxmN /`PJg /-NZ`JtfHynNXaTNR#HNR#NR#@/N8X#tJfn`aNR#BHxBHx/-N /HxlN /NZXNR#@/N0Xan`#@B`/N 8X#@#`+|;` g` gr` gb gV`j g fR g0 g$ g g fJgHyNX//-/-N`6 g f` gt f`d//- -R/`//-HxN //-Hx`Hy`tHxNtX//-/`nB/ -T` U (0 g (0 0fHyNX#@`B/`HxNtX// Nfp`Jp `D/N`//-HxoN #@ @ h a y@ a y@#@`n/-`B/-/-HxN /Hx `~B/-HxH`p/-/-HxF`` Df6/-NXJgHyNXB/-HxN +@#tBBHxN //-HxE`#tJrf 9t"HAHABAЁ @Jfj 9t"HAHABAЁ @/Hy!NPHxBHxBBHxaN -@ @!ytHx/.NPBBHxN #@ "HAHABAЁ0 @ 9rD0`BNtX#@ @!yє y@!|@JgHxN/X y@!@"y@#@ `BBHxN #@ @!yL!yP`bNf`//-NޖP#@ @ `pHx`BHxBHxaT /`^B/-`T -"HAHABAЁ @Jf8HxBHx$BBHxaN -@ @!mHx/.NP#tBBHxN #@ 9t`L.` R @PHH,fL N^NuNVH ..,. *y`R`ea . R @0HfHy/azPA#BL N^NuNVH0HxHyraLPHxHya fRr`6| ` |`| `| `Hy/aPP` 1f 0,a. R @0g "0,ar. R @0g "0,`v 4gn 3f`` 5fV`z ng.>\ x/HyNPHyNX`#Hx/aPav.o `bJgb 9gp@` 9gp`B/Hya X/NPP-@"HAHABAЁ(@ , f#`XHx/aPa . eg EfDa . +g -f yeR`Hy/a *P~eHx/aR` Hy/a PHyN1X`Hy/a P 90f0&|Jg, 9є#єHH0ѹєR`&|`. 9є"HA HABAЁHHЁ0#єRJf 9є-@Jg fBa. Lg lgHy/a ,Pp`a. R @0g$Hy/aP#HxHx.`j#Hy/aP0-H#0-H`#"p`#'BєBaF`f##Ep `ra. +f#N`a. &f# 9`2a. |f`#`a. g =f#T`a,. =g*nd +g,n0 &gn %g~`#P`#p`X# a.R @0#gHyqNXHy/a,P`# `#=`#?`#`#`z#`laF. g/HyNP#C` *gT` /gRn -g` g`` |g6`R/HyN`lL8N^NuNVH 9HH, Ω @g a b@0;N.~B 0*@`N/HyN |PJf60-H b@0;NJ|~`~`~`~ `~ `~`~`~`~`~`~`~`~`~~`x#0-H/B0-H/N #p!`0-H#`0-H#p"`##p#`v##`##1 9`B#$#HxHx aPa (f$#HxHx a\Pa "gbHyNX`"9R AHH`6 g g \fa>.SlHy/NPa . "f#HxHx aPa )flSm 9R @ HH`HyHx NPB` HyNXP UHHgpL N^NuNVH0`J*|D(|Jg g`^JfXNߌ`N#HxHx a PBa:. Ω @fDHy/aP#r#HxHx aPa. g*|D`, "HA HABAЁЇ0,`a.R fBJ9fh*|D(|`JfBSBHxdHyN*PJg/9HyNP" 9R/Hy NPa6. #g gHy/aPJgL0N^NuNVSm 9R @`HyN X-@J0gL 94 @R4 f* 94 @BHy HyNPB4 .N^NuNVJ0g  fJ4gS4/. . HH/N PN^NuNVH *nHUN 4XR.o>#ྐྵo#/9N X#JfHyNX/HU/9N *y߹̟ L N^NuNVH8(nB` HHЁ.Jf "<N -@(n-|` nJf>HxHxNP&@fHy4NX n n !@ n ".Ё*@~Jf n nJRHTaX* `Z UfHT/N |PJg T ne m e:HyMNXL8N^NuNV.Jg ve eHy\NX n-hJlHygNX ."HAHABAЁ*@JLgV/./HypN n/(NbX/9r n/( /(/. NX/HyN/. /.a*P n-h/./. a,P-@ -m- HH-@JLgHyNX/.NbX/. NX/HyNPHyNX/.NbX/.0-H/0-H/-HH/NX/HyN fJ-gnJg fh rfP gF . Q b@0;N....... . @f/HyNPJLgHyNXJf/HyNP+nnyr +|' ;yr g g  f;ytBNHXHxNHXHxNHX/.NHX`BB . ?/HUa!/.aXHUNѺXJLg/- 0-H/0-H/HyN` .f0-H-@ n-h-n`B .\ @ .\"@"RR .".-@ .0g6 .0 0f .\ @Jg .\ @Jg .\ @ .\"@ gv`- 9St-@ nJm "HAHABAЁ$ @  g n "HAHABAЁ$ @  gp n "HAHABAЁ& @ g4-U n "HAHABAЁ @-P .ذgY`F g g f00-H n g g g  f-HH-@JLg/.NX/HyDNP . @g0BHx . ?/HUa^JfV/.aHX`: . S b8@0;N,D,h,h>"/HyYNPHna*X*@`4 .U b@0;N&&`Jf` g fJrf~| .0 fV#T`J g> f@`. f0|/- N8` . f` g f` f| .0 gh` . fHyHUaPJf fFB`< . f 9R"- fn/.abX`b fX| .0 g`. . f00-H\ @Jf` g g g  g . @f 9rof  g\  gR  gH  f l4HUa,fX-@ n!@ ."HAHABAЁ`|/HynNP  f@ .0 g`( . g g f n ( ` .;@ n (;@ . @f . `HyHUaP`NR+@ .0 f#T`NR+@ |  fBNX/- N8`NR+@ B- `pHyHUa2P fLB`B+y R`0 .0 fL 9DP+@ D 9D"9tl|t 9D`^ 9D+@ 9DS"9D#D"9tlt 9Dt rfj- ``S bT@0;NXjjHHHHH*nN^NuNV mHyNX 9t @ RN^NuNV  gNfBNB<# # H#HBJPfF r$gHyNXJgHyNXJgHyNX#r$BB#D#Dt#tB#ќHxNXN^NuNVH0#@ LoHyNXB` t @,m "HAHABAЁ*@ Lo.//HyN /-NbXHyNX f.HxBHxBBHxaN (@)FHx HTaBPHUN4XHyHUaPRm>N,BNXHxNlXNR#/9HytNPBL0N^NuNVH0 ."HAHABAЁ*@ - bb@0;NXXXXXXX| . gp `p )@ . gp ` . gp `p/HTa>P#0-H/B/-N `\ . fBBBBBHxaN (@)n . gbp`n . g` . f`L0N^NuNV.BBHx BBHxaN *@+nJm HxHUazP*nN^NuNV./9a&X/9/Jm "HAHABAЁ @ ` </HyN 9gp` 9gp `p -@ .t @## .Rt @#< R\ @ t|B-n .X.` t @(/NHXJm mHyNX "HAHABAЁ*@ f& - l-@ - o-@0;@`0-H//-aP*-@g -?`0-H/0-H//-aD &Jf/HyNPo# "N Jg "NR"N,RmHxNHX 9"N Jg 9"NR"N# f@-|/.B/.a #/./.aP, T\ @ JfHyCNX \ @  T\ @ .Vt @ V\"@"/./N6P Lo T\ @/ R\ @/ \ @/ T/ R//HyXN R\ @.`J \ @/ \ @ "HAHABAЁ @/HyvN R \ @Jl .Tt @##/B/.N L N^NuNV/.NXN^NuNVaN^NuNV ."HAHABAЁ @ Jgp g g` g0`. ."HAHABAЁ @/HyNP ."HAHABAЁ/aX-@ ."HAHABAЁ @  ."HAHABAЁ$ @ /.aXN^NuNVH..,. Jl> g6 g. g& g g g/N#FX`B` 0NqT n. 0Jg gh fHyNX`P U b>@0;N04444440444` T\ @ `p`pLN^NuNV-|B .".0JgP g fHyNX .`v 0f"". \ A" .N-@R T o .\ @JfHyNXp ` .\ @ ".NN^NuNV. 9gưoHyNX-y .r N Jg .r NR-@ .m ../N/F`b ../N/FX .r N./N#X ../N/FX 9gHyNX..N^NuNV-y .".N Jg .".NR".N-@/.aXN^NuNV. Pm/.Hy)NP ."HAHABAЁ*@-HH#H  n!@ nB n!| n //.N-``FHy5NX`8 m f//(/(N. `/HUNX/N.PaHUNXL N^NuNVH`B yLJgRT$L yL.( f (R!@, \ @(m "HAHABAЁ-@ @ ( yLШ / n0(H/0(H//(/` yL (R!@* yL (\ @m Lbn yL-P ".N yLШ //( (R/ ( yL"(//(a` 0 0g^ LbLN^NuNV.-yL`$ yLJgHyLNX$L Lc6 yL.( g 0 0f yLJf!|#L..N^NuNVJPg/9HyVNPJTgST`*$L Lc yLJgBaN^NuNVH .. *n, "N Jg "NR"N, 9ܐd" gHyx`HyNX Ю* L N^NuNVH0*n(n 0-H//-a8P.,-F0-H/0-H//-a * -fP 9ܐdHyNX Ѕ-@"N Jg ."NR"N-@ .D`F - g -f& lHnHxHx a , .`Hn//a , -g ' f +F (B` gpL0N^NuNVH *nJl n (` -*Jl8 n (U b@0;N -`Jl n ( `0-H-@T\ @. .\ @,` 9"N Jg 9"NR"N#JmZHyN`Hz ~|`6z ~|`.z~`&JlHyNX~`/-N#FX.| . oHyNX-F J gZ 9"N Ю o0 9"N Jg 9"NR"N#Jl, 9ܐ dHyNX . ѹ`p f& - f-HH". @gp`B+y 9ܐ dHyNX . ѹ+EHUN#^XBL N^NuNVH B.9 rN-@BDrN Jg .rN rӮ - o/./- Hy#N `2/./N/X/Hy3` f n/(aXaJg n/(N0PXL N^NuNV.-n-n -n-|B-|BA   cHyBNXp`@0;N`L2L2L f-|`. fA -P`JfA -PR mdJf.-| g-n fX . `P f* f. g" fp` p` f g` ...N^NuNVH n !gHy[NXJ fB` LoBHy/. N@ n"n #h n !yt/. aX n"n #h n.(,(`> 0 0f R\ @/NHX ". 0f n /(N/X n !@ n (. g g g!G . LN^NuNVH *n.*a g -"-* Hf`J 6fB m,( aJfp`B m 6fr`BgHyjNX m!E/-aZX 6f /NHX m+h m+hL N^NuNVH *n,-g 0(g$ ".* 0(fZJ f" rf 9f-| g  f rf fV|` 0f fHyy` f 0g fHyNXB "`@ 0 0f R`: 0 f*HyNX ",Jg: 0 f*HyNX ", 0 f " fR+FL N^NuNV...Jfp` fp` fp` ..N^NuNVJf` 9g -|`H 9g -| `0Jrf -|` rf -| `-| . 0 fR .S b.@0;N2::$:$$$$$$$::$$::HyNX-| .@g 9fHy%NX .`@0;Nl>(.T.` 9fHy:` 9fHyH` 9gHyV`|Jrf HydNX rfjp `4 . 0 f* 9D m/. N,XJg` 9D m/. N,XJg`p` rlHy` rgHy` . 0 g Hy` . ". -@ 0 g& . 0 0g . 0 fVHy`D .S cD/.HyNPN^NuNVH n. "HAHABAЁ*@`0R m B*|` nfHyNX f|! -U n "HAHABAЁ @-P n "HAHABAЁ @*JLg/ n//.Hy N n L N^NuNVH8 Lo$/9/9/. /.Hy3NB-n ."<N -@-@"HAHABAЁ&@ fn &BB+ .`T+ C f *S(ngR m B&|` .fHy]NX`L8N^NuNVH0*n- C//aP"HAHABAЁ(@Jf )|`$g gre(|` L0N^NuNVH8.9rN!X(|` greHyoNX*L fB`0-H#rJlD#r- HHoJg -f" l#r/HyNP` HUN!`XJLg8- HH/- HH/ rN//HyN- gHUaX+||`"JgHUahX&@gHUHSa:P+|re*|f#rN!hL8N^NuNVH0*n(n +lll +l l ;l;l;l*L0N^NuNVH0*nA(Hre(|fHyNX g`HUHTajP- - A@ Jg/HyNPJLg4 rN/ rN/HyN rN#tL0N^NuNVH0*n- A.(Mf(|r`gX, Af f, JLgD rN/ rN/HyN `Hy NXL0N^NuNVH<*n (nJXg$HTHU .T @/HylN . @ , f| ft . g* Lg Mg`~JgHyNXBHU/.HUa6Jf"`N f& -"- +@+A ` p g fB f:*a(aJg/,NX ,` ./,NX ,`  g f g g fT fJ f@ . Sgn gnT gn& gn g`J g|`> gpn gf`( gD` BgNn" >gDn '@ @gHxBHx/+a'@  g: g +`/+aX'@`, +$@'j'j'j gHxHSaBP&@ gHxHSa*P&@  g HSarX&@ g HSavX&@ g*k(k . Agn gn glnr g0nF fF 9t"HAHABAЁ-@ @Jf n/HyNP'| 'k 'k'ytBBHSNP g HSaX&@HSN(FX&@JXgBHz!ZHSN@ ` n'h n0(H'@ n0(H'@ B'yt f'|@ n'h B'| &`^B'| `N&'|2B'|'yt'| ` BB'|'| B` ."HAHABAЁ& @ g2 g f - Rm - R\ @-P .\ @-Pm ."HAHABAЁ @-P ."HAHABAЁ @-P Lo/./.HyN ."HAHABAЁ& @ gN .찮fD-n)nJl ."HAHABAЁ @/Hy N`R` gL gB ."HAHABAЁ& @ g Hy$`Hy`N` - R*lHyN` -"-/ \ @//.a Jf. ."HAHABAЁ @/HyNPHSa X`x ;g> _gHyNX`*a&&m -`B/-Hxa -@*a&/./-Hx;a &@`H  g g fhB m/(Hxa -@B m/(Hxa -@ m a*&/./.Hxav //-Hx`t&aHUNp`& 'MB` - gHy`/+arX(@'L -0 gHyNX -"-'@0 gHyNX +"+'@'m'm fX m fLJmF @g< ("HAHABAЁ$ @HH-@ g fV g f +"+'@BHSHx ` g f>Hy` g/.Hyg` Bg` go g` Lgo Pgtn Mg` Qgf`| Vg(n( Tgn Sg`V Ug`H Xgn Wg`. Yg` L0N^NuNVH0*n m.( m,( g fz  @ g Pg QgHy)N` f f m"m ( g T @/HyENP` 0 g 0 0f(m`(m ,0 g8 ,0 0g& fJg6 T @/Hyi` m*( m((f m"m ( gHy` 0 0g 0 f 0 0g 0 f 0 0f6 0 0f& \ @ \"@ gHy`Z 0 0fR 0 0fR ". ",`HyNXL0N^NuNVH0*n m ("HAHABAЁ(@ m a*a/-aX*@ -0 g+| ,",-@0,H-@0,H-@//./.HUa *@-l ,HH-@@g` ,U bX@0;N  LLLLL4L  -|-| .".N".N-@JgV/././.HxBHx/./././.N-4/a /HUHxa /N(FX*@BHUHx a *@ .@g@0,H/B/,BHUHxga *@ , ".N ".?+@HUN(FX`R-|-|` -|-|` .T\ @-P`HyNX`L0N^NuNV.*n` ^gf _g: gfZ*m  g$ f m bg8 fg0 dg( -0 0g -0 gB`p*nN^NuNV.HxBHxBBHxah*@+n m n +|`& m n +|`+|+|@HUN(FX*nN^NuNV.*n/- /-/-HUaX/N-4*nN^NuNV n (0 gHyNXp `4 n/( /( ( n"(/N N^NuNVH8*n  f -` -(@HxBHx  f -` -/a(X/HTHxja&@HSN(FX&@  f+K`+K L8N^NuNVH *n -. g f - \ @ f~`6 - \ @ f~` - \ @ f~`~/N/X.+G -+@ f g+| +m L N^NuNV.*n -0 0f2 -"-+@RBHUHxa ` -0 g *nN^NuNV.*n  gx Pg8 Qg0 Rg, Sg$ Tg Ug/Hy&NP `b m b d m b eX`HxBHx/-aX/HUHxka /N(FX*nN^NuNV.*n-U m-h-n m-h m-h m-h m-h m-h . g g $g6 :g. og& .0 g-n-n-n/./././-aL+@/./././-a0+@ g* . @ f+n+n+n HUN(FX`/-aX-@/-aXghHy;NX`V .gJHyW` .0 f././.NP-@/./.NPl -n-n .R b@0;N `X`*nN^NuNVH *n& m.( m,(JgJf ogHyjNXB b e t  . b e t  ,  @ gF U bh@0;N,\^`PJNqz`D fp`p*`2*`. g g g f Jgz`z  @ g m((*`"Jg b e  ` (g/B//-a+@f of/B//-a+@  @ g m+h m+h m+h `,  @ g +|`+DB+E Jdg&// T @//HUHyN L N^NuNV.*n f fHUaX . f+n+n ` . 0g/././. BHUHxi`v fZ @fP  g  f<* b Nq -N+@+A+n +m HU`/././. BHUHxha/N(FX*nN^NuNVH8*n (nN0&@&'M'L'n'n'n L8N^NuNV.*n-M gHyNX-|`-m .gHyNX/.NX .*nN^NuNVHB n(  @  g g U mb<@0;N    bf rxRrxrx.R\\000000000000000000000000000000\0.bfrx~P~P0H 0 000\&0000000000000000000000  \ n h/(a4X*. n h/(aX,΀` <` gp` f T @/HyNPp` <`B` gp ` f` g < `  f  g <`f g <`R g <`> f g n h f <$` g n h f <D`  g <`p` <`  fJ f g <` g g <@ `z g g < `\ gl <`F g <E`2 of Jfp$` gpd`  f  g <G`Jg g <B` gpf` g <D` gp`` f` f g g <"D`d g <`R fd f g g <"` g0 g$ <ALN^NuNV . bb@0;NDXPPPPTTLLHHPPPPXXXXXXXXXXXXXXXXD`B`p `p` p`p`pN^NuNV.*n/- /-/-N rN-@HUNXJnHyNX/.aX*nN^NuNVH *n . R n "n"`HyNXU  nJ gHyNX  @ . T @/HUHyN f$/-Hy%NP/-Hy+NP/-NbX/- /-Hy2N L N^NuNV.*n fHxNXHxNlXNR-@/N8X fHx /-/-N. `Hx@/-/-N. +|B .D+@**nN^NuNV.*nJhgBHznHUN@ JtfHy g6 ^g bg cg dg fg` @f+|R`/-azX`Jm< -"HAHABAЁ @/N/X(@HTNX+@` -D/HySHnN Hn` m/( /(HxN ^rN+@ m/( HxNPrN+@`/-/-NBP+|W+|  g /-aX g L0N^NuNV n 8f*/(aX n!@ n/(aX n!@ .`6 n (0 fB/Hx N -@`/.aXN^NuNVH *n --@ g f HUNXJg `.  @ , g f /-aX+@/-aX+@  TgFn gn gnn gnR fx`HUN(FX`/-aX+@`T m gHyNX/-N,XJg( m  m!m m!m m!m *a -` m f `/-aXJg m (D!@*./-aXJf m f m g-m+m+n m f4-m-H-h-h+H n!n n!n+n fl m f` m fT m h fDHx m/(Hx/-NJg" m h a m a m+h m f6 m f, h f Hx m/(//-NJf m f\ m fPHx///-NJg6 m a/- /-/-/-N +@*a/-` fN/-a XJg@ m/(aX-@m,Jg*@. m!| "m#h  m!n f/-aXJg mJl (D!@*.`/-aXJg m g`l m f^-H+m+n P @0H*`2 gt`$ gn gZ` gL` Qgn( Ign NXNߌ `F g gHyFNX`HyN`HyW`Hy``HyhN`..N^NuNV/.HyNPN^NuNVR 9N^NuNVH Jg 9T"HAHABAЁ*@/9 aXa.HyNX/HyNP0-H/0-H/ -"-/N rN-@/./HyN .rN,`4 op`p, fpw`pl/HyNPJf/HyNPB/9 aXN3rL N^NuNVH BaX 9T"HAHABAЁ*@HUaX,- ", g fp`B# g fp`B#a0# HyNX/9HyNP g/9HyNP/9HyNPJgJHxDHyN*P/9/9rHy!N 9R/Hy,NPJgHav./Hy3NPHyBNXHyONX/Hy]NPNߌ-|@B` Ю @ "HAHABAЁ*@ -fn,- | +|' HnHUN؊P ( @/ - rN//-aX/HyrNp+F |` HnHUN؊PJgHyNXR m<#L N^NuNV 9r N Jg 9r NR#/9D/9N3 PN^NuNVN^NuNVN^NuNVN^NuNVN^NuNV.*n -f/N/X/HyNP -f - o /- aX`/N/X/HyNP*nN^NuNV? JlJ gHy`J fHyNX \g "fPB/.Hy`6R/.Hy`$ 0m\ 9nRB/.HyN`r :g m l |g ;gJfBSm 9R @ HH`Hy/.NP ? fHyNXN^NuNV.Jo,B`HyNXRm-n .ѹ..N^NuNVHyNXpN^NuNVN^NuNV/9rHyDHyHy$N\N^NuNV-|` n f X` nJf <N^NuNVHnHy$NP/. /.NpPN^NuNVH *n . " Ҁ A *Jo( . "HAHABAЁn  mJm -`a(Jg.HyNX/-HyNPHyNX/Hy NP/HyNPHy"NXHy/NXHyENXa~&/HyWNP~,-`8/ " Ҁ Af R" Ҁ A (` /Hy_N R oJl/a`  oTJm -`a(#Hx/. HUa /. HxavPJm/`l/HyoNP``~`FHyuNX " Ҁ A/Hy}NP " Ҁ A/(HyNPR oJm /-a6XL N^NuNVH *n/. atX. " Ҁ A ."@"#h o ./ S/HUa l" .R/ . / " Ҁ/a L N^NuNVH|` H@H@B@܀ So rNS*RrN. .l .` "Ҁ LN^NuNV . nHyNX . @/HyNP . @/HyNP .〰 o/9HyN`z .R na-@/.Hy` /9HyNP/. ./aBP .R n&/.HyNP/. .R/aPN^NuNV.*nHU/. B/. BBHxN /HxoN *@ m a*a -*nN^NuNVH0 n.  J\.HH n h!@ n h!F` .` .`0.` .` n h!n` n h g n/(NMX-@/.NMXgtJg`, n h gBHyNP n a n/(/( jfp `p` jgn ig` kg`L0N^NuNVpN^NuNVBN^NuNV .U b*@0;N `p` .0 gBN^NuNV.BNtX*@ .rN+@ *nN^NuNV.*n . й oHyNXp". Sr  㠁 . ѹ ѹ`: 9 r/Hy'NP 9 r#   l*nN^NuNV.A*H g/.HUNɤP @f/-/Hy3N `( .". NJ-@A*H/HyFNP .ѹ*nN^NuNV n ( g g/.aX . ѹ` n-h n hf h f n a n-h n ("(N> n!@ n!|@ n  n!| n!n`jN^NuNVJoX .ѹ ѹ`: 9 r/HySNP 9 r#   lN^NuNV._ ~` n  "@RR nJf  @B < ..N^NuNV . g g .`( .-@` .`N^NuNVpN^NuNV. ."HAHABAЁ*@/a4X/Hy_NP0-H/0-H//-N -@ .rN/HyjNPHypNX*nN^NuNV l g L g єmp`BN^NuNV/.NX#L#PpN^NuNVJPf/.NX/.N2XN^NuNVH NB~` Ю @*P -g`@0;NFpXP`hx``RJfS`VR`NR`FR`>R`6R`.R`&R `R`R`R`RTRJg0HHW !c6HH/Hy$NP`|RmN N. L N^NuNVJgHyD/9rNK~P#JgBHzX/.N@ /.Nq6XB/.aXBB/.N NN^NuNV###  9g##B` 9o#N`N^NuNV 9rN Jg 9rNR#NKN^NuNVH *nHUaPXJfBHUaXHxHUa:PB`Hx  @/aPRmL N^NuNVH0*n.  @ , gr f /-aX`b  g g g ;g/-aXJf /-aXJg&p`$/-aX(m/ HUNP(a`BL0N^NuNVH0*n.  @ ,  Kg$n ;gn gn g f/-aX g/-aX`HUNsXJg lHUN2X"9 A R(m m aHTHUNP(a`t gl`r Hg`n FgV`\ IgJ`P dg>n& Ngbn Lg(`. OgJ` mgn ff L0N^NuNV/.aXBJg"Hy3NXBHz/.N@ /.a XJg/9/9aP`/. /.aPN^NuNV .g\ f"HyE`HyK`HyPNX` g g ./HyVNP`^BB`Bp".g0JgHyaNXR . @/NXR . @JfN^NuNVH-n a/.aX n/(/NxPJg>/.HycNP/.aXHyoNXBHzd/.N@ n.  @ , n*  KgXn ;b[l8gm0+**bxt|x]gJn gHx/.` n-h-| `-n a /.aX n/(/NxP . //.NPJg` n.(/Hx/.a n a n a`N*/Hx/.a n"n"i#hHx n/(a0P n h ( n h!@BB n/(N HxIN-@/BNj@ /NXHx n/(aP/.NX n ^ nB n h"n#h n h"n#h n/(NX`N*/Hx/.a n ` n!EHx/.axP` n f/. /(N{P`*Hx /.aF`Hx`HyNX` nB n K././.NiNPJgX` nB n H././.NiNPJg*` nB n f././.Ni2PJg`  fHx n/(aP`/. n`/. /.N{PJf8 . g n Nfp`p n `/.N2X-@BB n/(N n!n n Nfp`p n n Nfp`p`/. /.NDPJf`/. /.NPJf/.N2X-@ n :BB n/(N n!n/.a >X n/(/NxPJgBHz /.N@ Hx n/(a*PHx/.`/. /.NPJf`/. /.N|dPJf  g`r Bg`f gj`X gn g`> g`0 Fg@n( :gn %g` ;g ` Ign Hg` Kg` gghn6 dgn bgn Ng>` fg` mgn lgL`x ng@`j n agP/. /NPJf>/. /.N2P* g$/. /.NlvPJg n afLN^NuNVH *n.  @ , g  Ign gHn g g HyZN` _gHyjNX n h`Hy~NX n/(a`J g ^f n/(aXJg@HyNX n/(aXHyNX` v n h  fHyNX n/(alXHy` n h` n.( g fHy` g f Hy`|Hy`rHxIN./Ba n/(NXHx1/.NP @,( ( @/HyNPp/N`/. n/(/a" ` hHyNXX 9|o D#|` :B` 0 n h (F n h!@HxR/.NP/aX n h (F n h!@` n h (D n h!@HxR/.NP/aX n h (D` n.(-h n  g ^gx _fR n g f& g fp`B`p nѨ`2 g gp`Hy` n-h n.( n m ^f@ (h @ g( f <` </HyNP`H 90( @/HyNP fpb`pw/HyNP/.aX 90( @/HyNP`: n ^f (h @ fH fpb`pw/HyNP/.aX 90( @/HyNP f 90( @/Hy NP n g g 90( @/Hy`*Hy!NX n bf n/(Hy,`Hy/`*B-| n bf *h(h`& n cf (hHy?`HyONX f( n*( -0 f ^gxHyYNXHUaX . @ ^gHy`NX .*@Rp"-㠁 -( @/HytNP ,0 f ^g _fJf(^`xHyNXHTa X . @ ^gHyNX .(@Rp",㠁 ,( @/HyNP n ^f(_ ^f*_,`| mp` mp`p( fpl` fpw`pb/HyNPHTaFXHyNXHUa0XHyNX٬٭Jf` 90( @&PHS rNS/HyN  ^f -h @ f _fJf -h @ fxHyNXHUarX . @ ^gHyNX .*@Rp"-㠁 -( @/HyNP ^f$ ,h @ g .f< ,( @/HyNPX 9|o#|R -( @$P ,( @-PN-@/HyNPHR/.HyN /.HSHy,N JgHR/.Hy:N Jg/.HyINPY n h f n h ` n h _f n h ^`/./. /.a\`/./.N`: n fj h Nf8 n h h (( @//.aX/HyXN` n h f n h h (( @//.aBX/Hyh` 0g` IgLn CgL` Lg` Rgfn( Ogn Ng`t Pg&`f TgnX Sg,`J cgn( agn Wg`$ bg` tgn fg` ~g`L 9xfJf HyO` ^f" -h @ g HyY`Hye` ^fT -h @ g< -( @-P/90/. 9D/a8 BHy`~ 90( @-P g/.HyNPHy/./.N 9xfJg8Hx/. 9D/a BHy/./.N n!|`|,,Jg "9)@xfJfHy`: ^f, -h @ g .gHy`Hy/./.N L0N^NuNV-|Jl-| .D-@ oJmH .( @-P/./.HyN /. /./.HyN`j/. Hy(NP`H/. /.Hy2N Q`* n/. /./.Hy=NBJnN^NuNV.*n gf*m  g g _f . ѭ`HyINX*nN^NuNVH 9, m 9R`p* m R`p,~`lp`p"h A R o~`lp`p"Ph A R o Ѕ#Jg 9Rl 9R#LN^NuNV fp`pN^NuNVpN^NuNVBN^NuNV.*n ^g6 g, g" _g f/-aXJgp`B*nN^NuNVH *n. g ^g g _fp` f/-a`X gBL N^NuNV.*n f*m ^g _f -h @ fp` g gB*nN^NuNV .0 f .".-@0 f  ffp`d .U bT@0;N(4J4@JJJJ(4`.  f$`  f`  f `  gBN^NuNV.*n ^f m np`B*nN^NuNVH *nJgF m/ m//HybN m/( m/( m/(Hy~N.HUalXJg <`N NfD/-aNXJg6 m f* hJf" m/( m/(ahPJg <`BL N^NuNV/.HyNPN^NuNV.*n  g ^gHyNX`4HUa` -( @/HyNPp"-㠁*nN^NuNV.*nHyNX*nN^NuNV.*n gf*m-m  g0 g4 ^gD _gnHyNX+n`/9/9| +"+Ng`&m f f kJg| f/9/9 +"+NgV  g HUNPHUNK(XB*nN^NuNV.*n g fHxHUNPJgv m  g g ^g _fJ l@` _f4 l*` gp egV fgvHyNXB`z  g f mJf . f m n`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@hh@@\@\@@@@@44          @@@@hh@@@\@\` f gf gZo Ѓl Ѓ`b `\ RmP `l ` R o m R`.p`(/-NcXJfl ` +y ` fJo o| g gJgp`B,Jg Єl Є` -@`-D "Ҁ .l "Ҁ`".+A ` gT gJ ^g.l*+K+L&L(m*(, `-k/.NaX& g fP f Jf@Jgp`B, Іl І` -@ І".l І` .`Jf l`l ` ,o ЃlF`: Rl`D fJo nlt`f Ѓl Ѓ` , Ѓl Ѓ` -@ 〼l"`".l l\ `* `$ fl ` ,l`m +@ L8N^NuNV.*n gf m!m*m f>*m f +n *m f m f +n *m/. HUa P*nN^NuNVHJg/. /.HyN (< n!n  *. n.  @ & n,( g f:R  =gn gn gn g|  Pgnl =g8n gn gn g`/ n/(aP n-h-E `/.NXXJf*< fx(<`n g`` gn g`J ?gn >g`( hg`/.NXXJf *<`*< ` g` f  g f*<` Lg` Tgn^ Rg nJ Qfl n h g n h fH*< n h f.` Sf"` hgn Uf ` lg g> fDLN^NuNV.*n f*m g f6 m f* hJf" m m n Hx/-`HxHUN7TP*nN^NuNV.*nB*nN^NuNVH *n f4.- g( g g/-NcX gp`BL N^NuNVH8*n(m&m  Rgn g` Qf f g f g f f f Jfl f/-aX+@ f/-aX+@Hx /-N7TPHx/-N7TPHUNXHxBN@Pp` Tg2n Sf`$ Ug mJ fR  @ g gHxHS` ^f +h @ f|Hx`  @ g , o&L(mHSa XJf ^f +h @ fHxHTaPJghHSa"X`\(m&mHTaXJg/,` ^f ,h @ f HxHSabPJgHTaXHx` T @/HyNP ^f ,h @ f* , o HTa2XJffHxHSaPJg` ^f +h @ fHxHTaPJgHSa"X`BL8N^NuNV.*n m ^g`Hx/`& _g\ gHyNXHx/-N7TP`$ -h @ g$Jf*^p`*m f _gB*nN^NuNV.*n m"m ( n IJ g ^g gHx/-aPJg /-a&X f m f /a@X+@Hx/-N7TP`@Hx /NPJg f4 m` h f. m h/(aXp`, m g m gg m ^gHx `B*nN^NuNV.*n - gV f . S"-g>  @  g g *m`B`/. /-aPJgp*nN^NuNVH|~n( h @ gp  @Jf`,Jl6.9n( h @ g<  @Jf,,JlHyNX  n!@` R`nR`LN^NuNVH8*n m  gB g: ^g _g* gg" `x m (h @ fJg$HUHy@NPBHyHHUN@ m f /(aX m gf h f m h/(aX(m gf(lHUN2X&@*:BB/-N +KHUNK(X/-HUaP(k gJf f `| k ( o6 (g/(HTaPJg /+aXHx/+N7TP ,g/,/+aJPJgHTaXHxHTN7TP -L8N^NuNVH8*n m.( m,(  =grn gn gnL f g f f JfPHUaX*@ m f /a8X+@ m f /aX+@ m!| Hx /-N7TPHx/-N7TPHUN X+|p` m ^f (h @ g:Jf4Hx/-N7TP`HUaX*@ m.( m (H&m-F` (m&m-GJg(Jg$ ,g/,HSaPJgHTaX ^f ,h @ fHxHTN7TPJg. ^f +h @ fHxHSN7TP m ^f" (h @ g mJg m!|Hx/-N7TPJg m ^f( (h @ g m g~ m!|`t m ^gƼo*Hx/a|PJg /-aXHx /-N7TPJg m f^/aXHUN0&@/NP*:+K/+N2X+@Hx/+a PJg /+apXHx /+` m gf h f m h/(`~ m ^g f m o` f g g g f m ^ff (h @ gL mJ f@Hx`*/-aX . g` g(n. f&` AgJn ?f`L Cg2o4 m g gf h f< m h/(a@X`(Jo$Hx/-aPJg /-aXHx `tBL8N^NuNV 9RN^NuNV/.HyQNPN^NuNVH *n`/-aX*a*m 8g cf*- m f*a*m*`^* HUNK(X _gF/-afXHUNK(X _g*/-aJXHUNK(X _gHyWNXۭ`> op`p. f <c` <p/HxHUN JnBBHUN `Hx HUN7TPL N^NuNVH *nB 8f/-aX.*m g f$ rN Jg rNR. P`\ cf2 rN Jg rNR.ޭ gR `" rN Jg rNR. XL N^NuNVH n.Jg//. /.HyN . g* .  b@0;N . gp` f n hJgB`f nJf g n f  g n f  g n o l  gz n o lz  fn`P _f` n lP`2/. /.NqfP` . g/.NbfXJf . @g" g _f n (f  g: g@ g& ^g _g `g| gg"` . @`,< . ` . g| n/(NbXJgf n.( ?#xp x"쁐#` .  ` n (h @ gp`p, n (h @ gV n ( @ n: fp`p`& . ` n/(NcX LN^NuNV . gp`|Jf-|J g/. /.Hy.N .0 fP . gD .".-@0 0g . //.abP` .".g . @` . gB` .U b@0;N*B~66fZNr` . `v . `j .  `^ . `R . `F . `: . `. . `" . ` . ` .  N^NuNVH *|` f#`$ afHy?NXB`" f  @ R pl  @Jg*| ag m  @, @g, g g _gB/NaPJg"`x  @ "gZ$`L N^NuNVH0NG @ f*y`T n  @*P`@ n f0` n gv gn _gf//NaPJfV$ ag m  @. @f n  @ "f - gHxL/.aP(@/-HTaPJg/- /,apPJgnHxR/.aP(@/-HTaLPJgL/-/,a:PJg8 -g -`JHU/.NdPJg/- /. /.a2 /. /-/.N <` <L0N^NuNV.*nBJgHHA bD@0;NJ::::: 0:::|:::::8RSm"HH"9R AHHR`zHyHH/NP`#`/. RHH//.NN, ` . gR  f`/9xHyJN`/9HyM`-| ."9x-@S ."9-@ MgF/NdvX`@ n/(HyP` n/RHH/NMr`0RHH//.aP @-h .-@/.HyS`HRHH//.apP/Nd`|RHH//.aRP/Nd`^RHH//.a4P/Nf`@RHH//.aP/Ne`"*nN^NuNV . .g 1g4 2g, 3g$ Lg0 RgR/. HyYNP`l . 1`X n  @  g4 n (`. n  @  f n (` .N^NuNV.##B#”B  @B h @ gJl#”# h @ gJl##R m..N^NuNVH n .(B`X  @ ^ //.aZP"0 A , @B $ @ SR g^`  @ ^ //.aP"0 A , @B $ @ R 0f g  @ _ 0 @  n dg cg fg bf n (r ` "<N/aX", A $ @  , @ ", A RB  @R mB` 0 @JlB`RmpLN^NuNV .ѹ o* 9rN Jg 9rNR# 9찹o# 9찹eHyNX 9쐹o 9쐹# 9DN^NuNV. n  @ g*/.NaX.//. /.a Jg ` n (. g//. /a Jf . g<.9”nx h @ g//. /.a` JfR` . g>.9`. h @ g//. /.a JfHRop..N^NuNV .h @ fHyNX . @ n> .h @ f . f . g$ n/(NaX f .f .Rh @ g .R @ n . @Jf .R @JgX .R @Jf/. /./.a Jf, . @JfD/. .R//.av Jg* . @ .R` . gB`< . @p`$ . @Jg/. /./.a N^NuNV .Dg/. HxL/.a4 Jgp`$ .g/. HxR/.a JfBN^NuNV/. /.NP-@ @ f @-h n _fF m, (S".g n (fPp`N n .g`< n ^f0 .g/(NaX f n (R".gBN^NuNVH *n.- ^f/-`: _f8 m&Hx S/a&PHx /`Hx/a PL N^NuNVJg./. NaX/ .( @/HyN .h @ g . @ S lHyNX/. NaX fr .f2 .h @ ".Rh A"gHy NX .R @ S lHyNXN^NuNVJg./. NaX/ .( @/Hy+N .h @ g . @R/. NaX fx .Rh @ g .R @R .f2 .h @ ".Rh A"gHyANXN^NuNVHJfHy|`HyNX`V gBB`6pg*JgHyNXR  @/NXR  @JfLN^NuNVH0JgD/.HyNP/. aRXHyNX/.N6XHyNX  g n afJ gHz/.NP n  @ gaJ g .g/.N`F . g6 . g*/.NX n ` nB nB`A*H . gHxL/.NP* . gHxR/.NP* . g* . g*4 . g*TAfHyNXB-|`: n g*A*H` n/(HTNPJf&X(UfP nJfHyNX n cf-h n)hHTajX(@/.NX n n!l n!l n!l n!l(a n  ^g _g` n (g (.  fpg  @Jf* n/(NaX f R @JgHyNX n/(/aP n/(/(a~P n/(/(/NY n!G n m (S-@ n (-@ . @ o .h @ f. . @ od .h @ gLHy`< n ( @ o* n (h @ gHyNXL0N^NuNV n "n" n "n#h n "n#h n "n#h n "n#h n "n#h n "n#hN^NuNVH0*nHUN0(@/aP.- ^f/-`P _fP m< S dgHx S/aPHx /`Hx/aP  @  g g `/-aLX)@/-a>X)@`L0N^NuNV.B h @ g  @JgHy NXR m..N^NuNV.-|B .-@RJf Sr-A ..N^NuNVRPHxuN#fX/. /.Hy$N\ HyHy$N\PHy$NX Po HyaXN^NuNVHxcN#fXJPg PnHy`:Hy4Hy$N\P/././. /.Hy$N\HyEHy$N\PHy$NXHxNXN^NuNVJTf^HxwN#fXHyGHy$N\P/./. /.Hy$N\HyQHy$N\PHy$NXN^NuNV-|v` n a c#vʠN^NuNV-yʠ f <v-@`2 . ` n af #ʠ `& g .` .fHySabXN^NuNVJPf8-|v`$ n ag/.Hyza,P ca#PBʜN^NuNV n ag Hz/aPN^NuNVJfHyċaX` n aN^NuNV.*nB-nHnHn/.HU n N  @  g& f*/./. /-a *m-n`*m-n`*nN^NuNVH *n  @ . g /. /-aP f /. /-aPHU n NXL N^NuNV.*|X`(  @ A T"@"Jl*nN^NuNV`*HyNX .".-@ .0 g .0 fHy ` .0 0fHy` . @/HyNPN^NuNVH0*nHUN 4X. 9ʜЇ mXX e HyaXBʜ yJf*HxN X(@f Hy6aX y HU y йʜ(@/N P Rѹʜ L0N^Nu8:# ]:#h:#  v:  :  :  :g:g &         & & &     '8 4  B P Di u  D€    ¦        g&g1  5 E gU [`` p 0{M~N fÉO fæN O NfOfN5OQ@ePm @e~@ePĎ @eğ" fį(fľ"  "  " f (f "   & " 4 B" E" S" a" n" {" ň # ŕ # Ţ # ů  ż   Le LLe LLq ~="Ɓ=" Ƙ=" Ʈ=" = = =OOC=LLO=\? _? ~? Ǥ? ? ?OO7?LLC@PfZh vfȀȎHȜhDDȠhDȡhDȢhȰhDȺhDh Jh JLh @h@h@h@hBF:hF=h @h Ch  Fh0Ih0Lh  OhPbQbXQTbWbXZnD]nhns @ ~N@NO@Nɀ:@:Ɂb@bɂ @Ƀ Ʉ@LɅ;@;Ɇn@nɇg@gɈ%@%ɉ@ Ɋ @ɋ @Ɍaaaaaaaaɍ@(#)table.68 2.11 (Berkeley) 4/11/83 clrZB AL moveq AR,AL movZB AR,AL movl AR,AL movl UR,UL Zf movZB AR,AL Za Za movZB AL@,A1 Z tstZB AR ZfZf cmpZB #0,AR clrZB A1 moveq AR,A1 movZB AR,A1 movl AR,A1 movl UR,U1 movl AR,A1 movZB AR,A1 movZB AR,A1 movl AR,A1 movl UR,U1 pea AR@ ZP pea CR ZP movl AR,Z- movw AR,A1 movl A1,Z- clrl A1 movw AR,A1 movl A1,Z- movb AR,A1 extw A1 extl A1 movl A1,Z- clrl A1 movb AR,A1 movl A1,Z- Zf movl UR,Z- movl AR,Z- Zb cmpZL AR,AL ZI cmpZL AR,AL ZIZc ZIZfZI moveq #1,A1 ZN negZB AL Zf notZB AL F movZB AL,A1 addqZB AR,AL F movZB AL,A1 subqZB AR,AL F movZB AL,A1 addZB AR,AL F movZB AL,A1 subZB AR,AL F movZB AL,A1 addqZB AR,AL F movZB AL,A1 subqZB AR,AL F movZB AL,A1 addZB AR,AL F movZB AL,A1 subZB AR,AL lea AL@(ZO),A1 pea AL@(ZO) ZP lea AL@(ZM),A1 pea AL@(ZM) ZP addqZB AR,AL addqZB AR,AL addZB AR,AL addZB AR,AL addZB AR,AL Zf subqZB AR,AL subqZB AR,AL subZB AR,AL subZB AR,AL subZB AR,AL Zf eorZB AR,AL eorZB AR,AL OIZB AR,AL OIZB AR,AL OIZB AR,AL OIZB AR,AL muls AR,AL mulu AR,AL mulu AR,AL extw AL movb AR,A1 extw A1 muls A1,AL andw #255,AL clrw A1 movb AR,A1 muls A1,AL movl AL,A1 swap A1 mulu #CR,AL muls #CR,A1 swap A1 clrw A1 addl A1,AL jsr lmult jsr ulmult Zf extl AL divs #CR,AL extl AL divs AR,AL andl #65535,AL divu AR,AL andl #65535,AL divu AR,AL extw AL movb AR,A1 extw A1 divs A1,AL andw #255,AL clrw A1 movb AR,A1 divs A1,AL jsr ldivt jsr uldivt Zf extl AL divs AR,AL swap AL andl #65535,AL divu AR,AL swap AL andl #65535,AL divu AR,AL swap AL extw AL movb AR,A1 extw A1 divs A1,AL swap AL andw #255,AL clrw A1 movb AR,A1 divs A1,AL swap AL jsr lmodt jsr ulmodt aOIw AL aOIZB AR,AL aOIZB AR,AL lOIw AL lOIZB AR,AL lOIZB AR,AL ZC movZB AL,A1 extw AL extw AL extl AL extl AL ZtZt movw AL,A1 andl #0xffff,AL movl AL,A1 extw AL movw AL,A1 andl #0xff,AL movl AL,A1 ZTZTZfZfZfZfZfZSZSZSZS .long CL .word CL .byte CL help; I'm in trouble NV.*n`XHytNX .@.. .-@ሁ*B`HyřNX*nN^NuNVH0*n.9 f JgV  g g g =gHTHyƨNP fJg m a m a*^B -gN gDHx HUN7TP`4  @(P` ` ` 0`L0N^NuNV.*nHyƱNX m aHxI/-/Nj@ *a*nN^NuNVH *n.- m,(  g g.  g< gDp`B f8 9 f`( f 9 g`/-NrX+@BL N^NuNVH0*n-y,-(m. f JgV  Qgn gnP gn4 gZn gHyNX/. N6XHyNXBHyHHUN@ HyNX`d . @/Hy=NP`B . @/HyF` . @/HyO` .0 @/HyX` f2 ,U b@0;N> f , g 9V-@` .  g& 9Ɛ @//. HUN `h . g ^gHya/. HUN 9H`Hyn`$Hy~`HyȐ/. HUN HyȚ/. HUN .T @/N`n fHyȤ` .l` .  f .  g 9Jg" g$ g< 9Ƅ`Hyȳ` ^gHxHUN`dPHyȽ`N-@Hy/. HUN /.HyNP ff-nN-@Hy/. HUN /./.HyN Hy/. HUN /.Hy NPHy/. HUN /.Hy`2 9Jg* g| g fHy"`lN-@/ m-h .( @/Hy0N /. .( @/HyDN`N-@/ m-h .( @/Hy_N /. .( @/Hys`HyɈ` g` =gln :g` Pg` Ugn( Sgn Rg` Tg`z _gpn ^gd`` hg`RL0N^NuNV 9Ɯ @/NXN^NuNVJʔg /.apX`jJgb n/HyʠNP/.a`X 9rN/ n0(H\ @ rN/HxHyʮNN^NuNV.Jʔgf/.a@X*nN^NuNVH ."<N  @-PJg2 n f .f . f fp .LN^NuNVH HxN X*@*+n +n+n +yʜRʜ ."<N .  @+P  @ -L N^NuNVH HxN X*@* +n+n+n n+h . "<N .  @+P  @ L N^NuNVHxHxHxHxa#HxHxHxHxa#HyHy/9/9Hyʾa HxB/9/9HyaHyHy/9HxHxHxHxan/HyaHxHx/9HxHxHxHxa8/HyazHxB/9HxHxHxHx a/HyaFHyB/9HxHxHxHx a/HyaHxB/9HxHxHxHxa/HyaHxB/9HxHxHxHxaf/HyaBHx/9HxHxHxHxa2/Hy atBHx/9HxHxHxHxa/HyaBHxHxHxBa-@/./.HyN BaXN^NuNV/./././. /.Hy,NBaXN^NuNVH0*n.- 0 f ". , 0 0f0-H-@`JgJʘg BʘaB*n - rN-@-HHS b@0;Nbl$~~~~`2-|G-m Jf/./HyIN HUaXHUa`-|X` -0 f -|` - n -|Y`-|[` -0 g-|]`p-|_`d0-HV\ @/HxHx/-a`-@fx-HH//HyaN `X ..,. n*(`$ \ @ \"@ fRR 0 0g 0 0f8 n-h`-| g g f@0-HR\ @-P f(-|0-HV\ @-P`-|-|-n/././.`0-HV\ @/HxHx/a$(@fHy~NX/,Hy˝`Lf/./././aJ/HyˠNP 0 g g( 0g(`T/./.Hx`lHyˤNX`6Hy˦` .R\ @ S//9Hy˨N ".g/./././a((@f$fZ g0-H\ @ rN///.Hx/a@`0Hx/.Hx/.a0-@`4/,Hy˳NPL0N^NuNVH g-n . g^ gV gj/./.Hy˶N L N^NuNV.*nfHxHyNP`n/. fps`pu//.HyN..` \ @ "HAHABAЁ*@/HyNPHUaX -@o-HH@//- Hy`*0-H/0-H//-N //- HyN R \ @ fRSm 9R @;HH`HyHx;NP`/.HyNP.. \ @ g \ @ "HAHABAЁ*@/- /Hy N R`-HHU b@0;N"N -0 f,/0-H\ @ rN/Hx$Hy`n0-H\ @ rN/Hx Hy!N `D -0 f,/0-H\ @ rN/Hx$Hy0` - o./- 0-H\ @ rN/Hx&HyA`/0-H\ @ rN/Hx(HyR`/- 0-H\ @ rN/Hx@Hyc`l 9rN/0-H\ @ rN/HxHys`4 - rN/0-H\ @ rN/HxHỹN*nN^NuNVH0JʔfJg .V\ @. "HAHABAЁ(@Jg0,HR\ @*/HxHx/,a2*@fB`,-Hx/Hx/,HUa/Hy̓NP0,H\ @ rN/////,a.HTa|XL0N^NuNVJgRJʔg/. /.a`: nJfHy̡NX`/.Hy̪NP/. Hy̸NPN^NuNVH0JgJʔga`(|*|DJg gB dl  @BR`Jf`f*|D(|`JfBSBHxHya PJg/9Hy̽NP" 9R/HyNP 9r찹.gV#.JgHHxDHyaP/9/9rHyN 9R/HyNPL0N^NuNVJgZJʔg /.aX`FHxHyaFP/9/.HyN 9R/HyNPN^NuNVJgZJʔg /.aX`FHxHyaP/9/.HyN 9R/HyNPN^NuNV.JgJʔg/.aX*nN^NuNVJgJHx n/aBPJg( 9rN/ n/(HyN /.aTXN^NuNVH Jf`B/.NPP"HAHABAЁ*@/Hy NPSm& -fpf`pF"9R AHH`Hy -fpf`pF/NPHUa XHUa` n.(*P(*( 0 g(HHS b@0;NTrT `HxHUaP DrN//HyN /.aX`Hx HUaP/Hy#NP`JDgp(`p&/HUaP n ( o //Hy+`HUN/X//Hy5`Hx@HUaTP//Hy>`nHx`HUa

`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVA-HA#ʨ=|B-n-|Hn/. N|PSm .R @BHH`HnBNP .N^NuNV4.-nB/`b yʨ S m. .R @HH yʨ"(R!AS AHH` /9ʨ .R @HH/NPR/ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHΩ @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHΩ @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|X-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N 4X-@8/.N 4XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|Y PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|[`J.g-|]J.g"/.N 4X".-A< o-@ .Xf -|_L`-|pLA`-H-H`P .P-@@ .P-@P".DN ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|΁`-|΄`Jl-| n P @-h-h/./.NPJf/./.N PJfHnHn .R l .R`p//./.N-@Jg -|·`J.g -|Ή`J.g-|΋AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9D/9@ .".NgP .S-@HJlD-@HJHg6 .Hr N 0S n .Hr N`S n0A .ذbJn/9L/9H .".Nfp+`p-S n.HHΩ @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.N PJfHnHn 0SR/9/9 .".Nfr/hdf`/9/9 .". NoF/9/9/9/9 .". N-@-ANl-n-n S` ./(@Jf n /d B9/`b\/hdT/9/9 .". N-@-A Hn//Nz -@-A .".N>0`/heB9/g`>*LZ`0SR`*0/b1 nRJf/c0R 9nB </L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N PJmJn -|`-nf9"HH/N XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXьe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N XJl~0-g /-N XBBBB BmB- L N^NuNVN(/.NXN^NuNV .". nJ/H?N\ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.N  N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N `PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0J/hf8 </l#/h </h#/l#/l/t#/h/p .^rN.*y/pB/| g`(*(U g " Ҁe " Ҁd(M *@b/tf/hgB`R/| /|o "<N#/|BNX(@ 9/|" Ҁe 9/|/NX(@g y/t 9/tXg y/t  9/|" ҀY(#/t </h A ` " Ҁ#/p/pc A#/x A 9/p*A L0N^NuNVH0*n(MY#/p (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ /x L0N^NuNHxN@e#ѐBNu /йѐ/@HxN@e 9ѐ#ѐNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL|%}u~szuxU  vwy{1|}t~szuxvwy{/|}t~szuxvwvyw.{y|t}(~szuxsuxvwy{|t}~szuxvwyv{w|y}~szuxt"uxtvwy{|}~szuxvwy{|}~szuxtvwvyw{y|{}t~szuxszuxvwy{|}t~szuxvwy{|}~szuxtVYWXPNOVYWXPNORQRQSTVYWXPSNTOVYWXPNORQRQSTVYWXPSNTOVYWXPNORQRQSTVYWXPSNTOVYWXPNORQRQSTVYWXPSNTOVYWXPNORQvwy{RQ}STszux STVYWXPNOVYWXPNORQ RQSTVYWXSTLVYWXPNOVYWXRQPNORQSTRQSTVYWXPSNTOvwy{RQ|}~szuxvSwy{|}~szuxvwy{|}szuxnRKHk}*}r(\>zG.pGGGGGm:P}*}!GGaT.G!GGGGG5G($_:'GGGlGGMGGGm5UGG G &GG/jGGGG|dtGGF9 [R} {x/v$)us:olkfe d\ZVOH ##%%&&&"""( ))++ ,,..'/' 000233111115566**--447!!89:$$$$$$$$$$$$$$$$$;;;<  "!#19 2!449826326:2!373338374 0298:4778 :46 223258599::::::::8332 8395)*$%9&+,-(/.57363599999522229573'+399972233933399bad bdtydimension table overflowwhiles, fors, etc. too deeply nestednon-constant case expressioncase not in switchswitch table overflowduplicate default in switchdefault not inside switchswitch table overflowduplicate case in switch, %dyacc stack overflowsyntax errorfunction level error$%dFAKEstructure typed union member must be namedfield outside of structureillegal field sizefield outside of structurezero or negative subscriptfunction declaration in bad contextold-fashioned initialization: use =nesting too deepillegal breakillegal continuestatement not reachedvoid function %s cannot return valueloop not entered at toploop not entered at toploop not entered at topprecedence confusion possible: parenthesize!old-fashioned assignment operator& before array or function: ignoredstructure reference must be addressableundeclared initializer name %sr  FIELD[%d]@(#)xdefs.c 1.1 (Berkeley) 9/7/82SNULLAUTOEXTERNSTATICREGISTEREXTDEFLABELULABELMOSPARAMSTNAMEMOUUNAMETYPEDEFFORTRANENAMEMOEUFORTRANUSTATICd@_0  "'`(2)3{4}5[6]7* ?:+ - /<%>&|^! L~M,88;9. D< S>U= ::)/*.,'1-%&$( 0$ ,5;@+FPCC/XXX SUN 4.1c bsdrwRelease: %s ccom:can't open %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ_$01234567890123456789abcdefABCDEF  01234567abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ$123456789  unexpected EOFnewline in string or char constantnon-null byte ignored in string initializerempty character constanttoo many characters in character constantunexpected EOFillegal character: %03o (octal)out of switch in yylexillegal hex constantnewline in BCD constantBCD constant exceeds 6 charactersgcos BCD constant illegalambiguous assignment: assignment op taken=<%c illegal=>%c illegalyylex error, character %03o (octal)bad asm constructionbad AR_?? action0,0,LL%d LL%d: | C: %sRan out of memory (savestr)ran out of memory (hash)ran out of hash tables@(#)scan.c 2.5 (Berkeley+SUN) 1/31/83asmautobreakcharcasecontinuedoubledefaultdoexternelseenumforfloatfortrangotoifintlongreturnregisterswitchstructsizeofshortstatictypedefunsignedunionvoidwhile0defid calltyreducedefid( %s (%d), , %s, (%d,%d) ), level %d modified to , %s previous def'n: , %s, (%d,%d) ), level %d declared argument %s is missing new entry made void type for %s dimoff, sizoff, offset: %d, %d, %d previous class: %s redeclaration of: %sredeclaration of %sparameter stack overflowbcsave errorparameter reset errorswitch errordclargs() %s (%d) dclstruct( %s ), szindex = %d ??gummy structure memberillegal zero sized structure member: %szero sized structure dimtab[%d,%d,%d] = %d,%d,%d member %s(%d) redeclaration of formal parameter, %scompiler takes alignment of functioncompiler takes size of functionunknown sizeinitialization alignment errorinoff errorbeginit(), curid = %d instk((%d, %o,%d,%d, %d) no automatic aggregate initializationinsane structure member listendinit(), inoff = %d too many initializersempty array declarationbad scalar initializationcannot initialize extern or union} expecteddoinit(%o) illegal initializationillegal {irbrace(): paramno = %d on entry too many local variablesStructure too largetoo many local variableszero size fieldillegal field typefield too bigstructure too largestructure too largenidcl error .lcomm L%d,%d .lcomm %s,%d illegal type combinationtymerge: arg 1Null dimensionarray of functions is illegalfunction returns illegal typea function is declared as an argumentfunction illegal in structure or unionfunction has illegal storage classillegal use of fieldillegal classillegal classillegal classillegal register declarationillegal classillegal classfortran declaration must apply to functionfortran function has wrong typeillegal class: %dSymbol table full nonunique entry for %s from %d to %d lookup( %s, %d ), stwart=%d, instruct=%d symbol table fullsymbol table full%s undefinedremoving %s from stab[ %d], flags %o level %d symbol table full%s redefinition hides earlier one %d hidden in %d unhide uncovered %d from %d unhide fails@(#)pftn.c 2.1 (Berkeley) 4/11/83Xbuildtree( %s, %o, %o ) constant argument to NOTconstant in conditional contextillegal lhs of assignment operatordivision by 0.%s undefinedmember %s==%s? illegal member use: %snonunique name demands struct/union or struct/union pointerstruct/union or struct/union pointer requiredundefined structure or unionillegal member use: %sunacceptable operand of &type clash in conditionalillegal functionillegal functionUnacceptable conditional expressionother code %dillegal indirectionassignment of different structuresmember of structure or union requiredchkstr( %s(%d), %d ) undefined structure or uniongummy structureillegal member use: perhaps %s.%s?division by 0division by 0illegal comparison of enumsenumeration type clash, operator %sillegal combination of pointer and integer, op %sillegal structure pointer combinationillegal array size combinationillegal pointer combinationundefined bit field typepointer requiredillegal oconvert: %dillegal pointer subtractionillegal types in :void type illegal in expressiontymatch(%o): %o %s %o => %o constant expectedconstant too big for cross-compileroperands of %s have incompatible typessizeof returns 0 %o) %s, 0x%lx, %d, , %d, %d statement not reachedL%d@(#)trees.c 2.6 (Berkeley) 4/15/83PQTURSXYVW& error@(#)optim.c 2.1 (Berkeley) 2/7/83 movb movbmovw movw jra LE%d jra L%d .even .text .data .data1 .data2 .stab illegal location counterL%d: movl d0,a0 movl #L%d,a1 .bss L%d: .=.+%d .text mov%c a0@+,a1@+ movl #L%d,d0 link a6,#0 addl #-LF%d,sp tstb sp@(-LP%d) moveml #LS%d,sp@ 0,%d,LL%d LL%d: movl #L%d,a0 jsr mcount .bss .even L%d: .skip 4 .text %s a6@(%d),%s bad argument .globl %s %s: " .ascii "\%c\%o" .ascii "%c" .long 0 illegal field type%s, line %d: movl subl #0x%lx,d0 cmpl #%ld,d0 bhi L%d addw d0,d0 movw pc@(6,d0:w),d0 jmp pc@(2,d0:w) L%d: .word L%d-L%d L%d: cmpl #0x%lx,d0 beq L%d cmpl #0x%lx,d0 beq L%d bra L%d bgt L%d bgt L%d L%d: @(#)code.c 2.3 (Berkeley+SUN) 4/11/83tbad conversionincode: field > int .word %ld .long 0x%X, 0x%X .long 0x%X .word %ld .comm %s,0x%lx @(#)local.68 2.6 (Berkeley) 4/15/83LotzQPUTSRYXWVbad option: %cstore called on: SZEROSONESMONESPECIAL+%d|order( %o, ) no table entry for op %sorder( %o, ), cookie , rewrite %s illegal initializationexpression causes compiler loop: try simplifying %o) %s, , NOPREF %s size=%d align=%dMUSTDO PREF %s, SU= %d @(#)reader.c 2.2 (Berkeley) 2/9/83SANYSAREGSTAREGSBREGSTBREGSCCSNAMESCONSFLDSOREGSTARNMSTARREGINTEMPFORARGSWADD  = ?AC #&),/258;>ADG  @JT^hr|QPQQSUVSUWUSXUSYWYVWYWYWXYWY?%s, line %d: | line %d, file %s LE%d: movl #-LF%d,d%d moveml a6@(0,d%d:l),#LS%d moveml a6@(-LF%d),#LS%d unlk a6 rts LF%d = %ld LS%d = 0x%x LS%d = 0x%x LP%d = %d %sfno hoptab for %sillegal zzzcodebad subroutine name jbsr jsr @ movl ,a0 jsr a0@bwl clrl %s sp@-Illegal ZT type conversion andl #0x%sffffff moveq #0,%s mov%c ,%s mov%c ,%s extw %s extl %s Illegal ZU%dNot a structure don't DO that STASG bad movl struct-assign botch,%s | left pointer movl struct-assign botch,%s | right pointer mov%c , movl #%d,%s lea struct-assign botch,%s | left tempval movl %s,sp@- L%d: movl %s@+,%s@+ dbra %s,L%d movw %s@,%s@ movl sp@+,%s addql #%d, %s subql #%d, %s movl %s,%s movl %s,%s movl %s,%s bset #%d, bclr #%d, andZB #N,AL orZB #M,AL movZB #CR,AL andZB #N,AL orZB #CR,AL movZB AR,AL andZB #N,AL andZB #M,AR orZB AR,AL andZB #M,A1 orZB A1,AL btst #%d, tstZB AL andl #M,AL movZB AL,A1 andZB #M,A1 andl #M,AL moveq #0,%s movZB AL,A1 andZB #M,A1 cmpZB #CR,AL andZB #M,AL cmpZB #CR,AL movZB AL,A1 andZB #M,A1 cmpZB #CR,A1lslllsrl movl #%d,%s %s %s,%s swap %s %s #8,%s %s #%d,%s illegal incraddr address shumul:op=%d,lop=%d,rop=%d prname=%s,plty=%d, prlval=%D 0x%lxillegal conput%sinsputillegal upper address#%sbad arg temp%s@(%d,%s)()illegal address#%sbad arg temp%s@(%d,%s)()@+-%ld%s%s+%ld %s #%d,sp addqladdw jra L%d bad conditional branch: %s cmp AL,AR tst AR cmp UL,UR tst UR address of OREG takenbad special shape@(#)local2.68 2.8 (Berkeley+SUN) 4/4/83addsuborandeormuldivdivslsrd0d1d2d3d4d5d6d7a0a1a2a3a4a5a6sp jeq L%d jne L%d jle L%d jlt L%d jge L%d jgt L%d jls L%d jcs L%d jcc L%d jhi L%d 'store finds both sides trivialrallo( %o, %d ) setbin can't deal with %sbad setstrcannot offload constrained subtreehard_rew( %o ): L%d: stuck starg movl AR,Z- movw AR,Z- @(#)order.68 2.9 (Berkeley+SUN) 4/4/83 h !@A @tshape( %o, %o), op = %d ttype( %o, %o ) bad setrew%d%d%d0x%lxbad getlr: %c@(#)match.c 2.2 (Berkeley) 1/18/83(]cjpvstack overflowusable asked about nontemp registerrfree( %s ), size %d register overfreedillegal freeregister overfreedrbusy( %s ), size %d illegal register pair freedRLEFTRRIGHTRESC1RESC2RESC3RNULLRNOP|reclaim( %o, , ) illegal reclaimcannot reclaimfaulty register movepotential register overwritepotential register overwriteregister allocation error@(#)allo.c 1.1 (Berkeley) 9/7/82LNAMESTRING^REG_OREGICONFCON`CCODES U- U*U&HUCALLKUFCALLL!M~lFORCEnINIThSCONViPCONV+h+=!i-( -=!) *  *=) &h&= i?:&&||8,;,OP:= %?%= @<<A<<=0 B>>C>>=0 |h|= i^H^= IN++ O-- E->FCALLIFCALLP==Q!=R<=S<T>U>YUGTXUGEWULTVULE]A>>!TYPE6[mCBRANCHgFLDjPMCONVkPVCONV$RETURN oCAST %GOTObSTASG cSTARGdSTCALLfUSTCALLğĥĪįĵĹľœP too many errorscannot recover from earlier errors: goodbye! compiler error: warning: out of tree space; simplify expressionwasted space: %ofreeing blank tree!undeffargcharshortintlongfloatdoublestrtyuniontyenumtymoetyucharushortunsignedulong??PTR FTN ARY %sout of temporary string spaceout of memory (tstr)@(#)comm1.c 1.1 (Berkeley) 9/7/82floating-point constant out of rangeincomprehensable floating-point conversion @(#)float.c 2.2 (SUN) 4/4/83  !'-4;BHNT[biou{ʂʉƽ &3?KWdq~Njǘdzɟɯ jsr %s jsr fcmpi moveq #0,U1 moveq #0,U1 jsr fdoublei jsr fpflt jsr ffltt jsr fflti jsr fpflts jsr ffltts jsr ffltis jsr fpfix jsr ffixt jsr ffixi jsr fpfixs jsr ffixts jsr ffixis movl AR,AL movl AR,AL jsr fsinglei movl d0,AL clrl Z- movl AL,Z- clrl Z- movl AL,Z- jsr fdoublei movl d1,Z- movl d0,Z- HEY! cookie = floatcode got a tree it didn't expect jsr %s jsr %s jsr %s jsr %s movl AL,A1 andl #0xff,AL andl #0xffff,AL extw AL extl AL jsr fsinglei tstl AL tstb AL cmpl #0x80000000,AL jeq L%d tstl AL jne L%d L%d: tstl UL jeq L%d tstl AL L%d: jbsr fcmpis tstl %s beqs L%d eorl #0x80000000,%s L%d: tstl %s beqs L%d eorb #0x80,%s L%d: eorl #0x80000000, AL .globl fpused .globl ffpused .globl ieeeused @(#)float2.c 2.5 (SUN) 4/4/83 fpaddfaddtfaddifpaddsfaddtsfaddisfpsubfsubtfsubifpsubsfsubtsfsubisfpmulfmultfmulifpmulsfmultsfmulisfpdivfdivtfdivifpdivsfdivtsfdivis .stabs "%s:p",0x%x,0,%d,%d intcharlongshortunsigned charunsigned shortunsigned longunsigned intfloatdouble .stabs "void:t%d=%d .stabs "%s:t%d=r%d;%d;%d;r .stabs "%s:%sSVGt# /* no info for %s (%d) */ unbelievable forward reference%d%d=*far%d;0;%d;%dcouldn't find basic type %d for %s ",0x%x,0,0,0 %d=%c%d%s:,%d,%d;,%d,%d;%d=e%s:%d,",0x%x,0,%d,_%s ",0x%x,0,%d,0 ",0x%x,0,%d,_%s ",0x%x,0,%d,L%d ",0x%x,0,%d,_%s ",0x%x,0,%d,%d ",0x%x,0,%d,%d ",0x%x,0,%d,%d .stabs "%s:T .stabn .stabs "%s",0%o,0,0,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,%d .stabs "%s:0,%d,%d 0,%d,0 0,%d,L%d 0,%d,%s 0,%d,%d 0,%d,%d No .stab for %s .stabn .stabs "%s", 0%o,1,0,%d 0,0,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,LL%d LL%d: 0,%d,_%s %Z%%I% %M% %G%Cp@@9@AׄBAy7D]?@$@$-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ь/. 4 &0,4(=@EpL R Z4biHqyT`|0'  1XKTr XL%-5ɤ=pE NV\b0hn4uʐ՚\H@ʜ ,#.6ژ?0JV_(i\s\}. .F||#-/4=DK*PY`hp v},?t&2,\ T $-49@4HL<RW^ekrzd4RX ?J4V0Z :^ !j(/5(<DDKT\d 4m$ Xu x|. x   <  R < |  3    ! @  A !(0@:DN<Sbfq<u|~#r04 ~є ќ ;< d@NR Ą ~D HR' JL- 4= TE#PX \` "e "m *r {$:tP D0p٢H8 %+ޖ ><Fp 6(f0Z7 <@tjI  S \elwb} @ F D`! Pײ4" x#    r - j &/ -dJ 6 r >%N E"( M/ V ]W 8 d\ l r t | [   B S  , t =t `T t  t  t v        "  *  2_ : BD J9Ѻ Sm!P ]h e m u{! }d  0 +X 0*  Ψ 1  \   f  ʔ     6( !kd )kL 1* 8hX @d G Os W  _ h0 q P y  ~ A l ( ߌ  | 1X   kp  T  D   ZL   $ 4 %. +J 2) 9  BP KK T$ ]7. f##F m/F v |> b  6 ؊  ; & y  0F @ { D !h !p . ˖  7H +, ! *D 2 L 8;N @DѺ Ib Q [v el o` wF }  cr OT dX 4 / K0P , -` f z !X !` U#^ <# Kad B ( /\5.>10E0M TS] f-4nv  ?[~plp s9*D j@^(Fa V#`, 3,<*DPU#W_g3 o uy1#f  & (3r | &D&n0G2sJɤH'M|d# /,z@D3s<D^BhN^i2X m_ DgKnj@u i|.lv+{7TXH2{ K( BxG%x,4 44<rDJKTt$\ hdolncv~ sdK~iNB e2)3T GKq6{2 6xtb"f*C:37 <7E6M3aS u] em`v b|edKaadyN,Mr L2h. `dZmhsdv a p!bf&Wcz08Z\D c Lg_xVqf_ ebn5ya t:Y Txl=c $|iKT;r4X|&K/R=RxJE K Q Z ` f-py@+  /QdN ”4HX Vœ P M" 3ʜ, ʠ6! > Ez KRY ~` ʤg/ Xn t; {R ʨ|y4   ʬof z(  ь3 j\PY*%+Q2R>D]KRW `] d @j8 sy /~crt0.orodata.ocgram.o_fakename_fakexdefs.o_ccnames_sccsidscan.o_bufr_sccsid_bufptrpftn.o_sccsidtrees.o_sccsidoptim.o_sccsidcode.o_sccsidlocal.o_sccsid_word_inwdreader.o_sccsidlocal2.o_sccsidorder.o_sccsidmatch.o_sccsid_mamaskallo.o_sccsidcomm1.o_sccsidtable.o_sccsidfloat.o_sccsidfloat2.o_sccsid_mult_minu_divt_plusstab.o_old_plcstab_sccsid_old_pstab_typelookup_maketype_old_poffs_old_outstab_reentertype_entertype_gentype_genstruct_t_int_tcount_old_psline_old_fixarg_old_prcstab_typetable_t_char_geninfo_inittypes_old_pfstabcalloc.ofreopen.ofprintf.ofprintf.oprintf.oprintf.oatof.oatof.o_exp5_twoe56setbuf.ostrncpy.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negsprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostrcpy.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_yydef_lastcon_plcstab_swtab_curclass_yyval_getlab_tfree_yyerrflag_dclstruct_regvar_contlab_addcase_dcon_block_dclargs_curftn_genswitch_werror_dimtab_swp_yylval_swx_retstat_psavbc_ftnarg_bcon_yylex_flostat_yynerrs_beginit_branch_savebc_yyerror_falloc_dstash_deflab_makety_resetbc_tymerge_types_endinit_sprintf_clearst_brklab_getstr_ecomp_autooff_bstruct_instruct_rstructieeeused_defid_buildtree_yyr1_yyr2_stwart_yychar_mkty_strucoff_yyv_swend_locctr_cerror_bccode_ftnend_lookup_irbrace_yyexca_prcstab_stab_yypact_optim_adddef_lineno_hflag_yyparse_ctype_swstart_blevel_yychk_moedef_brkflag_nidcl_icons_uclass_asavbc_doszof_retlab_yypgo_notlval_yyact_uerror_bdty_pfstab_ilbrace_curdim_idname_doinit_reached_scnames_minrvar_pflag_paramstk_node_inoff_cflag_paramno_ftnno_argoff_strflg_ititle_xdebug_ftitle_putbyte_ejobcode_edebug_printf_proflg_bycode_hash_lxcp_sourcelist_bdebug_pstab_strncpy__ctype__isitfloat_gdebug_fprintf_lxenter_xungetc__flsbuf_floatmath_oldwaylmodt_savetab_noprobe_freopen_tdebug_ddebug_tinit_caloff_lxcom_mkdope_fpflag_lxmask_lastloc_lxrdope_idebug_lxgcp_lxinit_ungetc_calloc_lxdope_psline_strcmp_p2init_offsz_saveleft_mainp1_yyaccpt_yytext_htab_savestr__filbuf_labelno_xgetchar_malloc_lxmore_strlen__iob_lxstr_lxres_lxmatch_nerrors_lxtitle_asm_esc_fincode_fldal_vfdzerolmultffixi_upoff_eprint_outstruct_oalloc_gotscal_instack_movestab_tsizeulmult_noinit_fwalk_fixclass_stabLCSYM_aoend_defnam_cinit_inforce_iclass_cisreg_fixtype_relook_pstk_unhide_outstab_tprint_tyreduce_vfdalign_defalign_tcheckldivt_psave_instk_hide_ibseen_ilocctr_fixarg_exname_commdec_cendarg_incode_efcode_talign_aobeg_aocode_fldty_zecode_bfcode_mknonuniqfflti_tstr_rbusy_chkstr_opactfdivi_prtdcon_ecode_talloc_opst_pconvert_ptmatch_offcon_bpsize_tymatchfcmpi_moditype_walkffmulifsubi_conval_stref_addroregfaddi_dope_psize_strargs_econvert_oconvert_convert_chkpun_clocal_p2tree_oflag_revrel_ispow2_fortarg_nncon_andable_strftn_toreg_strs_toreg_fltfun_setbuf_p2bbeg_fdefflag_crslab_where_ftlab1_ftlab2_select_heapsw_rnames_p2bend_NULLNAME_usedregs_walkheap_makeheap_atof_isitlong_p2compilefsinglei_fpdecoder_cast_tlen_setbin_maxtreg_store_deltest_udebug_markcall_genscall_lflag_setstr_eobl2_cbgen_fregs_setrew_lastchance_allo0_rdebug_e2debug_negrel_setincr_order_e2print_baseoff_offstar_maxtemp_allchk_deltrees_odebug_ncopy_canon_stoarg_setasop_rcount_rallo_delay1_delay2_stoasg_oreg2_get2lab_notoff_tmpoff_nextcook_tshape_cnames_maxoff_mkadrs_lineid_gencall_constore_stocook_vdebug_tcopy_reclaim_delay_Wflag_deli_sdebug_radebug_def2lab_myreader_match_stotree_prcook_sucomp_adrput_cbranch_t2debug_x2debug_codgen_szty_callflag_nrecur_setasg_setregs_spsz_upput_floatcode_conput__fltused_cntbits_genargs_shltype_insput_zzzcode_hopcode_fldshf_acon_ioptab_incraddr_getlr_rstatus_adrcon_callreg_isconv_shtemp_indexreg_expand_eval_field_brnode_shiftreg_special_resc_flshape_floatnote_rewfld_brcase_rmove_fldsz_respref_optim2_shumul_lbranches_ccbranches_maxtoff_popargs_toff_where2_argsize_double_conv_floatcmp_ezsconv_niceuty_find_mustdo_crs2lab_rewrite_rall_mkrall_minb_busy_floatop_maxa_maxb_hard_rew_maxargs_rfree_rtyflg_table_rwtable_opptr_allo_ttype_freereg_ushare_recl2_freetemp_mina_rwprint_shareit_usable_indope_itstrbuf_tstrbuf_fflush_curtstr_tfree1_tstrused_lastfree_strcpyulmodt_freeuldivt_cfree_lseek_errno_creat_open_close_fclose__pfile__print_ldexp_read_fstat__sibuf_fcvt_ecvt_isnan_isinf_modf__cleanup_write__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_frexpfdoubleif_rcpffixisfloatflavorfmodiffltiscerrorptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[%l9yvm**bx $,40 Ш$G"I#HTHS/N /N;XNuNuNV/.Hy4N&PN^NuNVHxaNXHy:N&XN^NuNVH0A*H(N/9HxHxHUN& gHy=NXXJ-geHyZNX`HnNXL0N^NuNV/9HxHxHyoN&JnHywNX 9oN^NuNV nJg0Hy/.NDP#Jf/.HyNP` #hN^NuNVJ o0/9/. Hx/.N& gHyNXN^NuNVH..Jo oHyNX/9/HxHyoN&gHyNX ,`JoS o @JgJg.Hy|/HxHyoN'RgHyNXLN^NuNVH N@#/. /.NXP-@NJfHy!aX#a>.JHg: r/ / /Hy"HyN&d  fgJnn _gn$ %gn gdnVJfZHy?HyN&dP`\ .Ю @ P -fR .m .o 9` .Ю @/`aP#T# # r"9g$#T r#BX` 9To#N|`N*@* r+@Ba+@ g a0+@`+|TB +|  y X e,HyUNv`&N*@* r+@B g a*+@`~B`vN*@*_ r+@ +@` r# g /Hya@P ghY gHyoNvXJgHy/9NfP#T*yJDgBHyHUN HUNXBHUNXBBHUN6 NlN\` r/aH` gHxI r/BN( `Y y+PY y+P` Y y+PB`/HyNvPHxN;`0 gN*@ * r+@  @  g gz gL` ^fN*@*^ r+@ +@/-/NPB+|`" cg n& bfFN*@a+@a+@`2 dg` gnl gxn. f /a XHyN&X` fHyNvX .JoaS` gn> f 9rNEJg 9rNJdR#N`v fR ga`VL N^NuNVH N@B~` Ю @*P -g`@0;NFxX`Php`hRJfS`^R`VRD`NB`FR`>Rt`6R `.RP`&R`R`RL`RH`RRJg0HHW !c.HH/HyNP`|RmNNR L N^NuNVH *nHUaPXJfB$HUaXHxHUa:PB`Hx  @/aPR$mL N^NuNVH0*n.  @ , gr f /-aX`b  g g g ;g/-aXJf /-aXJg&p`$/-aX(m/ HUN>P(a`BL0N^NuNVH0*n.  @ ,  Kg$n ;gn gn g f/-aX g/-aX`HUNذXJg $lHUNX"9$ A R$(m m aHTHUN>P(a`t gl`r Hg`n FgV`\ IgJ`P dg>n& Ngbn Lg(`. OgJ` mgn ff L0N^NuNV/.aXB$JDg"HyN&XBHz/.N /.a XJ$g/9$/9$aP`/. /.aPN^NuNV .g\ f"Hy`Hy`HyN&X` g g ./HyN&P`^BB`Bp".g0JgHyN&XR .\ @/N&XR .\ @JfN^NuNVH-n a/.aX n/(/N`PJg>/.HyN&P/.aXHyN&XBHzd/.N n.  @ , n*  KgXn ;gJn gP n a . g(BB/.N6 `n fP`t Hgln Ff<`` If2`V lgNn dgDn Lf`8 ff `. mg&/./.NVP* gj g n-h gBJgP/.Hy0N&P/. aXHyHx/.` n-h-| `-n a /.aX n/(/N`P . //.NPJg` n.(/Hx/.a n a n a`N*/Hx/.a n"n"i#hHx n/(a0P n h ( n h!@BB n/(N6 HxIN-@/BN( /NXHx n/(aP/.NX n ^ nB n h"n#h n h"n#h n/(NX`N*/Hx/.a n ` n!EHx/.axP` n f/. /(N2P`*Hx /.aF`Hx`HyVNvX` nB n K././.N6PJgX` nB n H././.N6PJg*` nB n f././.NPJg`  fHx n/(aP`/. n`/. /.NPJf8 . g n Nfp`p n `/.NX-@BB n/(N6 n!n n Nfp`p n n Nfp`p`/. /.NPJf`/. /.NFPJf/.NX-@ n :BB n/(N6 n!n/.a >X n/(/N`PJgBHz /.N Hx n/(a*PHx/.`/. /.NpPJf`/. /.N PJf  g`r Bg`f gj`X gn g`> g`0 Fg@n( :gn %g` ;g ` Ign Hg` Kg` gghn6 dgn bgn Ng>` fg` mgn lgL`x ng@`j n agP/. /NPJf>/. /.NVP* g$/. /.N^PJg n afLN^NuNVH *n.  @ , g  Ign gHn g.9$`.  @ g//. /.a JfHR%op..N^NuNV . @ fHyNX .% @ n> . @ f . f . g$ n/(N rX f .f .R @ g .R% @ n .% @Jf .R% @JgX .R% @Jf/. /./.a Jf, .% @JfD/. .R//.av Jg* .% @ .R` . gB`< .% @p`$ .% @Jg/. /./.a N^NuNV .Dg/. HxL/.a4 Jgp`$ .g/. HxR/.a JfBN^NuNV/. /.N*P-@ @ f @-h n _fF m, (S".g n (fPp`N n .g`< n ^f0 .g/(N rX f n (R".gBN^NuNVH *n.- ^f/-`: _f8 m&Hx S/a&PHx /`Hx/a PL N^NuNVJtg./. N rX/ .t @/HyN& . @ g .% @ S lHyNX/. N rX fr .f2 . @ ".R A"gHyNX .R% @ S lHyNXN^NuNVJtg./. N rX/ .t @/HyN& . @ g .% @R/. N rX fx .R @ g .R% @R .f2 . @ ".R A"gHy%NXN^NuNVHJfHy``HyfN&X`V gBB`6pg*JgHykN&XR x @/N&XR x @JfLN^NuNVH0JtgD/.HymN&P/. aRXHy{N&X/.NrXHy~N&X  g n afJ gHz/.NP n  @ gaJ g .g/.N`< . g6 . g*/.NX n ` nB nB`A*H . gHxL/.N*P* . gHxR/.N*P* . g*%@ . g*%` . g*%AfHyNXB-|`: n g*A*H` n/(HTNPJf&X(UfP nJfHyNX n cf-h n)hHTaRX(@/.NX n n!l n!l n!l(a n  ^g _g` n (g (.  fpg % @Jf* n/(N rX f R% @JgHyNX n/(/aP n/(/(aP n/(/(/N` n!G n m (S-@ n (-@ .% @ o . @ f. .% @ od . @ gLHy`< n (% @ o* n ( @ gHyNXL0N^NuNV n "n" n "n#h n "n#h n "n#h n "n#h n "n#hN^NuNVH0*nHUN(@/aP.- ^f/-`P _fP m< S dgHx S/aPHx /`Hx/aP  @  g g `/-aLX)@/-a>X)@`L0N^NuNV.B  @ g % @JgHyNXR m..N^NuNVH n.Jg//. /.HyN& . g* .  b@0;N . gp` f n hJgB`f nJf g n f  g n f  g n o l  gz n o lz  fn`P _f` n lP`2/. /.NP` . g/.N NXJf . @g" g _f n (f  g: g@ g& ^g _g `g| gg"` . @`,< . ` . g| n/(N XJgf n.( ?#'pp 'p"쁐#%` .  ` n ( @ gp`p, n ( @ gV n (% @ n: fp`p`& . ` n/(N X LN^NuNV . gp`|Jf-|Jg/. /.HyN& .0 fP . gD .".-@0 0g . //.abP` .".g . @` . gB` .U b@0;N*B~66fZNr` . `v . `j .  `^ . `R . `F . `: . `. . `" . ` . ` .  N^NuNVH *|` f#%`$ afHyNXB`" f % @ R pl  @Jg*| ag m 4 @, @g, g g _gB/N PJg"`x  @ "gZ$`L N^NuNVH0N @ f*y%`T n % @*P`@ n f0` n gv gn _gf//N PJfV$ ag m 4 @. @f n  @ "f - gHxL/.aP(@/-HTaPJg/- /,apPJgnHxR/.aP(@/-HTaLPJgL/-/,a:PJg8 -g -`JHU/.NPJg/- /. /.a2 /. /-/.N6 <` <L0N^NuNV.*nBJgHHA bD@0;NJ::::: 0:::|:::::8RS|m"HH"9R AHHR`zHy|HH/N8P`#`/. RHH//.N ` . gR  f`/9'pHyN&`/9%Hy`-| ."9'p-@S ."9%-@ MgF/N ^X`@ n/(Hy` n/RHH/N:`0RHH//.aP @-h .-@/.Hy`HRHH//.apP/N x`|RHH//.aRP/N `^RHH//.a4P/N`@RHH//.aP/N `"*nN^NuNV . .g 1g4 2g, 3g$ Lg0 RgR/. HyNP`l . 1%@`X n  @  g4 n (`. n  @  f n (` .N^Nuϼ:# :#:#  :  :  !:  $:g2:g6 & :%I%R \  _  j  m p& ~& Љ&  З Х  о8     D    D  $  =   _  ъ Ѭ  ѯg&g    g `  0MN f O f=N ZO vNfҒOfүNO@eP @e@eP% @e6" fF(fU" d r" Ӏӎ " fӑ (fӠ " ӯ  ӽ "  " " " " " "  # , # 9 # F  S  ~ LeԮ LL LL ="=" /=" E=" b= = ժ=OO=LL=? ? ? ;? a? ֕?OO?LL@f  f%H3hDD7hD8hD9hGhDQhDdh Jnh JLqh @th@ׁh@ןh@׵hBFhFh h h  h0h0h  hbbXQbbXnDnn @ N@NO@N:@:b@b @ @L;@;n@ng@g%@% @ ! @" @#aaaaaaaa$@(#)table.68 2.11 (Berkeley) 4/11/83 clrZB AL moveq AR,AL movZB AR,AL movl AR,AL movl UR,UL Zf movZB AR,AL Za Za movZB AL@,A1 jra CL jmp AL@ Z tstZB AR ZfZf cmpZB #0,AR clrZB A1 moveq AR,A1 movZB AR,A1 movl AR,A1 movl UR,U1 movl AR,A1 movZB AR,A1 movZB AR,A1 movl AR,A1 movl UR,U1 pea AR@ ZP pea CR ZP movl AR,Z- movw AR,A1 movl A1,Z- clrl A1 movw AR,A1 movl A1,Z- movb AR,A1 extw A1 extl A1 movl A1,Z- clrl A1 movb AR,A1 movl A1,Z- Zf movl UR,Z- movl AR,Z- Zb cmpZL AR,AL ZI cmpZL AR,AL ZIZc ZIZfZI moveq #1,A1 ZN negZB AL Zf notZB AL F movZB AL,A1 addqZB AR,AL F movZB AL,A1 subqZB AR,AL F movZB AL,A1 addZB AR,AL F movZB AL,A1 subZB AR,AL F movZB AL,A1 addqZB AR,AL F movZB AL,A1 subqZB AR,AL F movZB AL,A1 addZB AR,AL F movZB AL,A1 subZB AR,AL lea AL@(ZO),A1 pea AL@(ZO) ZP lea AL@(ZM),A1 pea AL@(ZM) ZP addqZB AR,AL addqZB AR,AL addZB AR,AL addZB AR,AL addZB AR,AL Zf subqZB AR,AL subqZB AR,AL subZB AR,AL subZB AR,AL subZB AR,AL Zf eorZB AR,AL eorZB AR,AL OIZB AR,AL OIZB AR,AL OIZB AR,AL OIZB AR,AL muls AR,AL mulu AR,AL mulu AR,AL extw AL movb AR,A1 extw A1 muls A1,AL andw #255,AL clrw A1 movb AR,A1 muls A1,AL movl AL,A1 swap A1 mulu #CR,AL muls #CR,A1 swap A1 clrw A1 addl A1,AL jsr lmult jsr ulmult Zf extl AL divs #CR,AL extl AL divs AR,AL andl #65535,AL divu AR,AL andl #65535,AL divu AR,AL extw AL movb AR,A1 extw A1 divs A1,AL andw #255,AL clrw A1 movb AR,A1 divs A1,AL jsr ldivt jsr uldivt Zf extl AL divs AR,AL swap AL andl #65535,AL divu AR,AL swap AL andl #65535,AL divu AR,AL swap AL extw AL movb AR,A1 extw A1 divs A1,AL swap AL andw #255,AL clrw A1 movb AR,A1 divs A1,AL swap AL jsr lmodt jsr ulmodt aOIw AL aOIZB AR,AL aOIZB AR,AL lOIw AL lOIZB AR,AL lOIZB AR,AL ZC movZB AL,A1 extw AL extw AL extl AL extl AL ZtZt movw AL,A1 andl #0xffff,AL movl AL,A1 extw AL movw AL,A1 andl #0xff,AL movl AL,A1 ZTZTZfZfZfZfZfZSZSZSZS .long CL .word CL .byte CL help; I'm in trouble NV.*nN-@ @ h n!m n!| n!m n!M .*nN^NuNV.*n/- m/N P*nN^NuNV.*n Nf( m ^f m/( m/(N PJf *m ^g g _fp`B*nN^NuNVH *n.  @ gn m"m ( mn f(Jo #$`` mJ nNHy(NX`P m gf h f m h`#$` m"m ( n#$#$L N^NuNV m* n nJf  m  nB`pN^NuNVH8*n.  @ ,-m/.N rX&B g g(m(, &m*+ U dbD@0;N`8`848>888888888888888888888888888888888888888hh88\8\8888844          8888``888\8\` f gf gZo Ѓl Ѓ`Z `T RmH `l ` R o m R`&p` /-N XJfl `+y ` fJo o| g gJgp`B,Jg Єl Є` -@`-D "Ҁ .l "Ҁ`".+A `x gT gJ ^g.l*+K+L&L(m*(, `-k/.N rX& g fH gHJgp`B, Іl І` -@ І".l І` .`Jf l`l ` ,o ЃlN`B Rl`L fJo nlt`n Ѓl Ѓ` , Ѓl Ѓ` -@ 〼l"`".l l\ `* `$ fl ` ,l`m +@ L8N^NuNV.*n gf m!m*m f>*m f +n *m f m f +n *m/. HUa P*nN^NuNVHJ g/. /.HyGN& (< n!n  *. n.  @ & n,( g f:R  =gn gn gn g|  Pgnl =g8n gn gn g`/ n/(aP n-h-E `/.N XJf*< fx(<`n g`` gn g`J ?gn >g`( hg`/.N XJf *<`*< ` g` f  g f*<` Lg` Tgn^ Rg nJ Qfl n h g n h fH*< n h f.` Sf"` hgn Uf ` lg g> fDLN^NuNV.*n f*m g f6 m f* hJf" m m n Hx/-`HxHUN@P*nN^NuNV.*nB*nN^NuNVH *n f4.- g( g g/-N X gp`BL N^NuNVH8*n(m&m  Rgn g` Qf f g f g f f gt f/-aX+@ f/-aX+@Hx /-N@PHx/-N@PHUN NXHxBNPp` Tg:n Sf`, Ug" mJ fR  @ g g.HxHS` ^f + @ f|Hx`  @ g , o&L(mHSa0XJf ^f + @ fHxHTaPJghHSa"X`\(m&mHTaXJg/,` ^f , @ f HxHSabPJgHTaXHx`& ( @/HyXNP ^f , @ f* , o HTaBXJffHxHSaPJg` ^f + @ fHxHTaPJgHSa"X`BL8N^NuNV.*n m ^g`Hx/`& _g\ gHyrNXHx/-N@P`$ - @ g$Jf*^p`*m f _gB*nN^NuNV.*n m"m ( n IJ g ^g gHx/-aPJg /-a&X f m f /aXX+@Hx/-N@P`@Hx /NPJg f4 m` h f. m h/(aXp`, m g m gg m ^gHx `B*nN^NuNV.*n - gV f . S"-g>  @  g g *m`B`/. /-aPJgp*nN^NuNVH|~%n(  @ gp % @Jf`,Jl6.9$%n(  @ g< % @Jf,,JlHy}NX  n!@` R`nR`LN^NuNVH8*n m  gB g: ^g _g* gg" `f m ( @ fJg$HUHyN&PBHyHUN m f /(aX m gf h f m h/(aX(m gf(lHUNX&@*:BB/-N6 +KHUNX/-HUaP(k g~ k ( o6 (g/(HTaPJg /+aXHx/+N@P ,g/,/+a`PJgHTaXHxHTN@P -` L8N^NuNVH8*n m.( m,(  =gjn gn gnD f g f gPHUaX*@ m f /ajX+@ m f /aPX+@ m!| Hx /-N@PHx/-N@PHUNlX+|p` m ^f ( @ g:Jf4Hx/-N@P`HUaX*@ m.( m (H&m-F` (m&m-GJg(Jg$ ,g/,HSaPJgHTaX ^f , @ fHxHTN@PJg. ^f + @ fHxHSN@P m ^f" ( @ g mJg m!|Hx/-N@PJg m ^f( ( @ g m g~ m!|`t m ^gƼo*Hx/aPJg /-aXHx /-N@PJg m f^/aXHUN&@/N>P*:+K/+NX+@Hx/+a$PJg /+aXHx /+` m gf h f m h/(`~ m ^g f m o` f g g g f m ^ff ( @ gL mJ f@Hx`*/-aX . g` g0n. f&`" AgJn ?f`L Cg2o4 m g gf h f< m h/(ajX`(Jo$Hx/-aPJg /-aXHx `tBL8N^NuNV 9$R$N^NuNV/.HyN&PN^NuNVH *n`/-aX*a*m 8g cf*- m f*a*m*`^* HUNX _gF/-aXHUNX _g*/-atXHUNX _gHyNXۭ g\SSHyHxHUN `> op`p. f <` </HxHUN JnBBHUN6 `Hx HUN@PL N^NuNVH *nB 8f/-aX.*m g f$ rNEJg rNJdR. P`\ cf2 rNEJg rNJdR.ޭ gR `" rNEJg rNJdR. XL N^NuNV/9HyHyHyN&dN^NuNV/. /.HyN& N^NuNVH..BB` l gRRJf LN^NuNV-y .rNJd-@rNEJg .rNJdR-@<'/9'axXѮ/9HyN&P o,Hx/9HyN& /9HxHy`/9/9Hy3N& HyMN&XHyWN&X/./9Hy]N& o 9'//9Hyl`/9'/9HyzN& 9'P//9HyN& B'B'Jg BN&BN^NuNV.*|`6  f,/-HyN&P Ff4HyN&X`$PJl . ( @/HyNP*nN^NuNV n (U b0@0;N&&&"&&&&`p` p`p`pN^NuNVH< . Ugn Mgbn Bgn Z -gn > g HyN` _gHyNX n h`HyN&X n/(a0`J g ^f n/(aXJg@HyN&X n/(aXHyN&X` v n h  fHyN&X n/(aXHy` n h` n.( g fHy` g f Hy`|Hy`rHxIN./Ba n/(NXHx1/.N*P @,( t @/HyN&Pp'/N`/. n/(/aB ` hHyN&XX 9'o D#'` :B` 0 n h (F n h!@HxR/.N*P/a"X n h (F n h!@` n h (D n h!@HxR/.N*P/aX n h (D` n.(-h n  g ^gx _fR n g f& g fp`B`p nѨ`2 g gp`Hy` n-h n.( n m ^f@ ( @ g( f <-` <0/Hy!N&P`H 9%\t @/Hy5N&P fpb`pw/HyCN&P/.aX 9%\t @/HyKN&P`: n ^f ( @ fH fpb`pw/HyPN&P/.a2X 9%\t @/HyXN&P f 9%\t @/Hy]N&P n g g 9%\t @/Hyg`*HyqNX n bf n/(Hy|`Hy`*B-| n bf *h(h`& n cf (hHy`HyNX f( n*( -0 f ^gxHyN&XHUaX .%@ @ ^gHyNX .%@*@Rp"-㠁' -t @/HyN&P ,0 f ^g _fJf(^`xHyN&XHTa@X .%@ @ ^gHyNX .%@(@Rp",㠁' ,t @/HyN&P n ^f(_ ^f*_,`| mp` mp`p( fpl` fpw`pb/Hy N&PHTafXHyN&XHUaPXHyN&X٬٭Jf` 9%\t @&PHS rNJdS/HyN&  ^f - @ f _fJf - @ fxHy&N&XHUaX .%@ @ ^gHy,NX .%@*@Rp"-㠁' -t @/Hy@N&P ^f$ , @ g .f< ,t @/HyWN&PX 9'o#'R -t @$P ,t @-PN-@/HyfN&PHR/.HykN& /.HSHy|N& JgHR/.HyN& Jg/.HyN&PY n h f n h ` n h _f n h ^`/./. /.a\`/./.N!`: n fj h Nf8 n h h (t @//.aX/HyN&` n h f n h h (t @//.aBX/Hy` 0g` IgLn CgL` Lg` Rgfn( Ogn Ng`t Pg&`f TgnX Sg,`J cgn( agn Wg`$ bg` tgn fg` ~g`L 9'pfJ%f Hy` ^f" - @ g Hy`Hy` ^fT - @ g< -t @-P/9%\/. 9%D/a8 B%Hy`~ 9%\t @-P g/.HyN&PHy/./.N 9'pfJ%g8Hx/. 9%D/a B%Hy/./.N n!|`|,,Jg "9%)@'pfJ%fHy`: ^f, - @ g .gHy`Hy-/./.N L0N^NuNV-|UJl-|Z .D-@ oJmH .t @-P/./.Hy_N& /. /./.HymN&`j/. HyxN&P`H/. /.HyN& Q`* n/. /./.HyN&BJnN^NuNV.*n gf*m  g g _f . ѭ`HyNX*nN^NuNVH 9, m 9R`p* m R`p,~`(lp`p" A m p'R o~`.lp`p"P A m Prᡃ'R o Ѕ#JHg 9HRl 9HR#LN^NuNV fp`pN^NuNVpN^NuNVBN^NuNV.*n ^g6 g, g" _g f/-aXJgp`B*nN^NuNVH *n. g ^g g _fp` f/-a`X gBL N^NuNV.*n f*m ^g _f - @ fp` g gB*nN^NuNV .0 f .".-@0 f  ffp`d .U bT@0;N(4J4@JJJJ(4`.  f$`  f`  f `  gBN^NuNV.*n ^f m np`B*nN^NuNVH *nJHgF m/ m//HyN& m/( m/( m/(HyN&.HUalXJg <`N NfD/-aNXJg6 m f* hJf" m/( m/(ahPJg <`BL N^NuNV/.HyN&PN^NuNV.*n  g ^gHyNX`4HUa` -t @/HyN&Pp"-㠁'*nN^NuNV.*nHyNX*nN^NuNV.*n gf*m-m  g0 g4 ^gD _gnHy NX+n` f , g 9V-@` .  g& 9 @//. HUN `h . g ^gHy}/. HUN 9d`Hy`$Hy`Hy/. HUN Hy/. HUN .p @/N&`n fHy` .` .  f .  g 9Jg" g$ g< 9`Hy` ^gHxHUN,PHy`N-@Hy/. HUN /.HyN&P ff-nN-@Hy/. HUN /./.Hy N& Hy/. HUN /.Hy%N&PHy//. HUN /.Hy9`2 9Jg* g| g fHy>`lN-@/ m-h .t @/HyLN& /. .t @/Hy`N&`N-@/ m-h .t @/Hy{N& /. .t @/Hy`Hy` g` =gln :g` Pg` Ugn( Sgn Rg` Tg`z _gpn ^gd`` hg`RL0N^NuNV 9 @/N&XN^NuNVA-H#/Hn/. N)

*LZ`0SR`*0p@b1 nRJfp@c0R 9nB <p@L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NLN .B`T0-f(mfHn-HH/NFPJmJn -|`-n|f9HH/NFXJgm+|O+|O+n 0-gl(m m R Э "-d f -,/HT-HH/NLN .+L`/.NGdX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NLN . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NLN g m p`BL0N^NuNV.*|h` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NFXJl~0-g /-NIXBBBB BmB- L N^NuNVN:/.NLdXN^NuNV .". nJ/H?N= n g B5H 4@f8Jf g,///:8/:0 "N@> !A :":N@F` !FLN^Nu?H<"Ba` H<"a&atLBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|h`eB` 0,f -+fp`B, wf0Hx/.NEdP.JgJm/NFXHx` afvJgp`p//.NFP.lB of6Hx/.NEdP.Jg Jm/NFXHx/.NFP.Jm.HxB/NE `Jgp`B//.NFP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NF N^NuNLXHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NG4PJlB`pN^NuNLXHxN@eBNuNLXHxN@eNuNLXHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NGZ N^NuNV/. Hy@t/.NGZ N^NuNLXHx6N@eNuNVH0Jpf8 <p#p <p#p#pp#pp .^rNJ^.*ypBp g`(*(U g " Ҁe " Ҁd(M *@bpfpgB`Rp po "<NJd#pBNJX(@ 9p" Ҁe 9p/NJX(@g yp 9pXg yp  9p" ҀY(#p <p A ` " Ҁ#ppc A#p A 9p*A L0N^NuNVH0*n(MY#p (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNJ^.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ p L0N^NuNLXHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL%?%= @<<A<<=0 B>>C>>=0 |h|= i^H^= IN++ O-- E->FCALLIFCALLP==Q!=R<=S<T>U>YUGTXUGEWULTVULE]A>>!TYPE6[mCBRANCHgFLDjPMCONVkPVCONV$RETURN oCAST %GOTObSTASG cSTARGdSTCALLfUSTCALLOUZ_eint{' too many errorscannot recover from earlier errors: goodbye! compiler error: warning: out of tree space; simplify expressionwasted space: %ofreeing blank tree!undeffargcharshortintlongfloatdoublestrtyuniontyenumtymoetyucharushortunsignedulong??PTR FTN ARY %sout of temporary string spaceout of memory (tstr)")07=CIPW^djpw~(5BO[gs jsr %s jsr fcmpi moveq #0,U1 moveq #0,U1 jsr fdoublei jsr fpflt jsr ffltt jsr fflti jsr fpflts jsr ffltts jsr ffltis jsr fpfix jsr ffixt jsr ffixi jsr fpfixs jsr ffixts jsr ffixis movl AR,AL movl AR,AL jsr fsinglei movl d0,AL clrl Z- movl AL,Z- clrl Z- movl AL,Z- jsr fdoublei movl d1,Z- movl d0,Z- HEY! cookie = floatcode got a tree it didn't expect jsr %s jsr %s jsr %s jsr %s movl AL,A1 andl #0xff,AL andl #0xffff,AL extw AL extl AL jsr fsinglei tstl AL tstb AL cmpl #0x80000000,AL jeq L%d tstl AL jne L%d L%d: tstl UL jeq L%d tstl AL L%d: jbsr fcmpis tstl %s beqs L%d eorl #0x80000000,%s L%d: tstl %s beqs L%d eorb #0x80,%s L%d: eorl #0x80000000, AL .globl fpused .globl ffpused .globl ieeeused @(#)float2.c 2.5 (SUN) 4/4/83 fpaddfaddtfaddifpaddsfaddtsfaddisfpsubfsubtfsubifpsubsfsubtsfsubisfpmulfmultfmulifpmulsfmultsfmulisfpdivfdivtfdivifpdivsfdivtsfdivis-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$p. 40X$,@4p<E0M4U^f<ow<@l4L&d&d&&.&N'.)<)<5Fp<55%5,518:;A;I;Q<WPACTA!?)Ch-=3>8@F?>FBLBSA[@aB$g@lAu>|=?^Aj?CD ?B <B@BA@@BCnA>V>* =CH@%@,C|5C=CECN$DV.Ed^Ee.EmEuFE<EF^E<FF3FFFF!GGTGdIJ<JJ<JL%<*JT9K"=JnH<LKHSLH[LXdLdl;rx~~r0 /D& m( TnT Xl&d['R'E-7 h?*Fh@NVh^_\f nfvFJd|tDXN  )6lT*4   sN&.hHBv | # +y02ذ;LCNK R^T\^f n iuR}^@+t@22 >xF (`،k %,4<sD LkVc^~f\nv}6 e$P G$K zV $rxt&3 r u$pp(0T7AV*HmQ Z $` $f %lu %@{D9` % %Q~G  x f8` :y L%+ s ^   N   %  ( 1 .% 8 A U'p H< P W  ]< j4 N t }  v 0  $  R l -  ;z !  V  2 . & , 01< 7  ?W b I$ U c't ]g@ g 'x o '| wr 5&B  '  h P ( $'   '  V'      3/  / #!F +Gd 3$C ; / C)< K' TF ZM:b bF i / q zn5 f5 C ? C C < A <: ?B @F : LN  O zI ;F  3F ; Ld j=j = ? y; #[@> ); 0< 6Y< ?s= H? NQ>` URC aBJ gZ>t nE u o |/Ed F LX KH E G4 GZ G 7I@ J J^ p J crt0.ofort.o_sccsidfreader.o_sccsidfallo.o_sccsidfmatch.o_sccsid_mamaskftable.o_sccsidforder.o_sccsidflocal2.o_sccsidfcomm2.offloat2.o_sccsid_mult_minu_divt_plusfprintf.ofprintf.oprintf.oprintf.ordwr.ofilbuf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_maxtreg_edebug_printf_lflag_eprint_tstr_eobl2_rbusy_cbgen_fstack_lread_lnread_baseoff_talloc_fwalk_lrd_maxtemp_allchk_fprintf_fwritelmodt_filename_tmpoff_tinit_caloff_lccopy_lcread_tcheck_maxoff_lineidldivt_fopen_p2init_tlabel_offsz_cerror_ftnno_reclaim_delay_mainp2_myreader_label_lineno_dope_fread__iob_xdebug_uerror_nerrors_nrecur_lopen_setregs_fsp_setbin_store_deltest_udebug_getlab_tfree_markcall_genscall_setstr_fregs_setrew_lastchance_allo0_rdebug_negrel_setincr_order_offstar_deltrees_odebug_ncopy_canon_stoarg_setasop_opst_rcount_rallo_delay1_delay2_stoasg_tdebug_node_oreg2_notoff_mkdope_fpflag_tprint_nextcook_tshape_deflab_cnames_mkadrs_walkf_gencall_constore_stocook_vdebug_tcopy_Wflag_deli_sdebug_radebug_match_stotree_prcook_sucomp_adrput_rnames_cbranch_codgen_szty_callflag_setasg_freereg_ushare_recl2_freetemp_getlr_rstatus_callreg_mina_minb_busy_rwprint_resc_shareit_rmove_maxa_maxb_allo_respref_rfree_usable_upput_conput_shltype__flsbuf_insput_hopcode_zzzcode_fldshf_rtyflg_adrcon_shtemp_table_rwtable_expand_special_opptr_flshape_fldsz_shumul_ttype_spsz_double_conv_floatcmp_ezsconv__fltused_niceuty_find_mustdo_genargs_floatmath_crslab_rewrite_rall_mkrall_floatop_hard_rew_maxargs_argsize_floatcode_cntbits_werror_revrel_acon_ioptab_incraddr_where_isconv_indexreg_eval_field_brnode_shiftreg_ftlab1_ftlab2_addroreg_floatnote_rewfld_brcase_tlen_optim2_lbranches_ccbranches_maxtoff_popargs_toff_usedregs_indope_itstrbuf_tstrbuf_curtstr_tfree1_tstrused_lastfree_strcpy_malloc_strlen__pfile__print__filbuf_read_fflush_fstat__sibuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_close__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_errno_creat_opencerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[nlD R**bx@ P $G"I#HyHzNDPHTHS/N /NXNuNV .rN-@# . VrN-@ #А#rN -@/aX-@ fHx HyHxN `/9aX#  f"Hx Hy0HxN B ` 9rdN# 2l #2` o # 9"HA HABAЁ/aX# f&Hx HypHxN B B`/9/9 N// .NNNNN.`.<//././.N..N^NuNVaN/.NXN^NuJ9f" .̰b"y JQf2 yRhp0(2d !|Bh`r0 й @ fR`XJhf@"y0)R@3@1ip0(d6 й @ !|Bh`0( й @`B9NuHxHyHxN Nu /l/yHxN@dN#BNuJ/ /"9Ё/A/aXJf /Nu@(#)gcrt0.s 1.3 (gcrt0.s) (SUN) 3/8/83@No space for monitor buffer(s) No space for monitor buffer(s) No space for monitor buffer(s) No space for monitor buffer(s) No space for monitor buffer(s) No space for monitor buffer(s) gmon.outmcount: gmon.outmcount: tos overflow @(#)gmon.c 4.12 (Berkeley) 3/8/83 gmcount.s 1.2 (SUN) 83/03/09@P @.P:@PP\@jPv@@P@ P@@@@ P@ @P@$@0@<@H@N@n@x@@ P@@@@@@@P@ P@@$ P.@6PN@b@r@@@ P@.PF@TPh@p@@@@PP P PPPP(P2P>@J@V@\@j@v@@@@@@@@&@0 P@@H@XP`@r@@0@X@` P hD~"r+28>HdSYYbin:s8|h<?.;Z_exit_monstartupstart_main_environ_etextffixifflti__cleanup__mcleanupfdivifdoublei_write_end_brk_monitor__exit_sbrkmcountieeeusedfmuli_creatuldivt_close_perrorcerror_profilffltisb[sliM$ bq qbxn/* if_ecreg.h 4.2 83/03/10 */ /* * 3Com Ethernet controller registers. */ struct ecdevice { u_short ec_csr; /* control and status */ u_short ec_back; /* backoff value */ u_char ec_pad1[0x400-2*2]; u_char ec_arom[6]; /* address ROM */ u_char ec_pad2[0x200-6]; u_char ec_aram[6]; /* address RAM */ u_char ec_pad3[0x200-6]; u_char ec_tbuf[2048]; /* transmit buffer */ u_char ec_abuf[2048]; /* receive buffer A */ u_char ec_bbuf[2048]; /* receive buffer B */ }; /* * Control and status bits */ #define EC_BBSW 0x8000 /* buffer B belongs to ether */ #define EC_ABSW 0x4000 /* buffer A belongs to ether */ #define EC_TBSW 0x2000 /* transmit buffer belongs to ether */ #define EC_JAM 0x1000 /* Ethernet jammed (collision) */ #define EC_AMSW 0x0800 /* address RAM belongs to ether */ #define EC_RBBA 0x0400 /* buffer B older than A */ #define EC_RESET 0x0100 /* reset controller */ #define EC_BINT 0x0080 /* buffer B interrupt enable */ #define EC_AINT 0x0040 /* buffer A interrupt enable */ #define EC_TINT 0x0020 /* transmitter interrupt enable */ #define EC_JINT 0x0010 /* jam interrupt enable */ #define EC_INTPA 0x00ff /* mask for interrupt and PA fields */ #define EC_PAMASK 0x000f /* PA field */ #define EC_PA 0x0007 /* receive mine+broadcast-errors */ /* * Receive status bits */ #define EC_FCSERR 0x8000 /* FCS error */ #define EC_BROADCAST 0x4000 /* packet was broadcast packet */ #define EC_RGERR 0x2000 /* range error */ #define EC_ADDRMATCH 0x1000 /* address match */ #define EC_FRERR 0x0800 /* framing error */ #define EC_DOFF 0x07ff /* first free byte */ #define ECRDOFF 2 /* packet offset in read buffer */ #define ECMAXTDOFF (2048-60) /* max packet offset (min size) */ b[vl] br sbx+/* %M% %I% %E% */ /* * Structure of a Ethernet header. */ struct en_header { u_char en_dhost; u_char en_shost; u_short en_type; }; #define ENPUP_PUPTYPE 0x0400 /* PUP protocol */ #define ENPUP_IPTYPE 0x0800 /* IP protocol */ /* * The ENPUP_NTRAILER packet types starting at ENPUP_TRAIL have * (type-ENPUP_TRAIL)*512 bytes of data followed * by a PUP type (as given above) and then the (variable-length) header. */ #define ENPUP_TRAIL 0x1000 /* Trailer PUP */ #define ENPUP_NTRAILER 16 b[xli$ bs tbxH/* enreg.h 4.1 82/10/21 */ /* * Sun 3Mb Ethernet registers. * * NOTE: There is lots of strangeness here having * to do with Multibus addressing. The Ethernet * board takes 256 bytes of Multibus address space * but only decodes a few of the low-order address * bits. To avoid conflicting with other Multibus * peripherals that only decode 8 address bits we * start using addresses at 0xa0 within our 256 byte * chunk. THIS IS A KLUDGE!!! */ struct endevice { char en_pad1[0xa0]; /* padding */ u_short en_data; /* receiver data port */ u_short en_xxx; /* unused */ u_short en_status; /* control and status */ u_short en_filter; /* receiver address filter */ char en_pad2[0x100-0xa0-4*sizeof(u_short)]; }; /* * Control and status bits. */ /* status register, read */ #define EN_INTR 0x1000 /* interrupt flag */ #define EN_RINTR 0x2000 /* receiver interrupt */ #define EN_TIMEOUT 0x4000 /* transmitter timeout */ #define EN_TINTR 0x8000 /* transmitter interrupt */ /* status register, write */ #define EN_NOT_ILVL 0x0700 /* interrupt level bits (inverted) */ #define EN_NOT_RIE 0x0800 /* receiver interrupt enable (0 = enabled) */ #define EN_NOT_TIE 0x1000 /* transmitter interrupt enable (0 = enabled) */ #define EN_NOT_FILTER 0x2000 /* filter data bit */ #define EN_LOOPBACK 0x4000 /* loopback */ #define EN_INIT 0x8000 /* initialize device */ /* data register, read */ #define EN_COUNT 0x0fff /* word count */ #define EN_CRC_ERROR 0x1000 /* CRC error */ #define EN_COLLISION 0x2000 /* collision/abort */ #define EN_OVERFLOW 0x4000 /* receiver queue overflow */ #define EN_QEMPTY 0x8000 /* receiver queue empty */ #define EN_ERROR (EN_CRC_ERROR|EN_COLLISION|EN_OVERFLOW) b[{ lق 0byX*5bxPX`  @ |$!.HN@ _.HNuNVHHyNPXa4!AaFBHyNUXJfHyFNPXa >Hy[NPXaHymNPXa0Hr# @1|pBBHxHxNP< y1|pRG Gm..N^NuNVH0BG0H @JPg0Hr# @1|p y1|p 9P(@BTBE8` 92H぀*@: D Dm 92H぀*@<0H8`z 92H぀*@<n gX0H/0H/Hy NP p0/p0. /Hy:NP 0H @Ra h Gf8<D DmRE Em*RG GmL0N^NuNVHBG0Hr<0H/aX0H/NOX0F@<0H/aX0H/NOXRG GmLN^NuNV0. H/HySNPP0. H @Ra N^NuNVH0BD0H @JPg80Hr#P*@BUBGz` y1|p yBhpBC 92H぀(@BTC Cm y1Ep y1|p 92H぀(@BT y1|p 9(@<BC`0<JFg 0H/aXRCGmBC`0<JFf 0H/aXRCEm0H2HЁ6`0<JFg 0H/aXRC CmRE EoRG GmRD DmL0N^NuNVH0BGp0 @JPgFp0r# @1|p 9*@ 9*@BT 9 @0 y1|p: <<n gFp0/Hy|NPPp0/p0. /HyNP p0 @Rap y1|<. <9`@ 9(@0Hй @0BE80H/ n NX>RE EmF Fm>. <9`" 9(@0Hй @0 y1|BE88GgBA .0H R m0H/0H/0H/HyNPp0/p0/HyNP ./ .R/HyNP ./ ./HyNP a0H @R CgHT0H/ n NX>RE EmF FmJg 9R oBRC CmLN^NuNV .N^NuNV .FN^NuNV .RN^NuNV .SN^NuNV .r".぀N^NuNV .r".⁀N^NuNV-|/.HztHxaj /.Hz`HxUUaV /.HzXHxUUaB /.Hz8Hya, /.Hz.Ba /.HzHya /.Hz0Hxa /.Hz:Hxa /.HzBa /.HzHxa /.HzHxa /.HzBa N^NuNVHxHx!afPHy HyNPPHyNPXHy HyNPPNT@HxHxaPHy HyNPPN^NuNV/. /.Hy HyNPN^NuNVHNTX`l Sr g>Jg Hx,NTX-| nHH, o/NTXR` n  oR`-T .R @HH,g/NTX` bg` lgn dg` ugn sg` xg`L0N^NuNV. fJlHx-NTX .D-@A*H .". NUDp @ .". NVB-@JfSHH/NTXAb*nN^NuNVH `$ #g @gH`~ B`NSd*nNT.  g g g f*nHx NTX`L N^NuNVHBNT -fz`.BE`2 9n2 "HA HABAЁHH0Ё.NT 0lJEg D. LN^NuNVHB`N fnn . Am FnHH7`& am fnHHW` HH0ހNT 0m 9o Am Fo al LN^NuNV y NN^NuNV y NN^NuNV/. y NXN^Nu o HBNu o /L.NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@L gV/HyNS P`ad~/HyNS Pa^aa R`a@~/HyNS Pa:aR`a~/HyNS PaaR`NV./9HyNS PNV.o# y #/9Hy NS PNV.g.o n/9//9NQ #/9/9Hy*NS ..N^NuNV./9HySNS PNV.g o n#HyzNS X`Hy|NS X`..N^NuNVH0p#Jg <` </HyNS P# *y d c <` 9//9HyNS BJg2 c <` 9//9NNPѹ`( c <` 9//9aP*| c\(|`, dHy /HTNQ d ` 9/c ` /HyNS #JgX d <` 9/d <` /NNPѹ`N d <` 9/d <` /aPeHyHyHyNQ L0N^NuNV g6/9HyHyNS # /9HyaHPN^NuNVHy NS XJg/9Hy+NS P`Hy>NS XN^NuNVBHyKNS XB/. /.NG ѹHyMNS XHx/. /.NG ѹHyONS XHy/. /.NG ѹHyQNS XHxUU/. /.NG ѹHySNS X/. /.NGPѹHyUNS X/. /.NHRPѹHyWNS XHy/. /.NP ѹHyYNS X/. /.NI PѹHy[NS XHy/. /.NK Hy/. /. . /NKѹHxUUHy/. /.NN"ѹHy]NS XHxUU/. /. . /NKѹHyHxUU/. /.NN"ѹ 9ѹJg/9Hy`NS PJg/9HywNS PN^NuNVH0*n >.B(n`8ǹe<<SFJFn(n`(<Gg RHT0H/0H/HyaTe .L0N^NuNVH0*n B(n`8Te<<SFJFn(n`(>Lg RHT0H/p0 /HyaBTe .L0N^NuNVH0*n B-y(n` .ЮD-@8Te<<SFJFn-y(n`D .ЮD-@>ng&RHT0H/0./HyaTe .# .L0N^NuNVH0*n B(n`8Te-|B@SJn(n`&>LgRHT0H/p0 /HyaTe .L0N^NuNV l /.p0./p0.//.a2`(/.p0./p0.//.HyNS N^NuNVHp0.r2.>|z0H2HgHyNS X(.Jgع rR/HyNS P oHyNS X lFSE0H2HЁ/0R lB`rЁ/Hy'NS `F Eo0Hr`0Hr/ EoB`p/ rR/Hy.NS  .й/p0./p0.//.Hy7NS 0H<0RE @mLN^NuNV 9`"HAAAHABAЁ#`` 9`". NWLЮN^NuNVH0*n >.(n`8ǹeL0N^NuNVH0..*n<.!MBhB`-y`-ydBHy,NWXJ`fB`LHU/. a0P(@R0FfHyBaP8Rp0r24JBg Bg8Rm#`#dBB`vHU/. aP(@R60F@@gHyBaP8p0r24RJBg BgֶDgHTp0/p0/HylNIz0F@8Rm#`#dBB`LHU/. a6P(@R0FgHyBaP8p0r24RJBg Bg8Rm .f .g/.HytNS P/.HyNS P/.HyNS P`Rh/HyNS Pp0/p0/HTHyNS R`Hy,NW"X 9hL0N^NuNVRhp0./p0.//.HyNS N^NuNVH0*n >.<.!NBhB`Hy,NWXJ`f^(ndV:GgHTp0/p0/HyKNIz8T`Rhp0/HTHySNS Hy,NW"X 9hL0N^NuNVH<*n(n .<,<UUB-x!OBHy,NWXJf($M`0404eR&M`.e!B`d!p`XJf&JHSHytNS PHyNS X*KJg 9dHyNS X`dp`p/HyNS PHyNS XBJgHyNS Xd:d R/Hy` V/HyNS PHyNS X`fe $@`$Md rЅ/Hy`. (@ rR/HyNS P P/HyNS PR o.B|(n`00F@>z8 Rle0F@>dz8 Rlee*<SJn(n`0F@>zp0r2(Jg*UHTp0"/p0/HyNIzTR Rle0F@>dHzp0r2(Jg*UHTp0"/p0/HyNIzTR Rlee\ , ‼m .L0N^NuNVH ` .r , . r * .*@` 0:RmL `N^NuNV..8!R#d333E3HylNWXJg `@@d dd* yd0W yd PWf`HxHylNW"P333E3! 9d..N^NuNV y NN^NuNV y NN^NuNV/. y NXN^NuNV.*nHn HUa P*nN^NuNVH0*n(n `Jg/NS XHH, %fHH,  og0nd cg2n< Ogn" DgX`~`~ `~//a^P`.zJm ,g /NS XQ`.-T .R @HH//aPBJgHxNS X`l Sr g>Jg Hx,NS X-| nHH, o/NS XR` n  oR`-T .R @HH,g/NS X` bg` lgn dg` ugn sg` xg`L0N^NuNV. fJlHx-NS X .D-@A*H .". NWL @ .". NXJ-@JfSHH/NS XAb*nN^NuNVH `$ #g @gH`~ B`NSd*nNR.  g g g f*nHx NS X`L N^NuNVHBNR -fz`.BE`2 9n2 "HA HABAЁHH0Ё.NR 0lJEg D. LN^NuNVHB`N fnn . Am FnHH7`& am fnHHW` HH0ހNR 0m 9o Am Fo al LN^Nu o HBNu o /L.NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@L 0 int bkopen(),bkclose(),bkread(),bkinput(),bkioctl(); #endif #include "tb.h" #if NTB > 0 int tbopen(),tbclose(),tbread(),tbinput(),tbioctl(); #endif struct linesw linesw[] = { ttyopen, nodev, ttread, ttwrite, nullioctl, ttyinput, nodev, nulldev, ttstart, nulldev, #if NBK > 0 bkopen, bkclose, bkread, ttwrite, bkioctl, bkinput, nodev, nulldev, ttstart, nulldev, #else nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, #endif ttyopen, ttyclose, ttread, ttwrite, nullioctl, ttyinput, nodev, nulldev, ttstart, nulldev, #if NTB > 0 tbopen, tbclose, tbread, nodev, tbioctl, tbinput, nodev, nulldev, ttstart, nulldev, /* 3 */ #else nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, #endif #if NTB > 0 tbopen, tbclose, tbread, nodev, tbioctl, tbinput, nodev, nulldev, ttstart, nulldev, /* 4 */ #else nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, nodev, #endif }; int nldisp = sizeof (linesw) / sizeof (linesw[0]); b[$li$ b~ bxK/* uipc_proto.c 4.27 82/11/02 */ #include "../h/param.h" #include "../h/socket.h" #include "../h/protosw.h" #include "../h/domain.h" #include "../h/mbuf.h" /* * Definitions of protocols supported in the UNIX domain. */ int uipc_usrreq(); int raw_init(),raw_usrreq(),raw_input(),raw_ctlinput(); struct protosw unixsw[] = { { SOCK_STREAM, PF_UNIX, 0, PR_CONNREQUIRED|PR_WANTRCVD, 0, 0, 0, 0, uipc_usrreq, 0, 0, 0, 0, }, { SOCK_DGRAM, PF_UNIX, 0, PR_ATOMIC|PR_ADDR, 0, 0, 0, 0, uipc_usrreq, 0, 0, 0, 0, }, { 0, 0, 0, 0, raw_input, 0, raw_ctlinput, 0, raw_usrreq, raw_init, 0, 0, 0, } }; struct domain unixdomain = { AF_UNIX, "unix", unixsw, &unixsw[sizeof(unixsw)/sizeof(unixsw[0])] }; b[%lH IbyQ+by# # Sun Host Database # 127.0 localhost loghost # # Sun Local Net 125 -- 3Com 10Mb/s Ethernet # 125.9999 noname # # Off Campus Hosts and Networks (from SRI-NIC hostname server) # 10.0.0.12 dti-vms 10.0.0.20 cctc 10.0.0.23 usc-eclb eclb 10.0.0.27 usc-isid isid 10.0.0.43 office-1 of1 10.0.0.46 collins-pr 10.0.0.49 bbnb bbn-tenexb 3.0.0.49 bbnb bbn-tenexb 10.0.0.5 bbnf bbn-tenexf 3.0.0.5 bbnf bbn-tenexf 192.1.2.66 bbnf bbn-tenexf 10.0.0.51 darcom-ka sri-tenex sri-ka 10.0.0.54 cit-20 cal-tech 10.0.0.6 mit-multics multics 10.0.0.63 bbn-rsm bbnr 10.0.0.73 sri-nic nic 10.0.0.78 ucb-arpa 10.0.0.83 bbn-tac 10.1.0.1 ucla-ccn ccn 10.1.0.22 usc-isi usc-isia isia isi 10.1.0.23 usc-eclc eclc 10.1.0.27 isi-png11 10.1.27.27 isi-png11 10.1.0.31 cca-vms 10.1.0.38 bragg-sta1 10.1.0.43 office-2 of2 office off 10.1.0.5 bbng bbn-tenexg 3.1.0.5 bbng bbn-tenexg 192.1.2.67 bbng bbn-tenexg 10.1.0.52 usc-isie isie 10.1.0.54 cit-vax cit-11 10.1.0.65 afsc-sd-tac sd-tip 10.1.0.67 afsc-hq-tac hqafsc-tac 10.1.0.69 usgs2-tac 10.1.0.70 usgs3-tac 10.1.0.82 bbn-vax bbnv 3.1.0.8 bbn-vax bbnv 10.1.0.96 udel-tcp 10.1.4.51 srijoyce joyce 39.0.0.16 srijoyce joyce 10.2.0.11 su-tac 10.2.0.13 gunter-tac gunt 10.2.0.14 cmu-gateway 10.2.129.14 cmu-vlsi 10.2.0.17 mitre-tac 10.2.0.19 nbs-tac 10.2.0.22 usc-isic isic 10.2.0.23 usc-tac 10.2.0.27 isi-vaxa 10.1.33.27 isi-vaxa 10.2.0.29 brl-tac 10.2.0.31 cca-tac 10.2.0.37 csnet-purdue purdue-rvax rvax 128.10.0.2 csnet-purdue purdue-rvax rvax 10.2.0.38 bragg-tac 10.2.0.4 utah-tac 10.2.0.40 ncc-tac 10.3.0.40 bbn-gateway 10.2.0.42 london-tac 10.2.0.43 office-3 of3 almsa 10.2.0.50 darcom-tac 10.2.0.52 usc-isif isif 10.2.0.61 stla-tac stl-tip 10.2.0.64 wralc-tac 10.2.0.65 aerospace 10.2.0.66 afgl-tac 10.2.0.71 bbn-clxx clxx 10.2.0.75 yuma-tac 10.2.0.78 ucb-monet ucb-ingres ucb-vax ucb-ingvax 10.2.0.80 sac-tac 10.2.0.81 david-tac 10.2.0.84 nswc-tac 10.2.0.85 nwc-tac 10.2.0.91 washington-tac 10.2.0.96 udel-ee 10.3.0.20 edn-unix 10.3.0.23 usc-ecl ecl usc-ecla ecla 10.3.0.28 arpa-png11 arpa-xgp11 10.3.0.31 mit-devmultics devmultics cisl 10.3.0.4 utah-20 10.3.0.43 office-7 of7 cecom 10.3.0.49 bbnc bbn bbn-tenex 3.3.0.49 bbnc bbn bbn-tenex 10.3.0.5 bbna bbn-tenexa 3.3.0.5 bbna bbn-tenexa 192.1.2.68 bbna bbn-tenexa 10.3.2.51 sri-prmh 10.3.0.52 usc-isib isib 10.3.0.91 uw-vlsi udub-vlsi 10.44.3.10 ll-iptcp 11.3.1.42 ucl-ucl1 11.3.2.42 ucl-ucl2 11.3.3.42 ucl-ucl3 11.3.4.42 ucl-ucl4 11.3.5.42 ucl-ucl5 11.3.6.42 ucl-ucl6 11.3.7.42 ucl-ucl7 128.10.0.1 purdue-tcp purdue-pvax pvax 10.3.0.17 dcn1 linkabit 128.4.0.1 dcn1 linkabit 128.4.0.2 dcn2 dcn-vax 128.4.0.3 dcn3 dcn-11a 128.4.0.4 dcn4 dcn-11b 128.4.0.5 dcn5 dcn-11c 128.4.0.6 dcn6 backroom 128.4.0.7 dcn7 128.4.0.8 dcn8 128.4.0.9 dcn9 128.5.0.1 ford1 ford 128.5.0.2 ford2 128.5.0.3 ford3 128.5.0.4 ford4 128.5.0.5 ford5 128.5.0.6 ford6 128.5.0.7 ford7 facc 128.5.0.8 ford8 128.5.0.9 ford9 128.5.32.1 ford-aerospace 128.7.0.1 dfvlr1 dfvlr oberpfaffenhofen 128.7.0.2 dfvlr2 128.7.0.3 dfvlr3 128.7.0.7 dfvlr7 aroe stuttgart 128.8.0.1 umd1 umd 128.8.0.2 umd2 128.8.0.3 umd3 128.8.0.4 umd4 128.8.0.5 umd5 128.8.0.6 umd6 128.8.0.7 umd7 14.0.0.0 purdue-tn 14.0.0.1 uwisc-tn 14.0.0.2 udel-tn 21.0.0.2 edn-host3 3.1.0.50 alta-coma 3.3.0.7 bbn-div6-tac bbnt 4.0.0.0 satnet 4.0.0.1 etam-expak 4.0.0.2 goonhilly-expak 4.0.0.3 tanum-expak 4.0.0.37 satnet-sink 4.0.0.40 satnet-echo 4.0.0.41 etam-monitor 4.0.0.42 goonhilly-monitor 4.0.0.43 tanum-monitor 4.0.0.62 etam-echo 4.0.0.63 goonhilly-echo 4.0.0.64 tanum-echo 4.0.0.72 raisting 4.0.0.77 raisting-echo 4.0.0.78 raisting-monitor 4.0.0.79 raisting-expak 4.0.0.88 fucino 4.0.0.93 fucino-echo 4.0.0.94 fucino-monitor 4.0.0.95 fucino-expak 48.3.1.41 ndre1 ndre 8.0.0.4 clarksburg-expak 8.0.0.44 clarksburg-monitor 8.0.0.65 clarksburg-echo b[&lK'| bybyby/usr/lib/sendmailb['l> {byS*by# services 1.1 83/05/18 # # Network services, Internet style # echo 7/udp discard 9/udp sink null systat 11/tcp daytime 13/tcp netstat 15/tcp ftp 21/tcp telnet 23/tcp smtp 25/tcp mail time 37/tcp timserver name 42/tcp nameserver whois 43/tcp mtp 57/tcp # deprecated # # Host specific functions # tftp 69/udp rje 77/tcp finger 79/tcp link 87/tcp ttylink supdup 95/tcp # # UNIX specific services # exec 512/tcp login 513/tcp shell 514/tcp cmd # no passwords used efs 520/tcp # for LucasFilm biff 512/udp comsat who 513/udp whod syslog 514/udp talk 517/udp route 520/udp router routed # 521 also b[(l# byR*by # # Internet networks (reordered for local efficiency) # sun-ether 125 sunether sun3com ethernet localnet sun-en 126 sunen ucb-ether 46 ucbether arpanet 10 arpa purdue-localnet 128.10.0 purdue-net ub-net 99 ungermann-bass-network 3com-net 98 3com-network interlan-net 97 interlan-network cad-net 96 cad-network ucb-ether2 192.46.0 ucbether2 ether2 cc-net 89 cc-network comp-center-net loopback-net 127 software-loopback-net dcn-comsat 29 bbn-net 3 bbnnet bbn-rcc bbn-pr 1 sf-pr-1 2 sf-bay-area-pr-1 satnet 4 atlantic-satellite atlantic-satelite sill-pr 5 washington-dc-pr sf-pr-2 6 sf-bay-area-pr-2 chaos 7 clarknet 8 bbn-satnet bragg-pr 9 fort-bragg-pr uclnet 11 uc-london cyclades 12 nplnet 13 national-physical-lab telenet 14 epss 15 datapac 16 transpac 17 lcsnet 18 lcs tymnet 19 dc-pr 20 fort-sill-pr edn 21 dcec-edn edn-dcec dialnet 22 dial mitre 23 bbn-local 24 fibrenet rsre-ppsn 25 autodin-ii 26 nosc-lccn 27 wideband 28 dcn-ucl 30 bbn-sat-test 31 ucl-cr1 32 ucl-cr2 33 accat 34 akkat rsre-null 35 su-net 36 decnet 37 decnet-test 38 srinet 39 cislnet 40 bbn-ln-test 41 matnet 42 s1net null 43 intelpost amprnet 44 decnet 45 sac-pr 47 ndre-ring 48 b[)lސ :byT*by"# protocols 1.1 83/05/18 # # Internet (IP) protocols # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol ggp 2 GGP # gateway-gateway protocol tcp 6 TCP # transmission control protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol b[*l )*@*@by#/dev/ip0a:/:rw:1:1 /dev/ip0g:/usr:rw:1:2 b[+l )*2*2by$/dev/dd0a:/:rw:1:1 /dev/dd0g:/usr:rw:1:2 b[,lٷ ++by (08@HPX`hpx,0 (Gp$G"I#HTHS/N /NXNuNuNV/9&\/.HyHy$NpN^NuNVH0*nHUNXR/NX(@HUHTNP L0N^NuNVH0*nHx0NX(@ < A/ Q*_J0f#&H` y0!L,#0L0N^NuNV.HxNX*@/.aTX*/. aHX+@ J(f#&d` y(!M#(*nN^NuNVH0*n.. f HUaX`~(y&H`Jf@/,HUNJyoNSy`D0H @< FfRJlNl#lB$|4`X Rf0*GfXJRm 0Hf<*lB`JFf"09H b@0;NHZZ0H @0H〙*K0H @0H倗A#&<=F0HF @<0H @0H2HЁR=@ nl*0.H@ @>0H* @0D@2@g0H @0H@ @>0.HY 4b@0;N(@ 4\dnz:Rl|N\$.8BjHyahXR3`n0Hb @0H<JFm< Fl60H@ @0H* @ Pf0H@ @>`0Hb @<UYAԹd`Jg#`Hy)`Hy6/9)DNHy(N /a.X//-a2P#)@`/Hy) gDHyNXHxNXNNHyNX`NNh`N`N^NuNVH0*nSm -R @` HUNX. g g g fp`r fB`f(|n\Sm -R @` HUNX. g #Q @gB gHU/NP <n\L0N^NuNV./.NX-@/9&@NXЮZ/NX*@HyHUNP/9&@HUNPHyHUNP/.HUNP *nN^NuNV`l .R bB@0;NP*:*TPP "*`(N Jg`$Hy-|a X-@ f0#-|&PJ)lgHy-|Hy NP <`J)lgHy-|Hy $NP .`Hy-|NX-{ @B#-}&P`Hy-|aX#&PJ)lg/9&PHy *NP < `^Hy-|aX#&PJ)lg/9&PHy 1`Hy-|NX#&PJ)lg/9&PHy 8`/9/9Hy-|NX// 9"9NNJN#&P <!` <`#&PJ)lg+H    fS nHH#) )g` . r @HHЮ&@ jbRH  f@+H    fS nHH#) )g`*mg &UfS nHH#) )g``d nHH# #.H -|R#)x-| @B y) X)`: nHH#) )fS  y )R  LY)bJ9-|gp , cS  y HH`: y S m y (R!@S @`/9NX#) fR  9) fB` 9)-|9-|HH# JoX y S m$ y (R!@S @ HH`&/9/9 NP`L8N^NuNVJg nJg X @  fp`BN^NuNV , cS  y HH`: y S m y (R!@S @`/9NX#) fR  9) fB` 9)N^NuNV y S m y (R!@S @ HH`/9/.NPN^NuNV#) )fS  y )R N^NuNVH8HyHyNX/N@P-@Jf$HyNX/N0XHxNXHy$/.NpPHyA/.NpPHyZ/.NpPHyq/.NpPHy/.NpPHy/.NpPHy/.NpPHy/.NpPHy/.NpPHy/.NpPJ)$g@*y&H`F(mg6g.Hy/,NNX/-/-Hyb`,-/-(/-$/-HUaX///aX/Hy/,N/.NpP~*y)t` gJg/a X-@/aPX&@HSNX," ҀS(AoJgp `p܀ Ї Ho~HyG/.NpPJg HSHyK`HSHyV/.Np ކ*mfX g: n S m n (R!@S @ HH`/.Hx NPL8N^NuNVH8HyZ/.NpP~*y)t` gJf/aX-@/a4X&@HSNX," ҀS(AoJgp `p܀ Ї Ho~Hy`/.NpPJg HSHyd`HSHyo/.Np ކ*mfX g: n S m n (R!@S @ HH`/.Hx NPL8N^NuNVH0Hys/.NpP~*y)t`x gj/NXSЕ @ cfT/aXJfH/NXV,Ї Ho~Hy{/.NpP/Hy/.Np Rހ*mf(y&d`j/NX-@/9&lNX Ю, Ї Ho~Hy/.NpPކ//9&lHy/.Np(lf n S m n (R!@S @ HH`/.Hx NPL0N^NuNV.Hx//.NP*@A *nN^NuNVH<$y)tgn gJf/NX(RЌS*@HTaRXJfBHH/HTHTa|X/Hy/.NpHTa^X&@ sfHTHSHy/.Np`< * g8 g" gHTHyNP` gx$j`* 9&` fHTHy/.Np /9&lHSHy/.NpHSHy/.Np HSHy,/.Np `HTHy9` 9&` g gX`fHTHy\/.Np /9&lHSHy~/.NpHSHy/.Np HSHy`zHTHy`nJ),gJ.LfHyHy$NpP#.L 9&` g gZ`HT/9.LHy/.NpHSHy-/.Np HSHSHyF/.NpHSHyq`HTHy~`L g/, Hy1HUNp /, Hy/, HyMHUNp HywHUNpP/HyHUNp HyHUNpP/, /9&lHyHUNp`d/, HyHUNp Hy HUNpP/Hy ;HUNp `&(y&dg//9&l/Hy EHUNp 9&` g gt(l`Hy _HUNpP//9&lHy yHUNp/9&l/Hy HUNp/Hy HUNp /Hy HUNp `Hy HUNpP//9&lHy HUNp``Hy!HUNpP(y&d`/, Hy! HUNp (lfHy!HUNpPL0N^NuNVH0*n(M`(HH#Q @gHH RJf L0N^NuNVHy!Hn8NP/.Hn8NPHnHn8NPJgp`BN^NuNVH8Hy!Hy!NX/N@P*@f$Hy!NX/N0XHxNX(y&H`&lggxHy!(/+NgSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg ! @` ! @R mHH. ]g*Jg ! @` ! @RJfS L N^NuNVH *nBB-y"-y"-y"-y"-|-|HH. g -f -|`f +g^S`Z/9"|/9"x .".Nl< 0N///./. 9""9"NNJ-@-A`RHH. #Q @f .gZ`t/9"|/9"x .".Nl< 0N///./. 9""9"NNJ-@-ASHH. #Q @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH. #Q @fJl D*܅-FJl D,B g( " @/(/ .".N-@-AJg R mJl/./. .".N `/./. .".N-@-A/.//N -@-AJl ` .".L N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NzPJmJn -|`-n$f +|.\`D/.NX+@f,mJf,0-g-HHo(+@`m+n $f09$gHy$NfX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|$`&4eB` 0,f -+fp`B, wf0Hx/.NόP.JgJm/NXHx` afvJgp`p//.NP.lB .Pf6Hx/.NόP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|" 9.P"l  @*PJgTnԌԫ&@bՀհ 1Rkօֹ֡$FYfz׎סװError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNHxN@eNuNVA-HA#.T=|B-n-|Hn/. N@PSm .R @BHH`HnBNP .N^NuNV(.-nBo<`b y.T S m. .R @HH y.T"(R!AS AHH` /9.T .R @HH/NPRo< nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH#Q @gT nHH0-@ -@-A (|o/9$`/9$\ .".Ng(|o`rHn/9$h/9$d .".N //N> -@-A/9$x/9$t/9$p/9$l .".NJNN0SR/9$/9$| .".Nfrodf`/9$/9$ .". NoF/9$/9$/9$/9$ .". N-@-ANl-n-n S` .o@(@Jf n o@d B9o@`b\odT/9$/9$ .". N-@-A Hn//N> -@-A .".N0`oeB9o`>*LZ`0SR`*0o@b1 nRJfo@c0R 9nB <o@L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NzPJmJn -|`-n$f9$HH/NXJgm+|N\+|N\+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|$` HUaX&4e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NXPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N~ N^NuNV/. Hy@t/.N~ N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0Jof8 <o#o <o#o#oo#oo .^rN.*yoBo g`(*(U g " Ҁe " Ҁd(M *@bofogB`Ro oo "<N#oBNX(@ 9o" Ҁe 9o/NX(@g yo 9oXg yo  9o" ҀY(#o <o A ` " Ҁ#ooc A#o A 9o*A L0N^NuNVH0*n(MY#o (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ o L0N^NuNHxN@e#&8BNu /й&8/@HxN@e 9&8#&8NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL)*LM ^ ]\ 12D12[@YXRIE,(!:&/98AOTU3N<3W;V%P?$0SB.-# "'K7456CFGHJQQZ+*('       & =TA>ONKJIH@FE?GDCB      !  !              )))))++++   6/ !666& "*(#$%'475.,-80123config: %s at line %d %s connected to non-controller%s %d not definedno %s's to wildcardOHNO!!!ubambaonly uba's and mba's should be connected to the nexuscan't give specific nexus numbersmbonly mb's should be connected to the nexustimezone is unreasonableyacc stack overflowsyntax errorvaxvaxsunsunUnknown machine typeHZ specification obsolete; delete%dubambambaubambauba%s must be connected to a nexuscan't specify slave--not to master-pusage: config [ -p ] sysname rSpecify machine type, e.g. ``machine vax'' Don't forget to run "make depend" ..//$$ h p t z                         @N?                                     (4@ rL Xdp|  > V b   8 f  "    "-0111111188AAAAAAGGGGGGGGGGGGGGGGGGGGGAAAAAAGGGGGGGGGGGGGGGGGGGG, id(%s) (%s) #O:%o #X:%x #D:%d ? ... bad switch yylook %d%o%xmachinecpuidentconfigoptionsdevicecontrollerubambacsrnexusdrivevectorpseudo-deviceflagstracedisktapeslaveathztimezonedstmaxusersmasterpriorityioconf.cwioconf.c#include "../machine/pte.h" #include "../h/param.h" #include "../h/buf.h" #include "../h/map.h" #include "../h/vm.h" #include "../vaxmba/mbavar.h" #include "../vaxuba/ubavar.h" #define C (caddr_t) mbaextern struct mba_driver %sdriver; struct mba_device mbdinit[] = { /* Device, Unit, Mba, Drive, Dk */ mbacan't specify csr address on mba for %s%d can't specify vector for %s%d on mba drive not specified for %s%d can't specify slave number for %s%d { &%sdriver, %d, %s, %s, %d }, 0 }; struct mba_slave mbsinit [] = { /* Driver, Ctlr, Unit, Slave */ mba { &%sdriver, %s, %2d, %s }, 0 }; ubaextern struct uba_driver %sdriver; extern , X%s%d(); int (*%sint%d[])() = { , X%s%d, 0 } ; struct uba_ctlr ubminit[] = { /* driver, ctlr, ubanum, alive, intr, addr */ ubamust specify vector for %s%d must specify csr address for %s%d drives need their own entries; dont specify drive or slave for %s%d controllers (e.g. %s%d) don't have flags, only devices do { &%sdriver, %d, %s, 0, %sint%d, C 0%o }, 0 }; struct uba_device ubdinit[] = { /* driver, unit, ctlr, ubanum, slave, intr, addr, dk, flags*/ mbambaubamust specify vector for device %s%d must specify csr for device %s%d drives/slaves can be specified only for controllers, not for device %s%d %s%d isn't connected to anything , so %s%d is unattached must specify ``drive number'' for %s%d slave numbers should be given only for massbus tapes, not for %s%d interrupt vectors should not be given for drive %s%d csr addresses should be given only on controllers, not on %s%d { &%sdriver, %2d, %s, %s, %2d, %s, C 0%-6o, %d, 0x%x }, ubauba -1 0 }; ioconf.cwioconf.c#include "../h/param.h" #include "../h/buf.h" #include "../h/map.h" #include "../h/vm.h" #include "../sundev/mbvar.h" #define C (caddr_t) mbextern struct mb_driver %sdriver; struct mb_ctlr mbcinit[] = { /* driver, ctlr, alive, addr, intpri */ mbmust specify priority for %s%d must specify csr address for %s%d drives need their own entries; dont specify drive or slave for %s%d controllers (e.g. %s%d) don't have flags, only devices do { &%sdriver, %d, 0, C 0x%x, %d }, 0 }; struct mb_device mbdinit[] = { /* driver, unit, ctlr, slave, addr, pri, dk, flags*/ mbambmust specify vector for device %s%d must specify csr for device %s%d drives/slaves can be specified only for controllers, not for device %s%d %s%d isn't connected to anything, so %s%d is unattached must specify ``drive number'' for %s%d slave numbers should be given only for massbus tapes, not for %s%d interrupt priority should not be given for drive %s%d csr addresses should be given onlyon controllers, not on %s%d { &%sdriver, %2d, %s, %2d, C 0x%x, %d, %d, 0x%x }, mbmb -1 0 }; 0%sint%d'?' -1%3d../conf/makefile.rmakefilewmakefilemaxusers not specified; 8 assumed minimum of 2 maxusers assumed maxusers truncated to 32 IDENT=-D%s -DGPROF -DMAXUSERS=%dcpu type must be specified -D%s -D%s="%s" -D%s timezone not specified; gmt assumed PARAM=-DTIMEZONE=%d -DDST=%d GPROF.EX=/usr/src/lib/libc/csu/gmon.ex config: out of memory %s -pg COPTS=%s%CFILES %OBJS %RULES %LOAD Unknown %% construct in generic makefile: %sfilesrfiles.%s%s: No type for %s. %s: Duplicate file %s. standardoptional%s: %s must be optional or standard device-driverprofiling-routine%s: what is %s optional on? specialspecial%s: syntax error describing %s profiling-routinedevice-driverprofiling-routineSPECIAL=\ ../OBJ/%s %s OBJS=\ ../OBJ/%s %s CFILES=\ ../%s \ ../%s/swap%s.c %so: ../%s%c ${AS} -o %so ../%ss Don't know rules for %s ${CC} -I. -c -S ${COPTS} ../%sc ${C2} %ss | sed -f ../%s/asm.sed | ${AS} -o %so rm -f %ss ${CC} -I. -c -O ${COPTS} ../%sc ${CC} -I. -c -S ${COPTS} ../%sc ${C2} -i %ss | sed -f ../%s/asm.sed | ${AS} -o %so rm -f %ss ${CC} -I. -c -O ${COPTS} ../%sc config: COPTS undefined in generic makefile ${CC} -I. -c -S %s ../%sc ex - %ss < ${GPROF.EX} sed -f ../vax/asm.sed %ss | ${AS} -o %so rm -f %ss ${CC} -I. -c -O ${COPTS} ../%sc %s: makefile ${SPECIAL} ${OBJS} param.o ioconf.o swap%s.o @echo loading %s @rm -f %s @sh ../conf/newvers.sh @${CC} $(CFLAGS) -c vers.c @size %s @chmod 755 %s @${LD} -n -o %s -e start -x -T 80000000 ${SPECIAL} ${OBJS} vers.o ioconf.o param.o swap%s.o @echo rearranging symbols @-symorder ../%s/symbols.sort %s @${LD} -o %s -e start -x -T 4000 ${SPECIAL} ${OBJS} vers.o ioconf.o param.o swap%s.o swap%s.o: ../%s/swap%s.c ${CC} -I. -c -S ${COPTS} ../%s/swap%s.c ${C2} swap%s.s | sed -f ../%s/asm.sed | ${AS} -o swap%s.o rm -f swap%s.s ${CC} -I. -c -O ${COPTS} ../%s/swap%s.c all: %s ../ubglue.swubglue.smba%s%d .globl _X%s .align 2 _X%s: pushr $0x3f dzx movl $%d,r0 jmp _dzdma pushl $%d calls $1,_%s popr $0x3f rei rw#define %s %d w#define %s %d .h@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$&4o. 4l#.;nAhLX a0g0m<wppv.:""xˠql.@.όϬ ".4:0C$LT^hF@q@zJo<.v ?8"&.5x<CINU \aiqyTXlJ(bnH $?-4<CIQX^e"jrpwZ.Lf<"<$< t(139@GNW`!8gxoxAx8<<~r0! d&<(Ͼ.@;F &@NtDW^ &Df f&Hl &Lq "&PyBpPly00 &T &Xp4FF &\ k&` &d X&h &l$ D&t) @(0<8 (@4H )$R a)(\bd U),o x! )0%*$ )4.$ 8)8 )<[ @ )l )p\ v)tO D#P (286<AAIhQqZc0kn snyr!x )xx 1)|',Z 6)PV )f@ )> ,,'09?? nG So [,b kY s :-t{ T-|JN r| jO  .D e.Ht@ˠ .LvH o   y$ 'j - 9+l @J K Q Y# cv m xM R   .P .ό  ; .T @ x< :  b s   !   x  " (Lf 0z 7 .\ ?&4 IϬ P ] d" n uo {b[,lٷ ++by (08@HPX`hpx,g   F  >   N\ 3  in   [B  Y  Qd R N Zx   X $~ +8 17 : @ G o L~ Qcrt0.oy.tab.omain.olex.yy.omkioconf.omkmakefile.o_fcurmkubglue.omkheaders.oyywrap.oabs.oabs.ofreopen.ofprintf.ofprintf.oindex.oprintf.oprintf.oscanf.odoscan.oatof.oatof.o_exp5_twoe56strncmp.oatoi.ofgets.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.olseek.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.orindex.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_check_tz_yyvallmult_check_nexus_yyerrflag_PREFIX_connect_yydef_val_id_dtab_dst_yylval_newdev_fprintf_yylex_yynerrs_free_curp_abs_opt_timezone_yyerror_mkconf_sprintf_init_dev_yyr1_yyr2_yychar_yyline_machine_conf_list_temp_id_machinename_yyv_confp_strcmp_errbuf_yyexca_seen_mba_maxusers_yypact_profiling_yyparse_strcpy_malloc_cputype_yychk_huhcon_strlen_seen_uba__iob_ident_cur_yypgo_yyact_do_trace_hadtz_ns_ftab_printf_makefile_sun_ioconf_vax_ioconf__ctype__strcat_get_word_path_freopen_ungetc_ubglue_headers__filbuf_perror_yysptr_atof_atoi_yyback_yylookffixi_yyleng_yyout_yyestate_key_words_yyvstop_kw_lookup_sscanf_yyfnd_hex_yyunput_yytchar__flsbuf_yyoutput_yylstate_yyin_yyinput_yysbufieeeused_yycrankfmuli_yybgin_yyprevious_yywrap_octal_yyextra_yysvec_yyolsp_yytextfaddi_yymatch_yytop_yylineno_yymorfg_yylsp_qu_intv_fopen_fclose_strncmp_read_files_COPTS_index_new_fent_do_load_do_cfiles_do_objs_raise_nosource_tail_do_special_fgets_fl_lookup_stat_rindex_do_rules_dump_vec_do_header_tomacro_do_count_toheader_lseek_errno_creat_open_close__pfile__print_fscanf__doscan_scanf__getcclfsinglei__instr__innum__sctabffltifdivi_ldexpfcmpi_read_fflush_fstat__sibuf__lastbufulmult_sys_errlist_write_sys_nerrcerror_fcvt_ecvtlmodt_isnanldivt_isinf_modf__cleanup__sobuf_isatty__exitd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[-lٹ **by"<DLT\dlt|, $G"I#HTHS/N /NXNuNuNVJf <D`HnNHX-@ @B( .N^NuNVH J o4X S n /N0X#D"HAxxHABAЁ#D nJgHHR bf oX S n /N0X#d`Rh` nH`R`RT` 2g` 5gn 4g` 6g` Jgn 9gnr 8g`f Wg`X ngn( dgn cg\`4 fgz`& ugVn sg` wg.` <#`JDfJhg <S` <6 #D#$Hx:/9$NP#JfHyN:XHxNX yBR/9$N\XJf HxNXHz0HxN(P fHxHxN(PHz"HxN(P fHxHxN(PHzHxN(P fHxHxN(PHzHx N(P fHxHx N(PHzHx N(P fHxHx N(PHzHxN(P fHxHxN(PHyHxN(P fHxHxN(PN N/9NX*@gHUaX#N`p /Hy HyNǔR й4 @`8mL0N^NuNVHx n / n/NP -@Jf n P ( n P` .N^NuNV . n . N^NuNV . m . N^NuNV#THz(Hx NPa@JHyHyNP#lJf HyHyNǔPHxNXBHyHyHy yl/(HyTN$# йt @Jg,Jg йt @ l, йt @-PRdmJgBa,Hx r "9\ AА//.ND йt @B`lBlRdp# 9h"9`N ѹ^ 9dѹX 9Do6BaBXa 9\R/HysN:PHyNTXaJaNLN^NuNVJgNJlfB`a4R .dmN^NuNV`HyNDX fa"HyNDX fN^NuNVHyN:XNx` Hx NXBB/9N< JmNxN^NuNVNxN -@HyHxN(PN-@Jl/.HyN:PHxNXJgHxHxN(P`/././.HyN:HnNX-@f .g .//.Hy.N: . g g" g`*HxNXHxNXNxHxNX/.HyNN:PHxNX`HymNDXJfapHx/9N(@JgHU/N 4PJfN L0N^NuNVJfHyHyNP#`/9NXN^NuNVJg/9NXBN^NuNVH *n.. ` HHgRJfJgB L N^NuNVH0Jf"HyHyNP#fB`/9HxHyN *@Jg#"Hx:HUalP*@#"Hx:HUaXP*@/NވX#"#"$" Hx:HUa0P*@Hx HUa"P(|"$`#d(Hx,HUaP*@JfB <"L0N^NuNV-|-| n/NٔX-@Jf" n/HyHyNǔ p` n"n"HnaX-@Jm n (=@/( Hn/(N =nBHxHn/.NzJlP 08f/.N XS` =8f@ n6/.N X/.NX ."HAHABAЁ-@`@ n/N$`HxHy/.N B/.NdXR//./.N /.NdXR//./.N /.NdXR//./.N HxHn/.N gL n/N$XJg n/N X/.N X`LSJg"HnaVX-@JmHx/NNJP/.HyHnN@ HnNdXR-@HnNdXR/Hn/.N gHyN$X/.`V-|BHnHn/.Nj-@/.N XJlHyN$XB` n =n nf neJHyHyNǔP`J.gBHxHn/.N fHxHnHxN . f`~ .N^NuNV=|BBBHxHxN-@Jmz n =@BHxHn/.NRJm .`P 08g 18gHyBN$X`& nS n fHyIHyNǔPpN^NuNV-|J gB`HytHycNP-@Jg/.Hx HnN JgHx HnNPJgHx HnNP @BHx HnNP-@Jg @BRHn/.N 4PJfJg .` .//.N 4PJff/.NXB`,/.NX fBHy~Hyv`pN^NuNV/. /.HxgN N^NuNHxcN@eNuNHxbN@eNuNHxjN@eNuNVA-H#xHn/. NP n0( gp`BN^NuNVH *n.f `JfBL N^NuNVA -H#xHn/.NP09 gp`BN^NuNVH0*n(nBJ f<`D-n Sm ,R @` HTNxX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NPSf0, fR .e .L0N^NuNV#### . ".NЮ//.aPN^NuNVH0.9# . -@찇cH" .N " N-@ .Ю-@-@*n . (@`./.HUa P`/.HU y#NP-@gJljǻe``HT߮/.aP`NHT߮/.HUa ߮*n`0HT/. y#NP-@gJogHTHUaP`ǹbʻfL .". m/. .Ї/aP-n `/./.aP .Ї-@`HU/.HTaH (n`$L0N^NuNVH0-y#*n(n SfL0N^NuNVH8-y#*n(n &nHH-@SfL8N^NuNVHn /.HyN N^NuNVHn/. /.N N^NuNV.*n=|A-M-MB`RJf-nHn/. HnN *nN^NuNVH0*n (nBBHH.Jg& gz gp gf %g, n S m n (R!@S @`HH. %gB *g LX-H`HH.B-|`* ."HA HABAЁЇ0-@HH. Q @fJf-|u0 lf-|`BHH.` hg [f HUaX*@ Q @g  .-|Jfp`Hn/./././/.aJg JgRJg|Jg` n S m n (R!@S @` /.NxX-@ g g g g/./N pP`/.NxX-@g g*/./N pP .L0N^NuNVH c g s g [ f././././. Jg n `B/a`BBB e g f f-|| o f|` x f|A*HBB n S m n (R!@S @` /.NxX. g g g -fFR n S m n (R!@S @` /.NxX.S` +fS n S l/.NxX` am fo Am FnR f .` f .Ю` .-@-G Q @g0` am fnW`7߮.. n S mB n (R!@S @.Sm Q @f< g .f fJgR` eg Ef~Jfx fpJgjJgdR n S m n (R!@S @` /.NxX. +g -g 0m 9oJg .D-@ g/./N pP nB` n JgAgJgAfB`B .退 bJ@0;N^jj@@@@@@@@@@@@@&&DHnNXNz n P p`2HnNX n P !A` n P0` n P `L N^NuNVH8*n(n nB&M c f u0f-|B s f-|Sm ,R @` HTNxX. @HHg f-| c fB`` [ fV-|`L  @HHf>gSo,Sm ,R @` HTNxX. f gJo HT/N pP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y`-yd-yh-yl-|-|HH. g -f -|`f +g^S`Z/9,/9( .".NLl< 0NL///./. 9p"9tNN-@-A`RHH. Q @f .gZ`t/9,/9( .".NLl< 0NL///./. 9x"9|NN-@-ASHH. Q @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH. Q @fJl D*܅-FJl D,B g( 0 @/(/ .".N-@-AJg R mJl/./. .".N`/./. .".N-@-A/.//Nd -@-AJl ` .".L N^NuNV.*nJg0-g /-N zXms+n f mB `+m+| B*nN^NuNVBJg>HxNX-@Hy#NXJg8/.HxN(P/.NXN^NuNVHxHy#N P`PJg" .c .`-n-|HzHxN(P-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHx$N@eNu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNHxhN@eNu"o /B/gS @`"Q g2gNuNVH8*nBNXNd(@Jg,HU/N 4PJg&l`XJgHU/N 4PJfN8 L8N^NuNVJfHyHyNP#`/9NX .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`<(n `,f" `./9HxHy#N -@g @ #gHy/.aP*@gBHy/.aP*@gB#'(/.NX y( #(#( `R  g  g#(#(((y(HyHUaP*@f8`8R`4Jg8  g  g(d(HyHUaP*@gBfB <(`RJfRfBL0N^NuNVH0BNtXN*@JgJ//.N 4PJg(m`XJg//.N 4PJfJ g/. /- N 4PJfNܸ L0N^NuNVJfHyHyNP#`/9NX .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`L(n `<f2 `>/9HxHy(N -@g @ #gHy/.aP*@gB#,Hy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.NވX#,#,#,,(y,HyHUa P*@f8`8R`4Jg8  g  g-@d(HyHUaP*@gBfB <,`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNxX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N rPJmJn -|`-nf +||`D/.N X+@f,mJf,0-g-HH-D+@`m+n f09gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HHQ @f fNHHQ @Dg6HH HHQ Agra"Ё.Rf .f .찎d @ XR`8JgHHQ @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 98l  @*PJg*LZ`0SR`*0-\b1 nRJf-\c0R 9nB <-\L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N rPJmJn -|`-nf9HH/N |XJgm+||+||+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX4e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N XJl~0-g /-N zXBBBB BmB- L N^NuNVNX/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`4eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N XHx` afvJgp`p//.N P.lB 8f6Hx/.NP.Jg Jm/N XHx/.N P.Jm.HxB/N `Jgp`B//.N P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N @PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N f N^NuNV/. Hy@t/.N f N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0J-f8 <-#- <-#-#--#-- .^rN .*y-B- g`(*(U g " Ҁe " Ҁd(M *@b-f-gB`R- -o "<N #-BN zX(@ 9-" Ҁe 9-/N zX(@g y- 9-Xg y-  9-" ҀY(#- <- A ` " Ҁ#--c A#- A 9-*A L0N^NuNVH0*n(MY#- (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN .d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ - L0N^NuNHxN@e#8BNu /й8/@HxN@e 98#8NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL>>YOU<<< know what are you doing? Do you really want to abort dump?operatorNo entry in /etc/group for %s. operator/etc/utmprCannot open /etc/utmp ttydttyd/dev/w Message from the dump program to all operators at %d:%02d ... %3.2f%% done, finished in %d:%02d DUMP: Can't open %s for dump table information. /etc/fstabrwroDump these file systems: Last dump(s) done (Dump '>' file systems): ??%c %8s (%6s) Last dump: Level %c, Date %s @(#)dumpoptr.c 1.6 (Berkeley) 11/26/82Lost connection to remote host. shelltcprdump: shell/tcp: unknown service rootroot/etc/rmtO%s %d closeC R%d readW%d writeW%d writeL%d %d seekstatusS I%d %d ioctl%s: %s Protocol to remote tape server botched (code %s?). Protocol to remote tape server botched (in rmtgets). @(#)dumprmt.c 1.5 (Berkeley) 2/24/83bad size to dmpblk: %d Write error on tape %d TAPE ERROR! Restart this tape?After this tape rewinds, replace the reel and the dump volume will be rewritten. Change Tapes: Mount tape #%d CHANGE TAPES! Want to abort?Next tape ready?Tape rewinding Context save fork fails in parent %d Parent %d waiting for %d has another child %d return Child %d returns LOB status %o Bad return code from dump: %d Tape open failed, try again?Tape %d begins with blocks from ino %d The ENTIRE dump is aborted. @(#)dumprtape.c 1.4 82/12/29bread: lseek fails (This should not happen)bread from %s [block %d]: c=0x%x, regc=0x%x, &c=0x%x, n=0x%x More than %d block read errors from %d DUMP IS AILING! This is an unrecoverable error. Do you want to attempt to continue?@(#)dumptraverse.c 1.14 (Berkeley) 2/23/83JanFebMarAprMayJunJulAugSepOctNovDec8@(#)unctime.c 1.3 (Berkeley) 81/04/18M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/fstabr/etc/grouprr@(#)rcmd.c 4.7 3/24/83%s: unknown host %dwrite: setting up stderracceptsocket: protocol failure in circuit setup. socketsocket: All ports in use /etc/hosts.equivr.rhostsr@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$/etc/hostsrr# /etc/servicesrr# ,/ Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$4-b[.lٹ * *#by$%& x$G"I#HTHS/N /NXNuNuNVJf <D`HnNX-@ @B( .N^NuNVH J o4X S n /NX#x"HAxxHABAЁ#x nJgHHR bf oX S n /NX#d`Rh` n|`R:4`RT` 2g` 5gn 4g` 6g` Jgn 9gnr 8g`f Wg`X ngn( dgn cg\`4 fgz`& ugVn sg` wg.` <#`JxfJhg <S` <6 #xHzFHxNP fHxHxNPHz8HxNP fHxHxNPHz*HxNP fHxHxNPHzHx NP fHxHx NPHz Hx NP fHxHx NPHzHxNP fHxHxNPHy|HxNP fHxHxNPNNv/9:(N.X*@gHUaX#:(N`p /HyHyNR й4 @`8mL0N^NuNVHx n / n/Np -@Jf n P ( n P` .N^NuNV . n . N^NuNV . m . N^NuNV 9dr #:l/NhX#:hJgp`BN^NuNV.B 9,r й:hЇ @"nRR mR,R 9,dma ..N^NuNV . "<NJg/. Hy4NP 9d,-@ y ."(d-@ . "<Nh-@`^ .r / 9,r й:h//.N .ѹ,ѹav .Ѯ . 9d,-@ .nr / 9,r й:h//.N .ѹ,ѹ 9,dmaN^NuNVB,/9:l/9:h/9Nn :lg/9\HyLNPHyiNXHyvNXJgVHyNXHyNXHyNXS\#0aB0R\HxaX`a 9:l"9`Nhѹ:H^:H 9dѹX 9:HxoadaNN^NuNV/.Hy NP/9NFX` Hx N<`B/9:DNZP-@m/NFXN^NuNV/9NFXJ0f@a 9\R/HyNPHy8NX`HyINXJgaHy_NXJgN^NuNV/9NFXN-@Hy|HxNPNͮ-@Jl/.HyNPHxaXJgHxHxNP`/././.HyNHnNRX-@f .g .//.HyN .-@ g2 g, g*/.Hy NPHxaX`HxaXHxaX`Hx/9:DNtP#JlHy )NXJfa|`B:HR\R4R#N \o/9:L/9\Hy ZN N^NuNVHy NXHzHxNPN^NuNVHy NXHxaXN^NuNV/.NXN^NuNV y ("(,N̦S-@B:L`h 9:LrNJf -|J g n HH-@R R:L .g/9:La X-@/ nNX .-@ 9:LeN^NuNVH n0.Jg 9:LSrNt 9:LSrNbй:, @ @f. 9:LSrNt 9:LSrNbйt @ n (l ( m 9:LSrNbй:P @HH 9:LSrNrāfZ 9:LSrNt 9:LSrNbй:P @ g @g gR` /.N XLN^NuNVH *n 9:LSrNbй:P @HH 9:LSrNrāfB:@BBA( JgZ l R y"(P"- m y (0` y (HF Ш4SL/A( /aPR mBAX Jg/AX /aPR mJgtR:< 9:LSrNbй:P @HH 9:LSrNrāf8 9:LSrNt 9:LSrNbй:P @HUN XJ:@ff 9:LSrNbй:P @HH 9:LSrNrāf0 9:LSrNtF 9:LSrNbйt @L N^NuNV. y/(0Hn ."(d/a J n:B ytldA -PJg y/(0/.aLPR`S B`$A -PJg/. /.arPR ytm..N^NuNVHJ4gB4Hx/9:PaP 9:LSrNtF 9:LSrNbй:P @ n <C"Q#B( n0. @g g f nJ fa` y (0"HA HABAЁ n"( o y (8"HA HABAЁ` n ( y"(4SЁ"(4Nh./ .(/azP y (0"HA HABAЁ n"( -AJo2BHn/ .X"Ё @/a Jo R mLN^NuNVJg$ y/(0Hn ."(d/aP ` y/(0HnNPJ nz y (t"(0N̦ n"l  y"(4SЁ"(4Nh` y (t"(8N̦-@ y (t"(0N̦ n/.HnaLP`DS B`*/./. A ./a nJoR y .tmN^NuNV y"(4 . N̦"<Nh-@ y (0"<Nh-@B` .o-n` .-@-n`F .".NhЮ @Jg ., @` ., @BR .m .#(a"-n`j .".NhЮ @JgH .Ю찮n y/(0` .r / .".NhЮ @/NP .Ѯ .m# .mN^NuNVH|B` .Ї @Jg,RmJmNR#  "<Nh#(a2B-n`/.N:XR(mLN^NuNVH #:L#lB*|BBޝR m <Iސ#HyN:XL N^NuNVH Jf/. Hn y ."(d/a B`p0-ѮJg -.fJ- gx -. fJ- gj SrNbй:P @HH SrNrāgR`P SrNbйt @HH SrNrāgR:@ . lA*HJmfPL N^NuNV. .{ m {$m y/(0Hy{("( .Nh" y (N̦$ y"( .Nh y"(F" (N̦Ԁ yԨ"( .N y"(xNh y"(`Ԁ y (d/aP y"(x .N".#{ y (xЁ#{$ .{ {($.N^NuNVHB .r //9:0N JlHy NX,.//. /9:0Nj .fg/Hn//././9:(Hy NR  oV/9:(Hx Hy ^N Hy NXHy NXHy NXJfNP`B LN^NuNV/.NX g nB(/.HnNPB.HnaX-@lDpN^NuNVH0*| (n`HxHTHUNp Jft  rNh`lHnN8X-@HnN8X-@HnN8X-@HnN8X-@HnN8Xl-@HnaX`^VJfppL0N^NuNVH n <C"QA-HB~`.p,/.HnNX/a"PJo FSJl .LN^NuNVH0*n(n -op`Z -lp`L -n䰬m - n԰ m -nİm -nm nmBL0N^NuNVNrBN^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^NuNVH0 .". N̔-@/NhX*@fB`(M .VrNb.`BSl L0N^NuNV/.NXN^NuNV.*nm*nN^NuNV/.aX/aXN^NuNVH HnN2X0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QNh-@Jl QS*|D .rgSo,Sm ,R @` HTN(X. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  B @`  B @R mHH. ]g*Jg  B @`  B @RJfS L N^NuNVH *nBB-y -y -y -y -|-|HH. g -f -|`f +g^S`Z/9 /9 .".Nl< 0N///./. 9 "9 NNV-@-A`RHH.  @f .gZ`t/9 /9 .".Nl< 0N///./. 9 "9 NNV-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g(  @/(/ .".N-@-AJg R mJl/./. .".N,`/./. .".N-@-A/.//N -@-AJl ` .".L N^NuNV.*nJg0-g /-NXms+n f mB `+m+| B*nN^NuNVBJg>HxNX-@Hy@NXJg8/.HxNP/.NXN^NuNVHxHy@N*P`PJg" .c .`-n-|HzHxNP-@/.NXN`N^NuNxHxN@eNuNxHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNxHx$N@eNu"o /B/gS @`"Q g2gNuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN(X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|:x`D/.NhX+@f,mJf,0-g-HHt+@`m+n f09gHyNrX0-gp` - //--HH/Nj *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH0*n Jm m#Zp`T .Zx @(P .Zx @ gf ` <//.Hx0N `NqL0N^NuNxHxN@eJgBNuH // |Zx pNLNw //W.BN@d W/Nx WNNVBHnNBPJlp`Jg n .N^NuNxHxtN@eNuNV4.-nB`b y:p S m. .R @HH y:p"(R!AS AHH` /9:p .R @HH/NݜPR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| 4-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| 5 PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| 7`J.g-| 9J.g"/.NX".-A< o-@ .Xf -| ;L`-| LLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNh-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| ]`-| ``Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.Nڰ-@Jg -| c`J.g -| e`J.g-| gAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9  .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr Nh`S n0A .ذbJn/9 (/9 $ .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nn .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|[+|[+n 0-gl(m m R Э "-d f -,/HT-HH/Nn .+L`/.NhX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nn . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nn g m p`BL0N^NuNV.*|` HUaXhe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NFXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N, n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`heB` 0,f -+fp`B, wf0Hx/.NtP.JgJm/NFXHx` afvJgp`p//.NZP.lB Zf6Hx/.NtP.Jg Jm/NFXHx/.NZP.Jm.HxB/N `Jgp`B//.NZP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NZ N^NuNxHxN@eNuNxHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNxHxN@eBNuNxHxN@eNuNxHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNxHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0Jf8 <# <### .^rNb.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<Nh#BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNb.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNxHxN@e#lBNu /йl/@HxN@e 9l#lNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL>>YOU<<< know what are you doing? Do you really want to abort dump?operatorNo entry in /etc/group for %s. operator/etc/utmprCannot open /etc/utmp ttydttyd/dev/w Message from the dump program to all operators at %d:%02d ... %3.2f%% done, finished in %d:%02d DUMP: Can't open %s for dump table information. /etc/fstabrwroDump these file systems: Last dump(s) done (Dump '>' file systems): ??%c %8s (%6s) Last dump: Level %c, Date %s @(#)dumpoptr.c 1.6 (Berkeley) 11/26/82 bad size to dmpblk: %d Tape write error on tape %d TAPE ERROR! Do you want to restart?This tape will rewind. After it is rewound, replace the faulty tape with a new one; this dump volume will be rewritten. Tape rewinding Change Tapes: Mount tape #%d CHANGE TAPES! Do you want to abort?Is the new tape mounted and ready to go?Context save fork fails in parent %d Parent %d waiting for child %d has another child %d return Child %d returns LOB status %o Bad return code from dump: %d Cannot open tape. Do you want to retry the open?Tape %d begins with blocks from ino %d Waiting parent receives interrupt The ENTIRE dump is aborted. @(#)dumptape.c 1.6 (Berkeley) 12/29/82 bread: lseek fails (This should not happen)bread from %s [block %d]: c=0x%x, regc=0x%x, &c=0x%x, n=0x%x More than %d block read errors from %d DUMP IS AILING! This is an unrecoverable error. Do you want to attempt to continue?@(#)dumptraverse.c 1.14 (Berkeley) 2/23/83JanFebMarAprMayJunJulAugSepOctNovDec 4@(#)unctime.c 1.3 (Berkeley) 81/04/18M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/fstabr/etc/grouprr@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$hb[@/lR )*J*Kby$'/dev/xy0a:/:rw:1:1 /dev/xy0g:/usr:rw:1:2 b[B0l B*_*_by$wheel:*:0: daemon:*:1: bin:*:3: news:*:6: staff:*:10: other:*:20: b[D1l݁ **by$root::0:1:Operator:/:/bin/csh daemon:*:1:1::/: sys:*:2:2::/:/bin/csh bin:*:3:3::/bin: uucp:*:4:4::/usr/spool/uucppublic: news:*:6:6::/usr/spool/news: sync::1:1::/:/bin/sync b[F2l$ /**by$# rc 1.2 83/04/12 # HOME=/; export HOME PATH=/bin:/usr/bin if [ -r /fastboot ] then rm -f /fastboot echo Fast boot ... skipping disk checks >/dev/console elif [ $1x = autobootx ] then echo Automatic reboot in progress... >/dev/console date >/dev/console /etc/fsck -p >/dev/console case $? in 0) date >/dev/console ;; 4) echo Root fixed - rebooting. > /dev/console /etc/reboot -q -n ;; 8) echo "Automatic reboot failed... help!" >/dev/console exit 1 ;; 12) echo "Reboot interrupted" >/dev/console exit 1 ;; *) echo "Unknown error in reboot" > /dev/console exit 1 ;; esac else date >/dev/console fi rm -f /etc/nologin # attempt to rationally recover the passwd file if needed if [ -s /etc/ptmp ] then if [ -s /etc/passwd ] then ls -l /etc/passwd /etc/ptmp >/dev/console rm -f /etc/ptmp # should really remove the shorter else echo 'passwd file recovered from ptmp' >/dev/console mv /etc/ptmp /etc/passwd fi elif [ -r /etc/ptmp ] then echo 'removing passwd lock file' >/dev/console rm -f /etc/ptmp fi cp /dev/null /etc/mtab chmod 666 /etc/motd /etc/swapon -a >/dev/console /etc/mount -a >/dev/console sh /etc/rc.local echo preserving editor files >/dev/console (cd /tmp; /usr/lib/ex3.7preserve -a) echo clearing /tmp >/dev/console (cd /tmp; rm -f *) echo -n standard daemons: >/dev/console /etc/update; echo -n ' update' >/dev/console if [ -f /usr/lib/crontab ]; then /etc/cron; echo -n ' cron' >/dev/console fi if [ -f /usr/adm/acct ]; then /etc/accton /usr/adm/acct;echo -n ' accounting' >/dev/console fi /etc/comsat; echo -n ' mail' >/dev/console if [ -d /usr/spool/uucp ]; then cd /usr/spool/uucp >LCK.0 >LOG.0 rm -f LCK.* chmod +w LOG.* rm -f LOG.0 if [ -d /usr/lib/uucp ]; then /usr/lib/uucp/uucico -r1 & echo -n ' uucp' >/dev/console fi fi /etc/lpdrestart & echo -n ' printer' >/dev/console echo '.' >/dev/console cd / echo -n starting network: >/dev/console if [ -f /etc/rshd ]; then /etc/rshd & echo -n ' rshd' >/dev/console /etc/rexecd & echo -n ' rexecd' >/dev/console /etc/rlogind & echo -n ' rlogind' >/dev/console /etc/rwhod & echo -n ' rwhod' >/dev/console fi if [ -f /etc/routed ]; then /etc/routed & echo -n ' routed' >/dev/console fi echo '.' >/dev/console date >/dev/console exit 0 b[J3l z**by%: rc.local 1.4 83/04/15 /bin/hostname noname /usr/ucb/strings /vmunix | grep UNIX >/tmp/t1 grep -v UNIX /etc/motd >>/tmp/t1 mv /tmp/t1 /etc/motd /etc/savecore /usr/crash >/dev/console echo -n 'local daemons:' >/dev/console if [ -f /etc/syslog ]; then /etc/syslog & echo -n ' syslog' >/dev/console fi if [ -f /etc/telnetd ]; then /etc/telnetd & echo -n ' telnetd' >/dev/console fi if [ -f /etc/ftpd ]; then /etc/ftpd & echo -n ' ftpd' >/dev/console fi if [ -f /etc/tftpd ]; then /etc/tftpd & echo -n ' tftpd' >/dev/console fi if [ -f /etc/courierd ]; then /etc/courierd & echo -n ' courierd' >/dev/console fi if [ -f /usr/lib/sendmail ]; then (cd /usr/spool/mqueue; rm -f lf*) /usr/lib/sendmail -bd -q15m & echo -n ' sendmail' >/dev/console fi if [ -f /etc/nd.local ]; then /etc/nd - /dev/console fi echo '.' >/dev/console b[L4l; **by%12console 02ttya 02ttyb 02ttym0 02ttym1 02ttym2 02ttym3 02ttym4 02ttym5 02ttym6 02ttym7 02ttyp0 02ttyp1 02ttyp2 02ttyp3 02ttyp4 02ttyp5 02ttyp6 02ttyp7 02ttyp8 02ttyp9 02ttypa 02ttypb 02ttypc 02ttypd 02ttype 02ttypf b[N5lٺ<ف X**by& HB$G"I#HTHS/N4 /N@XNuNuNVH0` cg pgj rg sgpHy@HydN8PHxN@XSHTaXB4`TX n (P -fHH Pf#t`.HTNXN#0`Rh`Rd`RpSfJtf Hy|NX#tf #t/9taXXJf /9tHyNxPHxN@XHy/9lNP*@Jf/9lNTXHxN@XHUa`XHUNXHy/9`NP*@JgHUa6XHUNXJhga`aJ/9N@XL0N^NuNVH<*n`A(H`RHyHH/aPJfHTNX-@-A`RHyHH/a~PJf`RHyHH/abPJf&L`RHyHH/aDPJgHSNtX.BHTaX$@fJ4gJHTaX$@ .".NN// *NNN%@Jgߪ `R HUHxHnN JfL`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|h 9'||l  @*PJgQbx3Jd 1Uv 5Hj}Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV4.-nBI`b yx S m. .R @HH yx"(R!AS AHH` /9x .R @HH/N8PRI nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DN^ЮLЮ@ @S"n .P".DNp-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn .R l .R`p//./.NL-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N^0S n .Hr Np`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn *LZ`0SR`*0Ib1 nRJfIc0R 9nB <IL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NZ .B`T0-f(mfHn-HH/NrPJmJn -|`-nPf9bHH/N|XJgm+|'+|'+n 0-gl(m m R Э "-d f -,/HT-HH/NZ .+L`/.NpX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NZ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NZ g m p`BL0N^NuNV.*|<` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N"XBBBB BmB- L N^NuNVN/.NpXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|<`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB '|f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N6 `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNdHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N@PJlB`pN^NuNdHxN@eBNuNdHxN@eNuNdHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.Nf N^NuNV/. Hy@t/.Nf N^NuNdHx6N@eNuNVH0JIf8 <J#I <I#J#JJ#IJ .^rNj.*yJBJ g`(*(U g " Ҁe " Ҁd(M *@bJfIgB`RJ Jo "<Np#JBN"X(@ 9J" Ҁe 9J/N"X(@g yJ 9JXg yJ  9J" ҀY(#J <I A ` " Ҁ#JJc A#J A 9J*A L0N^NuNVH0*n(MY#J (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNj.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ J L0N^NuNdHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL/.a?X-@RDHn/.NPJl:/.Hy"` /.Hy1a@PBN^NuNV#/.aBXJfJ9g.HyRa@X`J9f8Hy\HykNpPJ9gHyNpXHyNpXa TLg&J9g Hya@X=nHn/.NPJl/.Hy5a=PB`xB9 yL XLeV y"yL"XL y X`0X`Rt .rNVt .rNй8 @RRS J n .L N^NuNVH #BpB`HB`:a*@g$ 9йp @JgBHUabPfRRp@mRmHyHyaPL N^NuNV.-|`tHx/.aPJg-|*|T`B f8/.Hy alPY y* y  Tfp`XeRS J n .*nN^NuNV.#p##d#j 9йp @HH b@0;N b`Hya,XHy6a-XHyOa,XJg a^*@Jf HySa,XUU@R`6HyTa,XHykNpXHymaXJf Hyva,tX 9йp @a^*nN^NuNVH0*n#pfp`X#dp0-йTe yBHmHyHywa, A(HAd 9R @fS yBB 9p\bJfrHyapX.#dJf`ZHy`HyaFX. ga-@g @0 @fp`p"9ҹp A 9йp @HH b@0;N$Bp `0 9pй @SP`T 9pй @SPa`:L0N^NuNV.#p` 9йp @ f##-yp#pa*@Jg:# BHxHUa P#pg 9йp @ g#pa%t f2##d y?R#ja#pRp 9pc*nN^NuNVH #D#p` gx g|` 9йp @HH f 9pй @0H.Jg0H/aX`D*| d6 pf HxHy`X`HxHy` HxHyaPRp 9pcd 9\U䰹PgZHya)XJ9gHyNpXJ9fHya X f 9\U#PHy$HyaPL N^NuNVH -|`Hx/.a >PJg -|` .rNй8 @HH .rNVrāgZ*|T` fYL yL*p`LXLe .rNVtF .rNй8 @StRS J nL .L N^NuNVPJ9hf^ 9"9NR"9tҹlЁйй (g 9/Hya"P`nJDg <` </JTg <` </JXg <` </Jg <` </Hya"xh` 9йXйTйDfl 9lTf 9LgZHya"&XJ9gHy=NpXJ9fHyGaX f#lT#LJ9hg:HyKa!XJ9gHy_NpX`Hyla6XJfB9hLaXJg+| f\9|BBl#0`DJo4 l*0(@p0,ѕp0, 0&@Jn "<NVJfP lJo \d2 kb*JkJkg "<NV"<p0+cx "<NV"<-A ѕ .Jf0/- HyFaP+|Hy]aXJg+| f0.l#0 L8N^NuNV./.HyeaPaDHyiNpXa*@JgDHUaXJg8Hyp0 @f <q` <u/Hyka `HyHyzaPHyaX*nN^NuNVH >. a"*@Jg0-GfaJfBHyaP` 9pf 9X` p0 @f <` </HyaPa>0-H2H/0-H/HyNp J9g$JGlHyNpXapHyNpXJ9fHyaX f mL N^NuNV.a *@Jg  f8p0 @f <` <//.Hya afJ9fHyaX fbJ9gHyNpXS#DBHUa,P | <C"Q 9йp @BR*nN^NuNVJ9g/9HyNpP/.HyNpPHyaBXHyIaXN^NuNV. pe 9p\c6J@g(Jp 9p\c/9pHyNpPB` 9p#4e 9#4й"9pe 9p"9@N" 9DN@$ 9p"9@N"9F" 9N@ԀԹ 9p"9@NP"9N"9Ԁ-B/9/Hya Jg: 9p"9N"9N@##4 9p"9NP$.N^NuNV n0 g @g `g g fp`&J@g n0/HyNpPBN^NuNVJ9g HyaXL/.HyNpPJ9xfJlHyNpX``J9gHyNpXp`HHxPHnHya< f Hya XHyNpX .yg .YgBN^NuNVH0*n .S" Ҁ(A n S m n (R!@S @` /.NX. g* fp`& a @fd`B L0N^NuNVH0*n(| . "9-@ -g`+n+n `,HUHTa0P/./.Hm HTaJf+|BL0N^NuNV.*n J- g/-/-Hm /.a0B- *nN^NuNVJ9fHyNpX/. /.Hya HyaXJf HyavXN^NuNVHy$HyajPHy|HyaXP g$#Hy|Hya(PHyHyaP/9NX/9NXN^NuNVH0/9pHyNpPaR*@JgHyNpXHn0-H/NXPJfA(H`R :fBHnHy#`0-H/Hy'NpPp0/Hy+NpPJ9g/9Hy4NpP/- Hy9NpPHmNX(@HlHlHyCNp L0N^NuNVH0BLBTBPBHB` 9D".NR-@йD-@䰹n6`D .䐮rNVtF .䐮rN @S .䰹lR 9D".NR$"9F® 9NRԀԹ-B 9D".NR$"9F® 9NRԀԹ-B ."9` @ "9F®Ё*@BNߠX#(# U#, 9S".f 98"903B2 .䐮#4B8BDB(@gPp0gDp0 @fR8S@ .rNVt .rN @RpR .హ@l0`\ .rNVtF .rN @R mJf>B .rNVt .rN @S@R eB .t @BB .".Ё @BPR mR mJf 9Sй$"9NѮ-n`, .rNVtF .rN @R .mB`BB` .ЮЮrNй8 @HH .ЮЮrNVrāf4 .ЮrNVt .ЮrN @R`0 .ЮrNVtF .ЮrN @R .హmN .ܰfR< ."9NR"94Nt @R ."9NR"94N$ ."9NR"90NV"90NԀ BRP`lJof .ѹD .rN @ .rNVp"<ā-BHxHyT/HyN 9Ѯ .й".䒮o-n`, .rNVtF .rN @R .䐮".l .ЁrNй8 @HH .ЮrNVrāf .rNVt .rN @RD` .rNVtF .rN @R ."9NVJf .ܰgXrN @ .rNVp"<ā-BHxHyT/HyN ."9N-@`/.HyHyN R 9"9".m 9DѹT 9<ѹL 9@ѹP 98ѹH |8*+h+h+h /9( 9D".NR$"9F® 9NRԀԹ 9/Hy HyaRR .mBB`r 9$హl 9$` 9/ ."9NRй "9/ .` @/Hya 9ѮR .హ$mB9ZB9XL0N^NuNV.*nJg2/9HmNXPJf e \b#p`p*nN^NuNVH0*n=| p0.XP-@Jgp0-XP-@`Bp0-dp`p0-=@;n Ю*@*;nA (H.9\`R r N.JfSBA ;@.9` r NP0S r N.Ab#p L0N^NuNV.*n -.f -. fJ- f *p `p*nN^NuNVH aF*@JfB`p0 @fp`B.,9Jg <b` <f/HyXa*PaJ9gJ gJ9gDHykNpX#pJf#pa*@Jf"#p`^Hy{aVXJf`J##X# BHxHUaP#p#fHyaXHyNpX`#pa*@Jg&p0 @f 9йp @ g#pHyavXHy` 9F g - йS+@ # #p#HxHUaPfHyaXHy`, 9pй @SPJg#a6*@# HxHUaP#pa*@JgRm 9pй @RP#p/9HyaP/Hy NpPJ9fHyNpXpL N^NuNVH *n..B .r //N. Jl$/.HyaP/.Hy!a PB`//. /N fpL N^NuNVH *n..Jm"`$/.Hy&aP/.Hy+aPB`@B .r //-N. Jm//. /-N f+|pL N^NuNVaHx N8XN^NuNVHx//.N,P-@JgHHn/.NPJm4p0. f n (rf T/ R/N0P .N^NuNVHx//.N,P-@JfB`P nB/.Hyd,N0P n/Hy1Hyd,NP .R/Hyd,NP <d,N^NuNV/././. /.NpN^NuNV/././. /.aHxN8XN^NuNVJ9g>/9Hy4NpP/././. /.NpHy9NpXa/././. /.NpN^NuNV/9Hy;NpPHxN8XN^NuNVJ9g/9HymNpP/. /././././. /.NpN^NuNVHyraXHx N8XN^NuNVH n (8 @ Ю @-@ . -@ z n8lt n (8rNV"Ҁpf`P  @.  @,( n8n( . f Ю @ .ѐ؅R`R`NqLN^NuNVH n (8` . Ю @ fp`B` .rA .Ю @r.r.fp`B` .rA .Ю @r.r.fp`B`~ .rA .Ю @r.r.fp`B`>HyNXB`, b@0;NRNqLN^NuNVH n (8` . Ю @B` .rF .Ю @`~ .rF .Ю @`\ .rF .Ю @``J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9Cl l @*PJg*LZ`0SR`*0db1 nRJfdc0R 9nB <dL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|D,+|D,+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXDe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NVXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`DeB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB Cf6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N. `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NtPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Je$f8 <e(#e$ <e$#e(#e(e0#e$e, .^rN.*ye,Be8 g`(*(U g " Ҁe " Ҁd(M *@be0fe$gB`Re8 e8o "<N#e8BNVX(@ 9e8" Ҁe 9e8/NVX(@g ye0 9e0Xg ye0  9e8" ҀY(#e0 <e$ A ` " Ҁ#e,e,c A#e4 A 9e,*A L0N^NuNVH0*n(MY#e, (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ e4 L0N^NuNHxN@e#HBNu /йH/@HxN@e 9H#HNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL cgsbase %d blk %d >= cgdmin %d; blk+cnt %d > sblock.fs_fpg %d %ld %s I=%u DIRECTORY %D CORRUPTEDSALVAGEDIRECTORY %D CORRUPTEDSALVAGE%s %s=%sDIRFILENAME=%sREMOVEUNREFLINK COUNT %sDIRFILE COUNT %d SHOULD BE %d (ADJUSTED) ADJUST%s %sDIRFILECLEAR (CLEARED) %s: BAD SUPER BLOCK: %s USE -b OPTION TO FSCK TO SPECIFY LOCATION OF AN ALTERNATE SUPER-BLOCK TO SUPPLY NEEDED INFORMATION; SEE fsck(8). inum out of range (%d) bad file type 0%o INTERNAL ERROR: GOT TO reply() %s? no yes CANNOT %s: BLK %ldCONTINUEProgram terminated I=%u OWNER=%s %d MODE=%o %s: SIZE=%ld MTIME=%12.12s %4.4s UNREF %s DIRFILE (RECONNECTED) RECONNECTSORRY. NO lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SEEKREADSEEKWRITE/r%s: %s: UNEXPECTED INCONSISTENCY; RUN fsck MANUALLY. %s: internal inconsistency: %s lost+foundisblockclrblocksetblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/fstabr/etc/passwdrUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$De<. 4ɔ*ɔ3;(D8L$S$Z8Xbpkpt.Ұ~0@@~xӜzӬӬ{ql.@֤f֎֖ ֢$l#X)ެ3<:TG߀QߠXgpydDDD08TTpxj>? &-4;AlF$MTpYari(qzz `>P(P,l  ?%,4;AI6PV]bhbow~< <<$.(.(88<Fb!<%,.X7?H3PW^en0w!T~<||<b< 8~4r%0, IL6<\C^JQX PahqnRtDp T DX \ `2v/7N@sH Qdd / Yhâ l! p'. ct6 x=zE |KļT [`dl u 6{8$ . hi uN   p yV V@~0&*D$008Ě? 4FN 8X_fWmJ:v <~P{Ӭ @&j^@ D Hª 4LF Tkɔ N5| EVT" A, 5cX< C IU]Xel tu }B     8 wrOj;   f !0 g  &ެ .  8, @ߠ F  Q X = _  g. m v   2 ú * ]   $ X C E w#4 { v#8 #< "#@ d#D v#H  #L  "#P  #T & *#X - #\ 5 > #` GƬ P #d Y #h d #l l &#n t w#p } X#t ^#x #| v # ,# # # # # V#  #     Oͪ ? . & ̠ /J 7 >Ұ G Pt W b+l iШ t |X #  Ӏ L  # l C  $ C T ߀ Q nj fD f0 d $ *. 3< : @ F L?4 R X b  D, jD t3 | i   x [ T  Y s @ Q R.  Z .  t  T 8 V  e< B !crt0.ofsck.oufs_subr.oufs_tables.ocalloc.octime.oOftime.ofstab.obcmp.obcmp.ogetpw.oprintf.oprintf.ostrncmp.ostrncpy.osync.obcopy.obcopy.oretbloopbwdbytesbzero.obzero.oatoi.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.oOsignal.ofork.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdividb[6lف' bx*by( (e_by_zeropotdiv_recallRSTrindex.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_rplyflag_read_pass1_pass2_pass3_pass4_freemap_pass5_atoilmult_pass4check_printf_frsumbad_offsumbad_imax_dupblk_pwarn_checkfilesys_iblockulmult_ckinode_ginode_thisname_getfsent_setfsent_pass1check_fixcg_catch_n_ffree_inum_write_n_blks_nflag_blkerr_sblk_errexit_pathp__ctype__strcat_n_index_sync_bcmp_muldup_lseek_lfdir_pass1bcheck_inosumbad_preendie_lastino_pfunc_getline_fmax_flush_wait_devname_free_zinolmodt_pass1b_version_rawname_endfsent_blockcheck_linkup_error_bflag_adjust_blockmap_chgdd_badsb_ctime_dirscan_rawflgulmodt_clrblock_bzero_debug_setup_readdir_bcopy_sbsumbad_bmapsz_bread_enddupldivt_fragacct_duplist_calloc_reply_ckfini_direrr_getblk_endpathname_pathname_n_files_getpw_preen_dnum_pass5check_pfatal_strcmpuldivt_hotroot_orphan_fork_badblk_maxblk_srchname_badlnp_badlncnt_makecg_open_pinode_outrange_descend_pass2check_close__filbuf_perror_bwrite_dfile_rwerr_strcpy_clri_stat_signal_statemap_rindex_time_parentdir_panic_yflag_inoblk__iob_ftypeok_filsize_lncntp_unrawname_n_bad_n_bfree_cgblk_fileblk_lfname_mkentry_findino_startinum_setblock_rootdev_mpid_nswdev_runin_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_fragtbl_physmem_isblock_rablock_boothowto_argdev_runout_dumpdev_selwait_nblkdev_rasize_around_updlock_runrun_maxmem_swapdev_wantin_dumplo_hand_inside_curpri_fragtbl124_fragtbl8_malloc_cfree_dysize_localtime_ftime_asctime_gmtimecerror_strncmp_strncpy_fopen_getfsfile_fgets_getfsspec_fclose_rewind__pfile__print_ovbcopy_fflush_fstat__sibuf_sys_errlist_errno_sys_nerr_strlen__sigfunc__sighandler_syscall_gettimeofday_fcvt_ecvt__flsbuf_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[7lсD bx*by+ $,4. x8$G"I#HTHS/N /NXNuNuNV#Hz(Hx NPa@Jl HxNXN^NuNVHyHycHy]NP#8Jf HygHy NPHxNXBHyHyHy y8/(HyN(#N^NuNV/. /.HyHnNHn/.ahP#4N^NuNV 4fHyHya8PB4N^NuNV/. HyHnN HnHyaP-@Jl #p`LB`8 .ސ/ .Ю//9N -@Jna| .Ѯ .ڰm .N^NuNV/. HyHnN HnNX/Hn/9N /. /./9N HyaXN^NuNV/.HyHnN HnNX/Hn/9N N^NuNV/. /./9N N^NuNVHyaXN^NuNV/. /.HyHnNHnHyaPN^NuNVH 4gB`.HyHyafPB*|a2R m <L N^NuNVJ lp`*/. /.HyHnNHnHyaPN^NuNV/. NX-@/. NX//. /9N ga/.aXN^NuNVHxHnaP .Eg .FfaXJfNSRHy>avXJfHyHy NPHxa XHyHy NP. HH Rgl rgd tg xgr`Hy>NX/HyHy xN Hy>NX/Hy.Hy xN ` n/aX-| n >Hy@HyN P#Jf&HyHyBHy N HxaXHyrHyN P#Jf&HyHyuHy N HxaVX/./. aPN^NuNVH HnHyNPJlHyHy NPHxa X#BJBo 9BSBg&/9BHyHy N HxaXHxHy>a`PJfHyHy NPBBBHyBa~ #b HxaHX` n /a X-@g.SrNй @HH .SrNXrāf . X @/HyHy N`LJg n /a,XJg . X @//.a P`Hx . X @//.a .SJfD oa##Hy>aBXHy>abXJgHxHy>aP fHy`,B/9NP# f~Hy,`fHy?Hy NPaNPHyVHy NPHyNXJgHyNpX#Jn|HyHy NP` oaHy>aXXJgj/9Hy>a$PJf/9> HyHy N `FHxHy>aPJgHyaXJopHy>a`XJf4B`RHy>aXJg/.HyHy N HxHy>a4P f,HyHy NPJfRJfH`nHxHy>aPJfHy>atX`V-y>#b  y!n ."< NX @*Pg .f-f#+y>0+y>8 p09> -@JgHUapX/HnN P`/-HyHnN . gj @g@ `gX g g/.HnHyHy N-S/9>,Hz Hz a * `JgHnHy Hy xN /9>H/.HnNB JgHnHy#Hy N `~JgHnHyCHy xN HxHyYHnN HnaX09>&H/09>$H/HnN /9>,Hz Hz a L `JfxJgHnHy\Hy xN HxHnNlP#lHnHym`09>&H/09>$H/HnN JgB/9>,Hz VHz a Hz ra,X`4JgHnHyHy xN 09>$H-@09>&H-@B9Bb/9>,Hz ~Hz "aJ HnHyNPJl*HnHyHy N -S`/./.HnN`JgHnHyHy xN HxHnNlP#lHnHy`09>&H/09>$H/HnN /9>,Hz Hz >at /9NX/.HnNPHmHnN&P`**U`-| ` n*P`Jg"-gHmHUaX/N&P-f-f$HUaX/HyHy N `JgHUaRX/HnN P/-a:X/HnN PJgHnHnHyHy xNHnHnN2PJlHnHnHy Hy N*UfX >eL N^NuNVH -|=|p0./Hy#HnN| p0.XP=@`Hy%Hy NPHy>a XJg`Hya(`Hy`*|> p0. @f >f~HnaXS gTp0. gHyCHy NPHxa6XHyWHy NP##Jf Jg/9B/9>aPJg/9>,HzHza HzfHnazPHzXaXHxHy>a P gHxHy>a P gHxHy>a PJfJgN/9NXHyaX#Jf*Hy{N X`/9>,HzdHz`a `dL N^NuNVH0Jg> .Ю -@*ndJUgHnHUaPHznHnaP`B`V .Ю(@ ."<-AJlg p0,c .Ѯ`p0,ѮJg HzHTaP . mL0N^NuNVH0 .SrNй @HH .SrNXrāf$Jg/. HyHy xN` ."< NXb @*P`N -f@Hx/. /.a Hx/. HnN| HxHyHnN HnNX-@/-/-/9a /9alX(@/9a^X(@/9aPX(@/9NҬX-@`"HxHlHnHyHy Ng lf ,/g|ABp0,Ю dp0,/HlHnN Hn/aVP/-/./9a `H*UfHx/. /.ah L0N^NuNVH0# *n /fRA(H`JgR /fTBHU/9 a8P# JfB` ./fA*H` 9 L0N^NuNVH0 ."< NXb @(P` ,g(TfB`t/,/,/9a  /. NX-@/9a X*@g mf -/gp0-f/./. HmN8 Jf L0N^NuNV. |> <C"QB`(AܤJgt 9Rr AЈ/a$X 9B"<N"9ܲf o 9B` 9Sr Ю/Hn nNPB`hJo: o 9r ` 9Sr Ю/Hn nNPB o <` ./HyB n NPn4Hy>aX` 9r Ю/Hn nNPB`xRܠmHnaXJf,/9aBX/HyHy N B>`*HxHnaPJfA <C>"QJnf..N^NuNV/. /./9N fHyN XHxa&XN^NuNVHx/. /9N fHyN XHxa XN^NuNV . rNЮ-@-n`$Hn/.a PHzNHna^P .eN^NuNV/9a X/HyHy N /. /.a:PN^NuNV . ѹb bo(/. /.HyHy NHxa X/.HyNPN^NuNV/9a pX/HyAHy N Hxa XN^NuNVN^NuNV. mXB r ( @BR mBHx(HyN|P.l8Jg$/9a X/HyhHy N JfHyHy NPHyHy NPS dm 9 hR h @`Hy dN`X@S dm 9 hR h @`Hy dN`X f .yg .nft .nf Hxa XR.<(/HyNDPHx/NPJlHyHy NPHxa :XJf# RaNP/9HyHy N S dm 9 hR h @`Hy dN`X fB/9NP# f Hy`HyHy NP`hHnaHXJg/9HnaPJfHy`/.aX`*Hx/. 9Rr /N ..N^NuNV# N^NuNV o=|`=|-|aHx0.H/NjP fT o<=|Hx0.H/NjPJf=| 9S-@/0.H/` BBNP oHxHxNjPN^NuNV n ( fp`BN^NuNV/.a"XJfB`Hx/.azPJgpN^NuNVJf,/.a@X n lf/aXJfB`HnaXHx/.NDP n n!n n!n n!n n!n n!n n!n n!n n1n n1n"" n1n$$ n1n&& n!n(, n!n,H n!nT0 n!nX8 n!n\@ n!n`Hx ./HndN kfHnaXJg n!|lpN^NuNV n lgB`pN^NuNV n  fp`BN^NuNV..9> nJfHx/NTP n n-P`/.aX SJfHy>a&XJg..N^NuNVH *n,<BޝSf Ig*/9a|X//HyHy NB`pL N^NuNVH0*n(M` /fBHxHUN&PJlnN0.fPBHUHy%HyNBHUHy:Hy+NHy@Hy NPBaFXHnNzX,mf/RJflL0N^NuNVNJfHy{Hy\`P .//.HyHy N ./N"XJlr ./HyHy N HxaX`/./.N4PJgND-@f/.HyHy N HxaNXN^NuNV nJg0(й c4 <"9 A0HxHy n NPB n0(/ 9 //N #  n0(ѹ N^NuNV <"9 A0/9 Hy nNPB N^NuNV/9/. Hx/.Nr/9NX#BN^NuNVH0*n(n HxHTNDPp0(HxHmHlN| HlNX9@p0,XP9@L0N^NuNV.Hx NX*@B/.NP* fHUNBXB`B *nN^NuNV.*nHUNҬX". gp . J l/. HyHy N B . Ю//N . +@JgHxHm /N +@*nN^NuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNV.Hx HxNTP*@ ."< NXb @* ."< NXb @ +n+n *nN^NuNVH0-|/.HxNTP*@+nn/. NX-@n/9NX+@/9Hx .R//. NrJ.g ."< NX @* ."< NX @ R(U`(Tg& ,f,f-+LSJg-g:HTa|X//. HyHy xNHxB/9NP `:-g/./. Hy`/./. Hy Hy xN L0N^NuNVB n/(/9NP /9Hx n(R/Hy(N <(N^NuNV/././. /.Hy NN^NuNVHyNXHyNX/.NXN^NuNVJ/H0..*n Jo o#p`   @(P   @ g0g(g g <*@`*|HU/NP*@ggf(M  @B L0N^NuNVJ/H0..*n Jo o#p`z   @(P   @ ggg <*@HU/NP*@ggf(M  @ L0N^NuNVJ/...Jo o #`Hx/NP..N^NuNVJ/...Jo n  @Jf #` </ /NP..N^NuNVJ/...Jo n  @Jf#p` <//NPB..N^NuNVJ/Hx/.NPN^Nu/<0N@dNNuJ/H // |  pN o Jg$/|LY/<0N@NrLNwNHxN@eNu _/<BN@eJfN# HxNX-@HyNXJg8/.HxN(P/.NXN^NuNVHxHyNP`PJg" .c .`-n-|HzHxN(P-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHx9N@eNu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNHxhN@eNu"o /B/gS @`"Q g2gNuNVH8*nBNXNL(@Jg,HU/N4PJg&l`XJgHU/N4PJfN L8N^NuNVJ 0fHy 8Hy $N P# 0`/9 0NѠX . 4N^NuNVJ 0gJ 4f/9 0NXB 0N^NuNVH0J 0fNHy :Hy $N P# 0f2BL0N^NuNVH0*n`<(n `,f" `./9 0HxHyN -@g @ #gHy /9 VHxHyN -@g @ #gHy d/.aP*@gB# Hy g/.aP-@Jg @BR n  g  gHy j/.aVP*@gnB/.NpX# # #  (y Hy mHUa P*@f8`8R`4Jg8  g  g d(Hy pHUaP*@gBfB < `RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN`X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NrPJmJn -|`-n df +|(`D/.NX+@f,mJf,0-g-HH +@`m+n  df09 gHy xNjX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NɈHH0`hrA`^HH  @f fNHH  @Dg6HH HH  Agra"Ё.Rf .f .찎d @ XR`8JgHH  @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| t 9 l ʴ @*PJg\όϣ .Ga}Еж"5BVj}ьError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNjXBB-HH/N B+mm0-gm*nN^NuNHxaN@eNuNV/9Hn /.N҂ N^NuNV/9/. /.N҂ N^NuNVA -H .X @Jf n/Hn /.N҂ N^NuNHx;N@eNu //W.BN@d W/N WNNVHxB n/N nШN^NuNVA-HA#$=|B-n-|Hn/. NDPSm .R @BHH`HnBNP .N^NuNV4.-nB 4`b y$ S m. .R @HH y$"(R!AS AHH` /9$ .R @HH/NPR 4 nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH  @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH  @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| `J.g-| J.g"/.NX".-A< o-@ .Xf -| L`-| LA`-H-H`P .P-@@ .P-@P".DN^ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| `-| `Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.Nߨ-@Jg -| `J.g -| `J.g-| AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".NgP .S-@HJlD-@HJHg6 .Hr N^0S n .Hr N`S n0A .ذbJn/9 /9 .".Nfp+`p-S n.HH  @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0 8b1 nRJf 8c0R 9nB < 8L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NrPJmJn -|`-n xf9 HH/N|XJgm+|(+|(+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| d` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NBXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N$ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| d`eB` 0,f -+fp`B, wf0Hx/.NlP.JgJm/NXHx` afvJgp`p//.NP.lB f6Hx/.NlP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuNVH N6.*nJfS` r NX0 r N.S XgR|a` zf <` RB/.N&P f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.Nv N^NuNV/. Hy@t/.Nv N^NuNHx6N@eNuNHx N@eNuNVH0J f8 < # < # #  #  .^rN.*y B g`(*(U g " Ҁe " Ҁd(M *@b f gB`R  o "<N# BNBX(@ 9 " Ҁe 9 /NBX(@g y 9 Xg y  9 " ҀY(# <  A ` " Ҁ#  c A# A 9 *A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLFOXajt8~|$4DD{|\pq`.+Ɉ3>ɮIU[a j$ʴsѠy|ҌҬJFDDN 4ߨߨߨ  &z-26?BEINU[?d<jqtx|$X\pN"*0,6;DKRfY`rd kLq v?"&v^2P  $ %.l-4.<Ex N0W@_i@s<xN j<4l|3 !0p( hh'x1<6ENIT<Xt_tfnw~r0qpl4%P,~= `|jw F) 3vj=LQ(W #_pju  f$. dI>8}r  |6SXz}#; +D5?tFO >W|` /Bh BpxvW| z B >b[r?zyB,~x~  ^ n " Pb + 4 b < : Du LW S Y " aX h  o w. d {D  ?0 "     < F u j kT  t {& v    P ! +2 14 9  @.l G N Wo ]  d6 n  sX {  & > ; `  g - N  7 !   ( z       *> 1 9X CeP J S ]n e  i q  u x D  B JҬ  6  L   C >   M  6  Ɉ ! (O 0^ 6? A H Q* Y  b*$ l w+ ~ Lj QH t~ 8   Ҍ F:  -| n Z $ D f    ( / 8 DL P \ gѠ oLà {M s\ r ( ɚ ʴ  D $ ҂ n fߨ     $ B?N'  (/93|AHirO$V\yc[FipvYsQhRRZ|p6tPv08lB  .crt0.odumprmt.o_rmtstate_sccsidrrestor.osigset.o_cactions_setflgsignal.osignalSIGDORTIsigoldnoerrorOutime.oOvfork.ocalloc.ochmod.ochown.octime.oOftime.ofstab.oftell.ogets.ogetuid.ochdir.olink.omknod.ofseek.orcmd.oaccept.oconnect.olisten.ofprintf.ofprintf.oindex.ordwr.osetuid.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrncat.ostrncmp.ostrncpy.osymlink.obcopy.obcopy.oretbloopbwdbytesbind.obzero.obzero.ogethostbyname.ogethostent.ogetservbyname.ogetservent.oatoi.ofgets.ofilbuf.oinet_addr.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.osocket.oexec.oexec.oexecve.osyscall.otelldir.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.omktemp.oaccess.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_atoi_rmtgetconn_rmthost_rmtclose_write_rmtgetb_rmtopen_rmtgets_fprintf_errno_rmtread_rmtconnaborted_rmtseek_sprintf_rmtwrite_rmtioctl_getservbyname_msg_rcmd_rmtape_rmtwrite0_rmtwrite1_rmtwrite2_rmtcall_mts_rmtpeer_strlen__iob_rmtreply_sigset_rmtstatus_pass1_dumpnum_readtape_strncmp_readbits_xtrlist_ftell_null_checktype_xtrlnkskip_mflag_dirloc_getfsent_setfsent_flsht_cvtflag_u_spcl_strncpy_fssize_seekpt_strcat_index_xname_chmod_lseek_curblk_execl_clearedbuf_pathlen_fwrite_dirwrite_xtrfile_wait_free_chown_version_setuid_volno_seekdir_symlink_dcvt_xtrcvtskip_unknown_dirfile_inotab_lnkbuf_unlink_ctime_prev_dirbufulmodt_ofile_putent_checkdir_psearch_bzero_df_vfork_chdir_readdir_bcopy_maxino_isheadldivt_fopen_dirp_calloc_strncat_doit_utime_xtrcvtdir_host_xtrlnkfile_eflag_gethead_allocxtr_link_strcmp_vflag_creatuldivt_magtape_done_entry_checkvol_tbf_search_open_setdir_access_xtrskip_close__filbuf_perror_getfile_hflag_fread_bct_checksum_strcpy_getleaves_stat_signal_gets_malloc_xtrcnt_cvtdir_dumpmap_namefile_yflag_getuid_flushent_fseek_readhdr_tapename_putdir_nf_fclose_mt_allocinotab_mktemp_clrimap_ino_mknod_telldir_opendir_extractfiles_resetmtcactions_sigignore_sighold_sigpause_sigsyssetflg__sigcatch_sigrelsecerrorulmult_cfree_dysizelmodt_localtime_ftime_asctime_gmtime__ctype__endfsent_getfsfile_fgets_getfsspec_fflush_socketaddr_connect_ruserok_rresvport_sleep_syscall_bind_socket_gethostbyname_accept_listen__pfile__print__flsbuf_alarm_setjmp_longjmp_pause_ovbcopy_endhostent_gethostent_sethostent_inet_addr_rewind_endservent_getservent_setservent_fstat__sibuflmult_sys_errlist_sys_nerr_execle_execv_execve_fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_getpidptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[8lف6 bx*by,08@HPX`hpx( h`<$G"I#HTHS/N4 /NРXNuNuNV.Hz#HxNLP fHxHxNLPHz#HxNLP fHxHxNLPHyNڠXHyNڠX lHyHy tNDPHxa#RXX U n *PX `bn Rgn -gFHH/HyHy tND `R^`n ff n #pX SRJgHH sf . X @/NX#tJnHyHy tNDPHxa"X`RN`RR`URV`RZ`RNRRU`v cgF`" mgn hg` rg` xgn vgn tg` yg`/. /..HH/a Ba!X*nN^NuNVB/9pNܾP#l&/9pHy:Hy tND Hxa!X tg>=| 9tS-@HnHym/9Nz JlHyPNXHx Hy>NPHy:aXJfNSR^Hy:aXJfHy\Hy tNDPHxa XHyuHy tNDP. HH Rgl rgd tg xgr`Hy:N X/HyHy `ND Hy:N X/HyHy `ND ` n/aXX-| n HyHyN$P#Jf&HyHyHy tND HxaXHyHyN$P#Jf&HyHyHy tND HxaX/./. aPN^NuNVH HnHyNPJlHy Hy tNDPHxabX#>J>o 9>S>g&/9>Hy/Hy tND HxaXHxHy:aPJfHyBHy tNDPBBBHydBa #^HxaRX` n /a X-@g.SrNй @HH .SrN\rāf . X @/HyHy tND`LJRg n /aXJNg . X @//.a P`Hx . X @//.a: .SJfD toa#t#xHy:aXHy:aXJgHxHy:a:P f Hy`.B/9pNܾP# fHy`nHyHy tNDPa/9NܪXHyHy tNDPHyNXJgHyNX#xJnrHyHy tNDP` toaHy:aXJgb/9xHy:aPJf/9:Hy(Hy tND `>HxHy:aPJgHya XJopHy:aXJf4B`RHy:alXJg/.Hy;Hy tND HxHy:aP f,Hy]Hy tNDPJfRJRfH`nHxHy:afPJfHy:aX`V-y:#^ y!n ."< N\ @*Pg .f-f#+y:+y; p09:-@JRgHUaX/HnNP`/-HyjHnN . gj @g@ `gX g g/.HnHymHy tND-S/9:Hz Hz a * `JVgHnHyHy `ND /9;/.HnN^ JgHnHyHy tND `~JVgHnHyHy `ND HxHyHnNp HnaRX09:H/09:H/HnN /9:Hz Hz a L `JRfxJVgHnHyHy `ND HxHnNpP#lHnHy`09:H/09:H/HnN JbgB/9:Hz VHz a Hz raX`4JVgHnHyHy `ND 09:H-@09:H-@B9B^/9:Hz ~Hz "aJ HnHyN*PJl*HnHyHy tND -S`/./.HnN`JVgHnHy>Hy `ND HxHnNpP#lHnHyO`09:H/09:H/HnN /9:Hz Hz >at /9NܪX/.HnNPHmHnNRP`**U`-| ` n*P`JRg"-gHmHUa"X/NRP-f-f$HUaX/HygHy tND `JRgHUaX/HnNP/-aX/HnNPJVgHnHnHy|Hy `NDHnHnNNPJlHnHnHyHy tND*UfX :eL N^NuNVH -|=|p0./HyHnN p0.XP=@`HyHy tNDPHy:a ,XJg`Hya`Hy`*|:p0. @f :f~HnaXS gTp0. gHyHy tNDPHxaXHyHy tNDP#b#^Jf Jbg/9>/9:aPJg/9:HzHza HzHnaPHzaXHxHy:a |P gHxHy:a bP gHxHy:a HPJfJgN/9NXHyaX#Jf*HyNX`/9:HzdHz`a `dL N^NuNVH0Jbg> .Ю -@*ndJUgHnHUa"PHzHnaP`B`V .Ю(@ ."<-AJlg p0,c .Ѯ`p0,ѮJg Hz~HTaP . mL0N^NuNVH0 .SrNй @HH .SrN\rāf$JVg/. HyHy `ND` ."< N\^ @*P`N -f@Hx/. /.a( Hx/. HnN HxHyHnNp HnNX-@/-/-/9a\ /9aX(@/9aX(@/9aX(@/9NX-@`"HxHlHnHyHy tNDg lf ,/g|ABp0,Ю dp0,/HlHnNp Hn/aVP/-/./9a `H*UfHx/. /.a L0N^NuNVH0#*n /fRA(H`JgR /fTBHU/9a8P#JfB` ./fA*H` 9L0N^NuNVH0 ."< N\^ @(P` ,g(TfB`t/,/,/9a /. NX-@/9aX*@g mf -/gp0-f/./. HmN Jf L0N^NuNV. |: <C"QB`(AܤJgt 9|R|r AЈ/a$X 9>"<N"9|f o 9>` 9|Sr Ю/Hn nNPB|`hJ|o: o 9|r ` 9|Sr Ю/Hn nNPB| o <` ./Hy> n NPn4Hy:atX` 9|r Ю/Hn nNPB|`xRܠmHna8XJf,/9aX/Hy5Hy tND B:`*HxHnafPJfA <C:"QJ|nf..N^NuNV/. /./9N fHy\NXHxatXN^NuNVHx/. /9Nږ fHyjNXHxa4XN^NuNV . rNЮ-@-n`$Hn/.a PHzNHnaP .eN^NuNV/9a xX/HywHy tND /. /.a:PN^NuNV . ѹ^ ^o(/. /.HyHy tNDHxa `X/.HyNPN^NuNV/9a X/HyHy tND Hxa XN^NuNVN^NuNV. m~B r  @BR mBHx(Hy/9N .lNHyNXJg$/9a @X/HyHy tND JZfHyHy tNDPHyHy tNDPS Lm 9 PR P @`Hy LNX@S Lm 9 PR P @`Hy LNX f .yg .nft .nf Hxa XRJ.<(/HyNPHx//9Nږ JlHy!Hy tNDPHxa jXJf# Rxa/9NܪX/9xHy6Hy tND S Lm 9 PR P @`Hy LNX fB/9pNܾP# f HyG`HyZHy tNDP``HnaXJg/9xHnahPJfHyu`/.avX`*Hx/. 9Rr /N4 ..N^NuNV# N^NuNV to=|`=|-|aHnHym/9Nz f tod=|HnHym/9Nz Jf@=| 9tS-@HnHym/9Nz JgXHyNX`HBB/9Nږ to(=|-|HnHym/9Nz N^NuNV n ( fp`BN^NuNV/.a"XJfB`Hx/.azPJgpN^NuNVJ^f,/.aX n lf/aXJfB`HnaXHx/.NP n n!n n!n n!n n!n n!n n!n n!n n1n n1n"" n1n$$ n1n&& n!n(, n!n,H n!nT0 n!nX8 n!n\@ n!n`Hx ./HndN4 kfHnaXJg n!|lpN^NuNV n lgB`pN^NuNV n  fp`BN^NuNV..9;h nJfHx/NP n n-P`/.aX SJfHy:a&XJg..N^NuNVH *n,<BޝSf Ig*/9a|X//HyHy tNDB`pL N^NuNVH0*n(M` /fBHxHUN*PJlnN\.fPBHUHyHyNBHUHyHyNHyHy tNDPBaXHnN~X,mf/RJflL0N^NuNVNJfHyHy`P .//.HyHy tND ./N>XJlr ./Hy1Hy tND HxalX`/./.N8PJgNp-@f/.HyHHy tND Hxa&XN^NuNV nJg0(й c4 <"9 A0HxHy n NPB n0(/ 9//N4 # n0(ѹN^NuNV <"9 A0/9Hy nNPBN^NuNV/9/. Hx/.N/9N0X#>N^NuNVH0*n(n HxHTNPp0(HxHmHlN HlNX9@p0,XP9@L0N^NuNV.Hx NݔX*@B/.NܾP* fHUNFXB`B *nN^NuNV.*nHUNX". gp . J l/. HyXHy tND B . Ю//Nږ . +@JgHxHm /N +@*nN^NuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNV.Hx HxNP*@ ."< N\^ @* ."< N\^ @ +n+n *nN^NuNVH0-|/.HxNP*@+nn/. NX-@n/9N0X+@/9Hx .R//. NJ.g ."< N\ @* ."< N\ @ R(U`(Tg& ,f,f-+LSJVg-g:HTa|X//. HyxHy `NDHxB/9Nl `:-g/./. Hy`/./. HyHy `ND L0N^NuNVB n/(/9Nl /9Hx n(R/HypN <pN^NuNVHyN݊XHyN݊X/.NРXN^NuNHxN@eNu _/<BN@eJfN# `J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|\ 9䰹pl ` @*PJg*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NvPJmJn -|`-n `f9 rHH/N܀XJgm+|p+|p+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NݔX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| L` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NܪXJl~0-g /-NFXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N( n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| L` eB` 0,f -+fp`B, wf0Hx/.NpP.JgJm/NܪXHx` afvJgp`p//.NܾP.lB f6Hx/.NpP.Jg Jm/NܪXHx/.NܾP.Jm.HxB/Nږ `Jgp`B//.NܾP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nܾ N^NuNHxN@eNuNVH N:.*nJfS` r N\0 r N.S XgR|a` zf < ` RB/.N*P f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NTPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.Nz N^NuNV/. Hy@t/.Nz N^NuNHx6N@eNuNHx N@eNuNVH0JHf8 <L#H <H#L#LT#HP .^rN.*yPB\ g`(*(U g " Ҁe " Ҁd(M *@bTfHgB`R\ \o "<N#\BNFX(@ 9\" Ҁe 9\/NFX(@g yT 9TXg yT  9\" ҀY(#T <H A ` " Ҁ#PPc A#X A 9P*A L0N^NuNVH0*n(MY#P (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ X L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLL >T\Wc jzqږx|zD > >^[?p~yF,~0wx*^D P^ ^! :)u݊1W 8> "F\M T\zfdto{v z?\>^4F Fu$ jkptTxRv~JP8 BN8! V(.p/6p?oE L6V [Xcܾi,q*y>;ܪg-NN7"! Lzݔb  $  =Z ! +. L 1el 8 Af Kn S  W _  c pxڠ x D  ^ J   L   4  O b ?$ :  V  *P  !+` ( 3Ln ;  CH Kf͘ Tt ]v d  lF r` p  d    Z n fʬ   ؖ ؤ  ( F ?ל R    p  #3܀ + 2iv 9( @ Fy M[J Sм Z `Y is rԨ xQl Rؖ V ZӀ p: x T 4 8p F ` 2 crt0.orestor.oOutime.oOvfork.ocalloc.ochmod.ochown.octime.oOftime.ofstab.oftell.ogets.ochdir.olink.omknod.ofseek.ofprintf.ofprintf.ordwr.ostrncat.ostrncmp.ostrncpy.osymlink.obcopy.obcopy.oretbloopbwdbytesbzero.obzero.oatoi.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.oOsignal.oexec.oexec.oexecve.osighandler.osyscall.otelldir.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.omktemp.oaccess.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_pass1_atoi_dumpnum_readtape_strncmp_readbits_xtrlist_ftell_null_checktype_xtrlnkskip_mflag_dirloc_getfsent_setfsent_flsht_write_cvtflag_u_spcl_strncpy_fssize_seekpt_strcat_xname_chmod_ioctl_lseek_curblk_execl_fprintf_clearedbuf_pathlen_fwrite_dirwrite_xtrfile_wait_free_chown_version_volno_seekdir_symlink_dcvt_xtrcvtskip_unknown_dirfile_inotab_lnkbuf_unlink_ctime_prev_dirbufulmodt_ofile_putent_checkdir_psearch_bzero_df_vfork_chdir_readdir_bcopy_sprintf_maxino_isheadldivt_fopen_dirp_calloc_strncat_doit_utime_xtrcvtdir_xtrlnkfile_eflag_gethead_allocxtr_link_strcmp_vflag_creatuldivt_magtape_done_entry_checkvol_tbf_search_open_setdir_access_xtrskip_close__filbuf_perror_getfile_hflag_fread_bct_checksum_strcpy_getleaves_stat_signal_gets_malloc_xtrcnt_cvtdir_dumpmap_strlen_namefile_yflag_flushent__iob_fseek_readhdr_tapename_putdir_nf_fclose_mt_allocinotab_mktemp_clrimap_ino_mknod_telldir_opendir_extractfiles_resetmtcerror_errnoulmult_cfree_dysizelmodt_localtime_ftime_asctime_gmtime__ctype__endfsent_getfsfile_fgets_getfsspec_fflush__pfile__print__flsbuf_ovbcopy_fstat__sibuflmult_sys_errlist_sys_nerr__sigfunc__sighandler_syscall_execle_execv_execve_fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_getpidptwo_gtty_stty_realloc_sbrk_end_brkb[9lѾω **bx<DLT\dlt|# XK0$G"I#HTHS/N4 /NtXNuNuNVH B-|`HyHyN@P-@JfHyNlXHxHNtX3 d n (3 fB h`X n *P -f-HHd b~@0;NZt<ttttttttbHmNX#NJnD#N`8J-g A#`&#R`R`HmNX3 fSnTJf #RJf~ l"Hx/NtPR`HzHxNtPHzHxNtPHz 0HxNtP 9N"HA<P`NV/9/.HyGHnNBHnHxaPN^NuNVH *n`rHUHyXNP`^ MZfJ g:/. /9ZN@PHyj/9ZNP/9ZNXѹZ#JL f@-HH $g *gJRHH0#LRJm Lox#JL`l-HH/HymNP-HH0.Jo~ nv#J`nHyNXaf`Z  g  g yZRZRJfJg6 yZBRZR#MZ/9Z/9LaP#MZJfL N^NuNVHyHxaPRHzFHxNtPHxNXHz*HxNtPJgHzHxNtPN^NuNVBNXHyHxatPHxN$XNfBNtXN^NuNVH *nB Ї @JfB`,R m - f - f -: f -: fpL N^NuNVH8A(H.<HnNpX/. aXJf"HnNXX*@|`SJn*n ` SJmJfS  g B "HA**HABAЁ&@JgJl.J+g 9N"HA<NJf(A /Hn fp`B/a: BNX`HnNԞXJlL8N^NuNVH8`HyNXHxHxNtPHyHxaPHy/9NP*@JffHyHyNP-@/9/9Hy/.N`/9/9HyN /.NX`N(|`Jg /,NXB* `e(|`>BHnHy6N . g8A&H`  gRJfBA&HBHH0-@ *f R-|B+ `dHSHl N@PHyHHSNP)@JfTHyWHyJNP-@/9HSHyY/.N/.NX`fHSHyNP`TBn l(HH/NX@`$,HH//./.HSHyN*HUHx(HnNX JfBHUHx(HnNX JgtA&H`  gRJfBB.HxHn "HA33HABAЁ d/N@ R l"` "HA33HABAЁ d @BR mHUNXHyHxaPHz HxNtPL8N^NuNVH BHyNP-@Jl`J.gvJf@BHn "HA33HABAЁ d/aPJf R m l0NJf$HxN$X*|HxHnHmN$ HxHUNP.Jl HxNXHn/NζPJm*p0.g`.Bp0./HyN /NXBNXHnNpXHx$Hy/NԺ HxHnNX//NԺ HxHy%/NԺ /./. /NԺ HxHy+/NԺ BNXHxHn/.N gf/.NXL N^NuNVH0*n(n Bg  fJgJf  gB`$  gJgR  gJgRR mpL0N^NuNVH0BN` Hy.NXHnNpXA(H*|6fSHnNX*@fHnHxaZPHzHxNtP 9N"HA<HxNX-@HyQ(NXJg8/.HxNtP/.NXN^NuNVHxHyQ(NP`PJg" .c .`-n-|HzHxNtP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHx$N@eNuNVH0JLl BBaP .Xn-n `A*HJo" 9Pf< .0> 9Pg&Nz/Hy`HUN HUNXJTg(yT`Jf: ` .R @gj  gd %f nRHH mfJm 9To/9HydHUN HUNXAeJfS B/. /./././.HnHn N 9PglHxHy dBHn NX/Hn /9LNZ,JlZHymNlX`J 9 @/Hyz`@%B`@Hn NX/Hn /9LNԺ nJf,L0N^NuNV#T# PJLlfHyHy}N@P-@/9\NX-@JgJgHxHy dNP3 dBBHxHxNj#LJm4BHxHy d/NJl/9LNX#LJLlHyNlX n (3 f n/( Hy h/(N( P`HyNlXJLl\PP#X#LHxHyNP#LJlHyNlX#LN^NuNV/9LNX#LN^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNHxhN@eNu"o /B/gS @`"Q g2gNuNVH8*nBN/9"HxHyVNX -@g @ #gHy0/.aP*@gB#ZHy3/.aP-@Jg @BR n  g  gHy6/.aVP*@gnB/.NX#Z#Z #Z$Z(yZHy9HUa P*@f8`8R`4Jg8  g  gZd(Hy`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|@ 9Tl  @*PJgXh$:LXjy%;JViz4Kb|"2Im8M`Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNBXBB-HH/Nj B+mm0-gm*nN^NuNHxN@eNuNHxaN@eNuNVH0*n Jm m#p`T .,| @(P .,| @ gf ` <$//.Hx0NP `NqL0N^NuHxN@NHxN@eJgBNuH // |,| pNLNw //W.BN@d W/N WNNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNVA-HA# t=|B-n-|Hn/. NPSm .R @BHH`HnBNlP .N^NuNV4.-nBZ`b y t S m. .R @HH y t"(R!AS AHH` /9 t .R @HH/NlPRZ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|p-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|q PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|s`J.g-|uJ.g"/.NX".-A< o-@ .Xf -|wL`-|LA`-H-H`P .P-@@ .P-@P".DN͢ЮLЮ@ @S"n .P".DNҴ-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NxPJf/./.NˠPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9\/9X .".NǼgP .S-@HJlD-@HJHg6 .Hr N͢0S n .Hr NҴ`S n0A .ذbJn/9d/9` .".NǼfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NxPJf/./.NˠPJfHnHn *LZ`0SR`*0Zb1 nRJfZc0R 9nB <ZL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NԺ .B`T0-f(mfHn-HH/NζPJmJn -|`-n(f9:HH/NXJgm+|,+|,+n 0-gl(m m R Э "-d f -,/HT-HH/NԺ .+L`/.NϴX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NԺ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NԺ g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NfXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NDP.JgJm/NXHx` afvJgp`p//.NP.lB f6Hx/.NDP.Jg Jm/NXHx/.NP.Jm.HxB/Nj `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NτPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NϪ N^NuNV/. Hy@t/.NϪ N^NuNHx6N@eNuNVH0J[f8 <[#[ <[#[#[[$#[[ .^rNҮ.*y[ B[, g`(*(U g " Ҁe " Ҁd(M *@b[$f[gB`R[, [,o "<NҴ#[,BNfX(@ 9[," Ҁe 9[,/NfX(@g y[$ 9[$Xg y[$  9[," ҀY(#[$ <[ A ` " Ҁ#[ [ c A#[( A 9[ *A L0N^NuNVH0*n(MY#[ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNҮ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ [( L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL%s< a/dev/consolew syslog: cannot open %s (errno %d) File %s errno %d cannot be opened. File %s pmask %d mark %d tty %d syslog restart /etc/utmp/dev/12345678Drop user, mode=%o Broadcast message from System at ... domark --- MARK --- M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec@(#)raddr.c 4.5 82/12/19/etc/hostsr/etc/hosts# /etc/hosts.localr@(#)syslog.c 2.15 12/16/82 %d error %dsyslog: send%ssyslogudpsyslog: socket/bindsyslog: can't find serv/host/dev/consolesyslog: Cannot open /dev/consoleloghost/etc/hostsrr# /etc/servicesrr# ,/ Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$[0. 40p%-6>eFQ[enw.$~N$$`pp0\p((f`b%{5<B@R_fqXnw.,L6>Jl$Tdt $ Pp)3=FFO&YZ`ipw|ltÐÐĬRĴĦz?ļT ʨ`#*Ȭ/7ɮ?dG0PYɶ`4eɾltHx~Ɯ&zʌdɌȼhŨ>J$ ? r&,38N>ɞE6M Tx[(ahpw\xx$.Dd.dẗ́̈́<͒Nͮ<x ΰ3&-4=@F!dMϤUϴ^LeҌm wҌҜ<ҤrҾ<ӘԘԴt~4r0qf $S,1v7fAԺHOW f]7Jen[vԞ| $LBWL ?pF {FtNj 9$  dζ+X"@17=  dINT\6];dll!@tt|pU$3epzO>͢?FҴ 4j,ϴ$  t,4.:flCN$JR[bXkxBP,p{(|T-TZh< x  L L, (s 4  | < C L R ,| \$ iP rQ n f ˠ Ǽ j x    ?p &   , yf  iJ   x [ Ð ļ Y s )| /Q@ 6Rj B* HZT O.D VӘ [͜ bτ hϪ od u7ѐ ~f Ү [0 R crt0.osyslog.o_SccsIdOvfork.octime.oOftime.ofseek.oraddr.orecvfrom.ofprintf.ofprintf.oprintf.oprintf.ordwr.osetuid.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrcpyn.osync.osyslog.osyslog.o_SccsId_SyslogHostbcopy.obcopy.oretbloopbwdbytesbind.obzero.obzero.ogethostbyname.ogethostent.ogetservbyname.ogetservent.oatoi.ofgets.ofilbuf.oinet_addr.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.osendto.osocket.oOsignal.o_exit.ofork.osighandler.osyscall.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_read_atoi_printf_shutdown_ShutDown_wallmsg_logmsg_namecheck_logerror_write_alarm_strcat_sync_DefPri_fprintf_fwrite_wait_recvfrom_setuid_errno_sleep__exit_fflush_ctime_LogFile_Debug_vfork_sprintf_ConfFile_bind_fopen_MarkIntvl_socket_Files_strcpyn_Susers_fstat_fgets_getservbyname_fork_init_SyslogAddr_die_open_stamped_close_perror_strcpy_signal_time_domark_strlen_isatty_fseek_getpid_fclose_raddr_printlinecerror_dysizelmodt_localtimeldivt_ftime_asctime_gmtime_lseek__filbuf_inet_addr_malloc__pfile__print__iob__flsbuf_fread_setjmp_longjmp_pause_LogMask_sys_errlist_LogStat_openlog_syslog_bzero_bcopy_closelog_LogTag_gethostbyname_sys_nerr_sendto_ovbcopy_endhostent_gethostent_sethostent_strcmp_rewind_endservent_getservent_setservent__sibufulmult__ctype_lmult__sigfunc__sighandler_syscall_gettimeofday_fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[:lI -**by/: newsyslog 1.2 83/04/20 cd /usr/spool/log rm syslog.7 mv syslog.6 syslog.7 mv syslog.5 syslog.6 mv syslog.4 syslog.5 mv syslog.3 syslog.4 mv syslog.2 syslog.3 mv syslog.1 syslog.2 mv syslog.0 syslog.1 mv syslog syslog.0 cp /dev/null syslog chmod 666 syslog kill -1 `cat /etc/syslog.pid` b[;lٺ .**by/#!/bin/sh cp /dev/null /fastboot /etc/halt $* b[<lB +*,*,by/3/dev/console 9/usr/spool/log/syslog root b[=lԁ *7*7by0b[>lځ c*_*aby40# Mail changes to termcap@UCBmonet or lose them! sa|arpanet|network:\ :tc=unknown: sb|bussiplexer:\ :tc=unknown: sd|du|dialup:\ :tc=unknown: se|ethernet|network:\ :tc=unknown: sl|lpr|printer|print|printing|line printer:\ :cr=^M:do=^J:nl=^J:bl=^G:le=^H:bs:co#132:hc:os: sp|plugboard|patch|patchboard:\ :tc=unknown: su|dumb|un|unknown:\ :am:bl=^G:co#80:cr=^M:do=^J:nl=^J: sw|switch|intelligent switch:\ :tc=unknown: sx|ansi|any ansi terminal with pessimistic assumptions:\ :co#80:li#24:cl=50\E[;H\E[2J:\ :bs:am:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:ho=\E[H:pt: cR|c108-rv-8p|concept108-rv-8p|concept 108 w/8 pages, in reverse video:\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :\ :tc=c108-8p: c8|c108|c108-8p|concept108-8p|concept 108 w/8 pages:\ :i2=\EU\E z"\Ev^A\177 !p\E ;"\E z \Ev ^A\177p\Ep\n:\ :te=\Ev ^A\177p\Ep\r\n:tc=c108-4p: cT|c108-rv-4p|concept108-rv-4p|concept 108 w/4 pages, in reverse video:\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :\ :tc=c108-4p: cS|c108|c108-4p|concept108-4p|concept 108 w/4 pages:\ :es:hs:\ :ts=\E z"\E?\E^C\Ea %+ :fs=\E z :ds=\E ;\177:\ :i2=\EU\E z"\Ev\177 !p\E ;"\E z \Ev \177p\Ep\n:\ :do=^J:bl=^G:pt:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ti=\EU\Ev 8p\Ep\r:te=\Ev \177p\Ep\r\n:\ :al=\E^R:le=^H:bs:cd=\E^C:ce=\E^S:cl=\E?\E^E:cm=\Ea%+ %+ :co#80:\ :dc=\E^Q:dl=\E^B:ei=\E\200:eo:im=\E^P:li#24:mi:nd=\E=:\ :kb=^h:ul:up=\E;:db:us=\EG:ue=\Eg:vs=\EW:ve=\Ew:am:xn:\ :vb=\Ek\200\200\200\200\200\200\200\200\200\200\200\200\200\200\EK:\ :ks=\EX:ke=\Ex:ku=\E;:kd=\E<:kl=\E>:kr=\E=:kh=\E?:\ :k1=\E5:k2=\E6:k3=\E7:k4=\E8:k5=\E9:k6=\E\72:\ :so=\ED:se=\Ed:mh=\EE:md=\ED:mr=\ED:me=\Ee\Ed\Eg\Ec: cp|c100-rv-pp|c100-rv-4p-pp|concept100-rv-pp|c100 with printer port:\ :is=\EU\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\041\200\EQ"\EY(^W\Eo\47\E\E^G\041\E^HA@ :\ :tc=c100-rv: cr|c100-rv|c100-rv-4p|concept100-rv|c100 rev video:\ :is=\EU\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E^G\041\E^HA@ :\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :so=\EE:se=\Ee:tc=c100: co|c100|concept|c104|c100-4p|concept100|concept 100:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :is=\EU\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E^G\041\E^HA@ :\ :ti=\EU\Ev 8p\Ep\r:te=\Ev \200\200\200\200\200\200\Ep\r\n:\ :al=3*\E^R:am:le=^H:bs:cd=16*\E^C:ce=16\E^U:cl=2*^L:cm=\Ea%+ %+ :co#80:\ :dc=16\E^Q:dl=3*\E^B:ei=\E\200:eo:im=\E^P:ip=16*:li#24:mi:nd=\E=:\ :ta=^I:pt:kb=^h:ta=8\t:ul:up=\E;:db:us=\EG:ue=\Eg:xn:\ :vb=\Ek\200\200\200\200\200\200\200\200\200\200\200\200\200\200\EK:\ :.dN#9:dC#9:pb#9600:vt#8:us=\EG:ue=\Eg:so=\EE\ED:se=\Ed\Ee:\ :mh=\EE:mr=\ED:mb=\EC:mp=\EI:mk=\EH:me=\EN\200:\ :ks=\EX:ke=\Ex:ku=\E;:kd=\E<:kl=\E>:kr=\E=:kh=\E?:k1=\E5:k2=\E6:k3=\E7: v8|tvi925|925|televideo model 925:\ :xn:am:bs:co#80:li#24:cm=\E=%+ %+ :cl=^Z:cd=\EY:ce=\ET:is=\El\E":\ :al=\EE:dl=\ER:im=:ei=:ic=\EQ:dc=\EW:if=/usr/lib/tabset/std:\ :ho=^^:nd=^L:bt=\EI:pt:so=\EG4:se=\EG0:sg#1:us=\EG8:ue=\EG0:ug#1:\ :up=^K:do=^V:kb=^H:ku=^K:kd=^V:kl=^H:kr=^L:kh=^^:ma=^V^J^L :\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:k0=^AI\r:ko=ic,dc,al,dl,cl,ce,cd,bt: Mu|sun|Sun Microsystems Workstation console:\ :li#34:co#80:cl=^L:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :am:bs:km:mi:ms:pt:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:\ :kd=\E[B:kl=\E[D:ku=\E[A:kr=\E[C:kh=\E[H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :al=\E[L:dl=\E[M:im=:ei=:ic=\E[@:dc=\E[P: kg|h19-g|heathkit w/block cursor:\ :ve=\Ex4:tc=h19-b: ke|h19-e|h19e|h19 for emacs:ip=1.5:tc=h19-us: kU|h19-us|heathkit w/keypad shifted/underscore cursor:\ :ks=\Et:ke=\Eu:tc=h19-u: ku|h19-u|heathkit with underscore cursor:\ :vs@:ve@:tc=h19-b: kb|h19|heath|h19-b|heathkit|heath-19|z19|zenith|heathkit h19:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=1*\EL:am:le=^H:bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:dc=\EN:\ :dl=1*\EM:do=\EB:ei=\EO:ho=\EH:im=\E@:li#24:mi:nd=\EC:as=\EF:ae=\EG:\ :ms:ta=^I:pt:sr=\EI:se=\Eq:so=\Ep:up=\EA:vs=\Ex4:ve=\Ey4:\ :kb=^h:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\EH:kn#8:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\ :l6=blue:l7=red:l8=white:k6=\EP:k7=\EQ:k8=\ER:\ :es:hs:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:fs=\Ek\Ey5:ds=\Ey1: hn|2621-nl|hp2621-nl|2621|hp2621|hp 2621 with no labels:\ :ks@:ke@:kh@:ku@:kl@:kr@:kd@:tc=hp2621-fl: h4|hp2645|2645|hp45|hp 264x series:\ :mh=\E&dH:mr=\E&dB:us=\E&dD:mb=\E&dA:me=\E&d@:\ :ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:ks=\E&s1A:ke=\E&s0A:tc=hp: h5|hp|hewlett-packard:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:al=\EL:am:le=^H:bs:\ :cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:cm=6\E&a%r%dc%dY:\ :co#80:cv=\E&a%dY:da:db:dc=\EP:dl=\EM:ei=\ER:im=\EQ:\ :kb=^H:li#24:mi:nd=\EC:ta=^I:pt:se=\E&d@:so=\E&dJ:\ :us=\E&dD:ue=\E&d@:up=\EA:xs:vt#6:pb#9600: MG|bg|bitgraph|BBN BitGraph terminal:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=2*\E[L:bs:cd=150\E[J:ce=2\E[K:cl=150\E[H\E[J:cm=%i\E[%d;%dH:co#85:\ :dl=2*\E[M:k0=\EP:k1=\EQ:k2=\ER:k3=\ES:kd=\EB:ke=\E>:kl=\ED:kr=\EC:\ :ks=\E=:ku=\EA:li#64:nd=\E[C:ns:pt:se=\E[0m:so=\E[7m:up=\E[A:sf=280\n: d0|vt100|vt100-am|vt100|dec vt100:\ :cr=^M:do=^J:nl=^J:bl=^G:co#80:li#24:cl=50\E[;H\E[2J:\ :le=^H:bs:am:cm=5\E[%i%d;%dH:nd=2\E[C:up=2\E[A:\ :ce=3\E[K:cd=50\E[J:so=2\E[7m:se=2\E[m:us=2\E[4m:ue=2\E[m:\ :md=2\E[1m:mr=2\E[7m:mb=2\E[5m:me=2\E[m:is=\E[1;24r\E[24;1H:\ :rf=/usr/lib/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:ta=^I:pt:sr=5\EM:vt#3:xn:\ :sc=\E7:rc=\E8:cs=\E[%i%d;%dr: la|adm3a|3a|lsi adm3a:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cm=\E=%+ %+ :cl=1^Z:co#80:ho=^^:li#24:ma=^K^P:nd=^L:up=^K: l1|adm31|31|lsi adm31:\ :is=\Eu\E0:cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EE:am:le=^H:bs:ce=\ET:cm=\E=%+ %+ :cl=\E*:cd=\EY:\ :co#80:dc=\EW:dl=\ER:ei=\Er:ho=^^:im=\Eq:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:\ :k5=^A5\r:k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:\ :li#24:ma=j^Jk^P^K^Pl ^R^L^L :mi:nd=^L:\ :se=\EG0:so=\EG1:up=^K:us=\EG1:ue=\EG0: l3|adm3|3|lsi adm3:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cl=^Z:li#24:ma=^K^P:co#80: # ------------------------ # # Termcap source file @(#)termcap.src 1.4 (Berkeley) 2/8/83 # Mark Horton, U.C. Berkeley # Kevin Layer, Berkeley # Craig Leres, Berkeley # # This file describes capabilities of various terminals, as needed by # software such as screen editors. It does not attempt to describe # printing terminals very well, nor graphics terminals. Someday. # See termcap(5) in the Unix Programmers Manual for documentation. # # Conventions: First entry is two chars, first char is manufacturer, # second char is canonical name for model or mode. # Third entry is the one the editor will print with "set" command. # Last entry is verbose description. # Others are mnemonic synonyms for the terminal. # # Terminal naming conventions: # Terminal names look like - # Certain abbreviations (e.g. c100 for concept100) are also allowed # for upward compatibility. The part to the left of the dash, if a # dash is present, describes the particular hardware of the terminal. # The part to the right can be used for flags indicating special ROM's, # extra memory, particular terminal modes, or user preferences. # All names are always in lower case, for consistency in typing. # # The following are conventionally used flags: # rv Terminal in reverse video mode (black on white) # 2p Has two pages of memory. Likewise 4p, 8p, etc. # w Wide - in 132 column mode. # pp Has a printer port which is used. # na No arrow keys - termcap ignores arrow keys which are # actually there on the terminal, so the user can use # the arrow keys locally. # # There are some cases where the same name is used for two different # terminals, e.g. "teleray" or "2621" or "vt100". In these cases, # if a site has one of these, they should choose a local default and # bring that terminal to the front in the reorder script. This works # because tgetent picks the first match in /etc/termcap. # The list of names intentionally duplicated is: # 2621, c108, dtc, hp2621, teleray, tvi, vt100. # # If you absolutely MUST check for a specific terminal (this is discouraged) # check for the 2nd entry (the canonical form) since all other codes are # subject to change. The two letter codes are there for version 6 and are # EXTREMELY subject to change, or even to go away if version 6 becomes for # all practical purposes obsolete. We would much rather put in special # capabilities to describe your terminal rather than having you key on the # name. # # Special manufacturer codes: # A: hardcopy daisy wheel terminals # M: Misc. (with only a few terminals) # q: Homemade # s: special (dialup, etc.) # # Comments in this file begin with # - they cannot appear in the middle # of a termcap entry. Individual entries are commented out by # placing a period between the colon and the capability name. # # This file is to be installed with an editor script (reorder) # that moves the most common terminals to the front of the file. # If the source is not available, it can be constructed by sorting # the above entries by the 2 char initial code. # # -------------------------------- # # A: DAISY WHEEL PRINTERS # # The A manufacturer represents Diablo, DTC, Xerox, Qume, and other Daisy # wheel terminals until such time as termcap distinguishes between them # enough to justify separate codes. # This is an "experimental" entry for the SRI Agiles. # It has been tried in a minimal way -- the Agile did not blow up! # However, it has not been exhaustively tested. # Anyone who tries it and finds it wanting should get in touch with: # Ralph Keirstead (ralph@sri-unix); # EK352; SRI International; 333 Ravenswood Avenue; Menlo Park, CA 94025 Aa|agile|agiles|sri agiles:\ :bs:hc:os:pl:co#132:\ :bl=^G:bc=^H:ta=^I:do=^J:nl=^J:cr=^M:kb=^H:up=\E\n:\ :hu=\E0:hd=\E9:if=/usr/lib/tabset/std:is=\EE\EF\EJ: A6|1620|1640|450|diablo 1620:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :ct=\E2:st=\E1:ch=\E\t%i%.:\ :kb=^H:le=^H:bs:co#132:ff=^L:hc:hu=\EU:hd=\ED:os:ta=^I:pt:up=\E\n: A7|1620-m8|1640-m8|diablo 1620 w/8 column left margin:\ :cr=^M:do=^J:nl=^J:bl=^G:co#124:is=\r \E9:tc=1620: # DTC 382 with VDU. Has no cd so we fake it with ce. Standout works but # won't go away without dynamite. The terminal has tabs, but I'm getting # tired of fighting the braindamage. If no tab is set or the terminal's # in a bad mood, it glitches the screen around all of memory. Note that # return puts a blank ("a return character") in the space the cursor was # at, so we use ^P return (and thus ^P newline for newline). Note also # that if you turn off pt and let Unix expand tabs, curses won't work # (current version) because it doesn't turn off this bit, and cursor # addressing sends a tab for row/column 9. What a losing terminal! I # have been unable to get tabs set in all 96 lines - it always leaves at # least one line with no tabs in it, and once you tab through that line, # it completely weirds out. Ac|dtc|ps|dtc382|382:\ :bl=^G:do=^J:nl=^J:al=^P^Z:am:le=^H:\ :bs:co#80:ce=^P^U:cl=20^P^]:cm=%r^P^Q%.%.:dc=^X:\ :dl=^P^S:ei=^Pi:ho=^P^R:im=^PI:ve=^Pb:vs=^PB:pc=\177:te=20^P^]:\ :li#24:nd=^PR:.se=^P \200:.so=^P \002^PF:us=^P \020:ue=^P \200:\ :up=^P^L:nc:nl=\n:xr:xs:da:db:.pt:cr=^P^M:cd=^P^U^P^S^P^S: Ad|dtc300s|300|300s|dtc|dtc 300s:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :kb=^h:le=^H:bs:co#132:ff=^L:hc:hu=\EH:hd=\Eh:os:ta=^I:pt:up=^Z: Ag|gsi:\ :le=^H:bs:co#132:hc:hd=\Eh:hu=\EH:os:ta=^I:pt:up=^Z:\ :cr=^M:do=^J:nl=^J:bl=^G: # This used to have :pl: - maybe they meant :pt:? Aj|aj830|aj832|aj|anderson jacobson:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:hc:hd=\E9:hu=\E8:os:up=\E7: # From cbosg!ucbvax!pur-ee!cincy!chris Thu Aug 20 09:09:18 1981 # This is incomplete, but it's a start. An|5520|nec|spinwriter|nec 5520|:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :kb=^h:le=^H:bs:co#132:ff=^L:hc:hu=\E]s\E9\E]W:hd=\E]s\n\E]W:\ :os:ta=^I:pt:up=\E9: Aq|qume5|qume|Qume Sprint 5:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :kb=^h:le=^H:bs:co#80:ff=^L:hc:hu=\EH:hd=\Eh:os:ta=^I:pt:up=^Z: # I suspect the xerox1720 is the same as the diablo 1620. Ax|x1720|x1700|1700|x1750|xerox 1720:\ :co#132:le=^H:bs:ff=^L:hc:os:ta=^I:pt:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :ct=\E2:st=\E1: # # -------------------------------- # # C: CONTROL DATA # Ca|cdc456|cdc:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :li#24:co#80:cl=^Y^X:nd=^L:up=^Z:le=^H:bs:\ :cm=\E1%+ %+ :ho=^Y:al=\E\114:dl=\E\112:ce=^V:cd=^X:am: Cc|cdc456tst:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :li#24:co#80:cl=^y^x:le=^H:bs:cm=\E1%+ %+ :am: # # -------------------------------- # # D: DATAMEDIA # D0|dm1520|dm1521|1521|1520|datamedia 1520:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=^K:ce=^]:cl=^L:cm=^^%r%+ %+ :co#80:ho=^Y:\ :ku=^_:kd=^J:kl=^H:kr=^\:kh=^Y:\ :li#24:nd=^\:up=^_:xn:ma=^\ ^_^P^YH:ta=^I:pt: D2|dm2500|datamedia2500|2500|datamedia 2500:\ :do=^J:nl=^J:bl=^G:\ :al=15^P\n^X^]^X^]:le=^H:bs:ce=^W:cl=^^^^\177:cm=^L%r%n%.%.:co#80:\ :dc=10*^P\b^X^]:dl=10*^P^Z^X^]:dm=^P:ed=^X^]:ei=10\377\377^X^]:ho=^B:\ :ic=10*^P^\^X^]:im=^P:li#24:nc:nd=^\:pc=\377:so@=^N:se=^X^]:up=^Z: D3|dm3025|datamedia 3025a:\ :is=\EQ\EU\EV:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=130\EP\n\EQ:le=^H:bs:cd=2\EJ:ce=\EK:cl=2\EM:cm=\EY%r%+ %+ :\ :co#80:dc=6\b:dl=130\EP\EA\EQ:dm=\EP:ed=\EQ:ei=\EQ:ho=\EH:\ :im=\EP:ip=6:li#24:nd=\EC:ta=^I:pt:so=\EOA:se=\EO@:up=\EA: D4|3045|dm3045|datamedia 3045a:\ :is=\EU\EV:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=2\EJ:ce=\EK:cl=2\EM:cm=\EY%r%+ %+ :co#80:\ :dc=6\EB:dm=:ed=:ei=\EP:ho=\EH:ic=:im=\EP:ip=6:\ :k0=\Ey\r:k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:\ :k5=\Et\r:k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:k9=\Ex\r:\ :kh=\EH:ku=\EA:kr=\EC:li#24:nd=\EC:pc=\177:ta=^I:pt:eo:ul:up=\EA:xn: # dt80/1 is a vt100 lookalike, but it doesn't seem to need any padding. D5|dt80|dmdt80|dm80|datamedia dt80/1:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=%i\E[%d;%dH:ho=\E[H:nd=\E[C:sr=\EM:\ :so=\E[7m:se=\E[m:up=\E[A:us=\E[4m:ue=\E[m:tc=vt100: # except in 132 column mode, where it needs a little padding. # This is still less padding than the vt100, and you can always turn on # the ^S/^Q handshaking, so you can use vt100 flavors for things like # reverse video. D6|dt80w|dmdt80w|dm80w|datamedia dt80/1 in 132 char mode:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :cd=20\E[0J:co#132:ce=20\E[0K:\ :cm=5\E[%i%d;%dH:cl=50\E[H\E[2J:up=5\E[A:tc=dmdt80: # # -------------------------------- # # H: HAZELTINE # # Since nd is blank, when you want to erase something you # are out of luck. You will have to do ^L's a lot to # redraw the screen. h1000 is untested. It doesn't work in # vi - this terminal is too dumb for even vi. (The code is # there but it isn't debugged for this case.) H1|h1000|hazeltine 1000:\ :le=^H:bs:ho=^K:cl=^L:nd= :co#80:li#12:\ :cr=^M:do=^J:nl=^J:bl=^G: # Note: the h1552 appears to be the first Hazeltine terminal which # is not braindamaged. It has tildes and backprimes and everything! # Be sure the auto lf/cr switch is set to cr. H2|h1552|hazeltine 1552:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EE:dl=\EO:k1=\EP:l1=blue:k2=\EQ:l2=red:k3=\ER:l3=green:tc=vt52: H3|h1552rv|hazeltine 1552 reverse video:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :so=\ES:se=\ET:tc=h1552: # From cbosg!ucbvax!pur-ee!cincy!chris Thu Aug 20 09:09:18 1981 H4|h1420|hazeltine 1420:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:am:li#24:co#80:al=\E^Z:dl=\E^S:cd=\E^X:cl=\E\034:\ :up=\E^L:nd=^P:ce=\E^O:ta=^N:cm=\E^Q%r%.%+ :so=\E\037:se=\E^Y: H5|h1500|hazeltine 1500:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=40~^Z:am:le=^H:bs:cd=10~^X:ce=~^O:cl=~^\:cm=~^Q%r%.%.:co#80:\ :dl=40~^S:do=~^K:li#24:nd=^P:.se=~^_:.so=~^Y:up=~^L: # h1510 assumed to be in sane escape mode. Else use h1500. H6|h1510|hazeltine 1510:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\E^Z:am:le=^H:bs:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E^Q%r%.%.:co#80:\ :dl=\E^S:do=\E^K:li#24:nd=^P:.se=\E^_:.so=\E^Y:up=\E^L: H8|h1520|hazeltine 1520:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=~^Z:am:le=^H:bs:cd=~^X:ce=~^O:cl=~\034:cm=~^Q%r%.%.\200:co#80:\ :dl=~^S:do=~^K:hz:li#24:nd=^P:se=~^Y:so=~\037:up=~^L:ho=~^R: # Note: h2000 won't work well because of a clash between upper case and ~'s. H7|h2000|hazeltine 2000:\ :do=^J:nl=^J:bl=^G:\ :al=6~^z:am:le=^H:bs:cl=6~^\:cm=~^q%r%.%.:co#74:\ :dl=6~^s:ho=~^r:li#27:nc:pc=\177: # Hazeltine esprit entries from Univ of Utah Tue Feb 1 06:39:37 1983 # J.Lepreau, lepreau@utah-cs, harpo!utah-cs!lepreau HE|esprit|hazeltine esprit:\ :al=40\E^Z:bs:cd=5\E^X:ce=\E^O:cl=\E^\:cm=\E^Q%r%>^^ %+`%+`:co#80:\ :dl=40\E^S:do=\E^K:ho=\E^R:li#24:nd=^P:se=\E^Y:so=\E^_:up=\E^L: HF|esprit-am|hazeltine esprit auto-margin:\ :am:tc=esprit: # # -------------------------------- # # I: IBM, INTERACTIVE SYSTEMS, and INTECOLOR # # Some of these should go in the misc category, IBM, ISC, and ISC can't # all have I. I will wait to see who comes out with more terminals. # These compucolors appear similar, but they at least have different # sized screens. I don't know what's going on here. I8|8001|ISC8001|compucolor|intecolor:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EU:am:le=^Z:bc=^Z:cl=3*^L:cm=^C%r%.%.:co#80:cd=\EQ:dm=\EQ:ed=\EF:\ :dc=\177:dl=\EV:ei=\EF:im=\EQ:li#40:nd=1^Y:ta=8\t:up=^\:ho=1^H:pc=^@: IG|compucolor2|compucolorII:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :ta=^I:pt:am:cm=%r^C%.%.:le=^Z:bc=^Z:li#32:co#64:\ :cl=^L:ho=^H:nd=^Y:up=^\: # From cithep!eric Wed Sep 16 08:06:44 1981 It|intext|Interactive Systems Corporation modified owl 1200:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=5.5*\020:am:le=^_:bc=^_:le=^H:bs:bt=^Y:cd=5.5*\026J:ce=^K\160^R:\ :cl=132\014:cm=\017%+ %+ :co#80:dc=5.5*\022:dl=5.5*\021:\ :ei=\026\074:im=\026\073:ip=5.5*:li#24:nd=\036:ta=^I:pt:up=\034:\ :se=^V# :sg#1:so=^V$,:ma=^K^P^R^L^L :\ :kl=^_:kd=^J:kr=^^:ku=\034:kb=^H:kh=^Z:\ :k1=^VA\r:k2=^VB\r:k3=^VC\r:k4=^VD\r:k5=^VE\r:\ :k6=^VF\r:k7=^VG\r:k8=^VH\r:k9=^VI\r:k0=^VJ\r: I9|ibm|ibm3101|3101|i3101|IBM 3101-10:\ :cr=^M:do=^J:nl=^J:bl=^G:ct=\EH:st=\E0:\ :am:le=^H:bs:cl=\EK:li#24:co#80:nd=\EC:up=\EA:cd=\EJ:ce=\EI:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:ho=\EH:cm=\EY%+\40%+\40:ta=^I:pt: # # -------------------------------- # # M: MISCELLANEOUS TERMINALS # # The tab 132 uses xon/xoff, so no padding needed. # ks/ke have nothing to do with arrow keys. # is sets 80 col mode, normal video, autowrap on (for am). # Seems to be no way to get rid of status line. M1|tab132|tab|tab132/15|tab 132/15:\ :is=\E[?7h\E[?3l\E[?5l:dN@:ks@:ke@:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :da:db:al=\E[L:dl=\E[M:dc=\E[P:ei=\E[4l:im=\E[4h:cm=\E[%i%d;%dH:\ :ku=\E[A:kd=\E[B:kl=\E[D:tc=vt100: M2|tab132w:\ :co#132:is=\E[?7h\E[?3h\E[?5l:tc=tab132: M3|tab132rv:\ :is=\E[?7h\E[?3l\E[?5h:tc=tab132: M4|tab132wrv:\ :is=\E[?7h\E[?3h\E[?5h:tc=tab132w: # This used to say "de#001202" which presumably refers to the stty bits # that need to be set for some version of Unix. We need the real delay # requirements in MS. M5|mw2|Multiwriter 2:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#132:hc:os: M6|trs80|trs-80|radio shack trs-80 Model I:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:co#64:li#16: M7|d800|Direct 800/A:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#80:li#24:am:cl=\E[1;1H\E[2J:le=^H:bs:cm=\E[%i%d;%dH:\ :nd=\E[C:up=\E[A:ce=\E[K:cd=\E[J:\ :if=/dskb/rcd/.dinit:\ :so=\E[7m:se=\E[0m:us=\E[4m:ue=\E[0m:xs:vs=\E[>12l:ve=\E[>12h:\ :sf=\ED:sr=\EM:da:db:as=\E[1m:ae=\E[0m:ms:ta=^I:pt:\ :kl=\E[D:kr=\E[C:ku=\E[A:kd=\E[B:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW: M8|vc404|volker-craig 404:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=40^W:ce=20^V:cl=40^X:cm=^P%+ %+ :co#80:ho=40^Y:\ :kd=^J:kl=^H:kr=^U:ku=^Z:li#24:ma=^Z^P^U :nd=^U:up=^Z: M9|vc404-s|volker-craig 404 w/standout mode:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :se=^O:so=^N:tc=vc404: MA|vc404-na|volker-craig 404 w/no arrow keys:\ :ma@:kr@:ku@:tc=vc404: MB|vc404-s-na|volker-craig 404 w/standout mode and no arrow keys:\ :se=^O:so=^N:tc=vc404na: # missing in vc303a and vc303 descriptions: they scroll 2 lines at a time MC|vc303a|vc403a|volker-craig 303a:\ :cr=^M:do=^J:bl=^G:\ :am:le=^H:bs:ce=20^V:cl=40^X:co#80:ho=40^Y:kd=^J:kl=^H::kr=^U:\ :ku=^Z:li#24:ll=^P^@W:nd=^U:ns:up=^Z: MD|vc303|vc103|vc203|volker-craig 303:\ :cr=^M:do=^J:bl=^G:\ :am:le=^H:bs:cl=40^L:co#80:ho=40^K:kd=^J:kl=^H:kr=^I:ku=^N:li#24:\ :ll=^O\200W:nd=^I:ns:up=^N: # From cbosg!ucbvax!SRC:george Fri Sep 11 22:38:32 1981 ME|ampex|d80|dialogue|dialogue80|ampex dialogue 80:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :is=\EA:us=\El:ue=\Em:\ :am:le=^H:bs:ta=^I:pt:cl=75\E*:cm=\E=%+ %+ :\ :al=5*\EE:bt=\EI:ic=\EQ:im=:ei=:dl=5*\ER:dc=\EW:\ :ce=\Et:cd=\Ey:so=\Ej:se=\Ek:li#24:co#80:nd=^L:up=^K: # Test version for Falco ts-1. See "arpavax.hickman@ucb" for info MF|falco|ts1|ts-1|falco ts-1:is=\Eu\E3:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EE:am:bs:ce=\ET\EG0^h:cm=\E=%+ %+ :cl=\E*:cd=\EY:co#80:dc=\EW:\ :dl=\ER:ei=\Er:ho=^^:im=\Eq:k0=^A0\r:kd=^J:kl=^H:pt:\ :kr=^L:ku=^K:li#24:nd=^L:se=\Eg0:so=\Eg1:up=^K:us=\Eg1:ue=\Eg0: MF|falco-p|falco ts-1sp|falco with paging option:\ :is=\EZ\E3\E_c:\ :al=\EE:am:bs:ce=\ET\EG0^H\Eg0:cl=\E*:cd=\EY:co#80:dc=\EW:\ :dl=\ER:kd=\E[B:kl=\E[D:ei=\Er:im=\Eq:pt:db:\ :kr=\E[C:ku=\E[A:li#24:nd=\E[C:se=\Eg0:so=\Eg4:\ :up=\E[A:us=\Eg1:ti=\E_d:te=\E_b:\ :ue=\Eg0:do=\E[B:cm=\E=%+ %+ :ms:ul:kh=\E[H:da:mi:bt=\EI: #NOTE: bg can scroll, it just would rather not (ns) - rwells 3/13/81. # (Shouldn't you take out ns and put in an nl instead? - mrh) MH|d132|datagraphix|datagraphix 132a:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#80:li#30:cl=^l:ho=\Et:da:db:sf=\Ev:sr=\Ew:\ :up=\Ek:nd=\El:vs=\ex:ve=\Em\En:\ :al=\E3:ic=\E5:dc=\E6:in:ic=\E5: MI|soroc|Soroc 120:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :cd=\EY:ce=\ET:cl=2\E*:ma=^K^P^R^L^L :\ :kl=^H:ku=^K:kr=^L:kd=^J:tc=adm3a: # tec is untested, and taken from CB/Unix virtual terminal driver. # Upper case terminal, uses lower case for control sequences!!! # The driver shows the C ~ operator used on CM coordinates. # Without the terminal in front of me, I can't figure out what's # going on, so I've dotted out the cm. Note there is no ~ in tgoto. MJ|tec400|tec scope:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :.cm=l%r%.%.:up=x:do=h:nd=g:le=w:ho=i:so={:se=|:sg#1:\ :cl=f:al=e:dl=u:ic=d:dc=t:ce=c:cd=s: # From ucbvax!geoff Mon Sep 21 21:15:45 1981 # This entry has been tested. MK|tec500|tec 500:\ :cr=^M:do=^J:nl=^J:bl=^G:am:le=^H:bs:cm=\E=%+ %+ :cl=20^Z:\ :co#80:ho=^^:li#24:nd=^L:up=^K:so=^]:se=^\: # I would appreciate more information on this terminal, such as the # manufacturer and the model number. There is too many tecs in here. ML|tec:\ :li#24:co#80:cl=^l:up=^k:nd=\037:am:le=^H:bs:ho=\036:ma=^K^P^_ :\ :cr=^M:do=^J:nl=^J:bl=^G: MM|teletec|tec|Teletec Datascreen:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:co#80:cl=^l:ho=^^:li#24:nd=^_:up=^k: MP|digilog|333|digilog 333:\ :le=^H:bs:co#80:ce=\030:ho=^n:li#16:nd=^i:up=^o:\ :cr=^M:do=^J:nl=^J:bl=^G: MQ|ep48|ep4080|execuport 4080:\ :am:le=^H:bs:os:co#80:hu=\036:hd=\034:\ :cr=^M:do=^J:nl=^J:bl=^G: MR|ep40|ep4000|execuport 4000:\ :am:le=^H:bs:os:co#136:hu=\036:hd=\034:\ :cr=^M:do=^J:nl=^J:bl=^G: MS|terminet1200|terminet300|tn1200|tn300|terminet|GE terminet 1200:\ :co#120:hc:os:\ :cr=^M:do=^J:nl=^J:bl=^G: # AED 512 # by giles Billingsley (ucbcad.gilesb@berkeley) # rewritten 8/82 for newer AEDs and better operation of vi,etc. MT|aed|AED|aed512|AED512|aed 512:\ :db:co#64:li#40:cl=^L:\ :bs:nd=\Ei0800\001:\ :up=^K:ve=\E\E\E\E\E\E\E\072004=000200??\001:\ :vb=\EK0001??0000K0001202080\001:\ :us=\E\07200>8000140\001:ue=\E\07200>8000100\001:\ :uc=\Ei???>l0800i0102\001:\ :ti=\E\07200>8000140{<04<0??00001010L<0\072004=0002??00\001:\ :te=\E\07200>8000100{804<0??00001000L80\072004=000200??\001:\ :so=\E\07200>8000140[80C00\001:se=\E[00C80\001:\ :is=\EG1MMM.`40K0001202080K8001????00^L\EC80L80{80^L\EK010100????K0601??0000c818100\EG1HHH.\07210000019A27FD006A280D002A200A52429FE8524861086118612861360N031B4C3F3F1800N041B0C1B4C38301800N001B3B313030301800N011B3B313030341800N021B3B313030381800N050800N061B3B313335301800\07211000015A58E8D5011A58F8D5111A5908D5211A5918D531160\07212000015AD5011858EAD5111858FAD52118590AD5311859160\0721300004B2071C5858E0A18658E0A0A858EA900858F268FA5278590A50A29018591A9F51865908590A90165918591A59038E58E8590A591E58F290185912071C5180A0A0A0901858EA900858F268F60\0721350000BA9472031DEA9502031DE60\E\E\E\EG1MMM.^A: # CIT 80 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. Ma|cit80|cit 80|Citoh 80:\ :co#80:li#24:am:cl=\E[;H\EJ:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\EK:cd=\EJ:\ :is=\E>:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD: # AlternateCIT 101 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. # Uses 23 lines so can run citsys (like h19sys). Ma|citc|cit 101|Citoh fast vt100:\ :co#80:li#23:am:cl=\E[;H\E[2J:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l:\ :dc=\E[P:al=\E[L:im=:ei=:dl=\E[M:ic=\E[@: # AlternateCIT 101 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. # Uses 23 lines so can run citsys (like h19sys). Ma|cita|cit 101|Citoh fast vt100:\ :co#80:li#23:am:cl=\E[;H\E[2J:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l: # CIT 101 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. Ma|cit101|cit 101|Citoh fast vt100:\ :co#80:li#24:am:cl=\E[;H\E[2J:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD: # CIT 101 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. (modified to remove bell?not working)...rex Ma|cit101b|cit 101b|Citoh fast vt100:\ :co#80:li#24:am:cl=\E[;H\E[2J:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l: # Note several versions of blit. I don't know exactly what is what # so please send me any corrections to this -- mrh # From research!ikeya!rob Tue Aug 31 23:41 EDT 1982 Mb|blit|jerq|blit-pb|blit running teletype rom:\ :cr=^M:do=^J:nl=^J:bl=^G:ta=^I:\ :IC=\Ef%+ :DC=\Ee%+ :AL=\EF%+ :DL=\EE%+ :\ :mi:dl=\EE!:ic=\Ef!:dc=\Ee!:al=\EF!:\ :ce=\EK:cl=^L:cm=\EY%r%+ %+ :co#87:li#72:nd=\EC:\ :up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:kb=^H:am:ul:pt:eo: Mb|cbblit|columbus enhanced tty blit:\ :vb=\E^G:so=\EU!:se=\EV!:us=\EU":ue=\EV":cd=\EJ:\ :im=\EQ:ei=\ER:ic@:co#88:sf=\EG:tc=blit: Mb|oblit|ojerq|first version of blit rom:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :AL=\Ef%+ :DL=\Ee%+ :mi:dl=\EE:ei=\ER:im=\EQ:dc=\EO:da:db:\ :al=\EF:cd=\EJ:ce=\EK:cl=^L:cm=\EY%r%+ %+ :co#88:li#72:nd=\EC:\ :up=\EA:vb=\E^G:am:ul:pt:eo: Mb|daleblit|daleterm|blit running Dale DeJager's ROM:\ :ku=\EA:kd=\EB:kr=\EC:kl=\ED:so=\EU!:se=\EV!:us=\EU":ue=\EV":\ :da@:db@:tc=oblit: Md|datapoint|dp3|dp3360|datapoint 3360:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=^_:ce=^^:cl=^]^_:co#82:ho=^]:li#25:nd=^x:up=^z: # From ucbvax!faletti (Faletti@Berkeley) # FREEDOM 100 by Liberty Electronics USA, SF. # :kh=^^: left out because it precludes using change-to-alternate-file in vi. # Basic Freedom 100 entry, works with VI at 1200 baud. Mf|f100|freedom100|freedom|freedom 100 no padding:\ :am:bs:bw:mi:ms:pt:co#80:kn#20:li#24:\ :ct=\E3:st=\E1:is=\Eg\Ef\r\Ed:\ :kr=^L:\ :bl=^G:cl=^Z:cr=^M:do=^J:ho=^^:kb=^H:kl=^H:\:kd=^V:\ :ko=dc,al,dl,cl,bt,ce,cd:ku=^K:le=^H:nd=^L:nl=^J:\ :ch=\E]%+ :cm=\E=%+ %+ :cv=\E[%+ :sr=\Ej:ta=^I:up=^K:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:dc=\EW:dl=\ER:ei=\Er:im=\Eq:\ :se=\EG0:so=\EG4:ue=\EG0:us=\EG8:as=\E$:ae=\E%:\ :vb=\Eb\200\200\Ed:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k0=^AI\r:\ :hs:ts=\Eg\Ef:fs=\r:ds=\Eg\Ef\r: Mf|f100-rv|freedom100-rv|freedom-rv|freedom100 with reverse video at 1200:\ :is=\Eg\Ef\r\Eb:vb=\Ed\200\200\Eb:\ :tc=freedom100: # VI at 9600 baud (or EMACS at 1200 -- but may be more than is needed for emacs) Mf|f100-v|freedom100-v|freedom-v|freedom100 for 9600 vi or 1200 emacs:\ :al=6.5*\EE:dl=11.5*\ER:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=freedom100: Mf|f100-v-rv|freedom100-v-rv|freedom-v-rv|freedom100 rev. vid. for 9600 vi:\ :al=6.5*\EE:dl=11.5*\ER:\ :is=\Eg\Ef\r\Eb:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=freedom100: # EMACS at 9600 baud -- this still needs some more work on the padding Mf|f100-e|freedom100-e|freedom-e|freedom100 for 9600 emacs:\ :al=8.5*\EE:dl=11.5*\ER:ip=6:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=freedom100: Mf|f100-e-rv|freedom100-e-rv|freedom-e-rv|freedom100 rev. vid. for emacs 9600:\ :al=8.5*\EE:dl=11.5*\ER:ip=6:\ :is=\Eg\Ef\r\Eb:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=freedom100: Mg|dg|dg6053|data general 6053:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cm=^P%r%.%.:cl=^L:ho=^H:nd=^S:\ :up=^W:ce=^K:co#80:li#24: Mi|cdi|cdi1203:\ :am:le=^H:bs:hc:os:co#80:dC#200:\ :cr=^M:do=^J:nl=^J:bl=^G: # ^S is an arrow key! Boy is this guy in for a surprise on v7! Ml|sol:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cm=\E^1%.\E^2%.:cl=^K:ho=^N:co#64:li#16:nd=^S:up=^W:\ :kl=^A:kr=^S:ku=^W:kd=^Z:ma=^A^H^S ^W^P^Z^N: Mn|xl83|Cybernex XL-83:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=62^P:ce=3^O:cl=62^L:cm=^W%+ %+ :co#80:ho=^K:\ :kd=^J:kl=^H:ku=^N:li#24:up=^N:nd=^I: Mo|omron|Omron 8025AG:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EL:am:le=^H:bs:cd=\ER:co#80:ce=\EK:cl=\EJ:da:db:dc=\EP:dl=\EM:\ :ho=\EH:li#24:nd=\EC:se=\E4:sf=\ES:so=\Ef:sr=\ET:up=\EA:ve=:vs=\EN: Mp|plasma|plasma panel:\ :am:le=^H:bs:cl=^L:co#85:ho=^^:li#45:nd=\030:up=\026:\ :cr=^M:do=^J:nl=^J:bl=^G: Mr|remote|virtual remote terminal:\ :co#79:am@:nl@:tc=virtual: Ms|swtp|ct82|southwest technical products ct82:\ :cr=^M:do=^J:nl=^J:bl=^G:am:le=^d:bc=^d:\ :al=^\^y:cd=^v:ce=^F:cl=^L:cm=%r^k%.%.:co#82:li#20:\ :dl=^z:nd=^s:up=^a:so=^^^v:se=^^^F:dc=^\^h:ic=^\^x:ho=^p:\ :ei=:sf=^n:sr=^o:ll=^c:im=:\ :is=^\^r^^^s^^^d^]^w^i^s^^^]^^^o^]^w^r^i: Mt|terak|Terak emulating Datamedia 1520:\ :tc=dm1520: # Sun Microsystems (Inc.) Workstation console # the MT termcap capabilities do not work very well # on the sun. Right now, the first entry works best. #what does the :MT: do? Taking it out seems to have fixed the sun entry. Mu|origsun|sun:\ :am:bs:mi:MT:ms:pt:\ :li#34:co#80:\ :cl=^L:\ :cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:\ :kd=\E[B:kl=\E[D:ku=\E[A:kr=\E[C:kh=\E[H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :al=\E[L:dl=\E[M:im=:ei=:ic=\E[@:dc=\E[P: #end SUN Mv|virtual|VIRTUAL|cb unix virtual terminal:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#80:li#24:am:cl=\E\112:le=^H:bs:cm=\E\107%r%.%.:nd=\E\103:\ :up=\E\101:ce=\E\113:cd=\E\114:al=\E\120:dl=\E\116:im=:ei=:ic=\E\117:\ :da:db:kl=\E\104:kr=\E\103:ku=\E\101:kd=\E\102:kh=\E\105:\ :so=\E\141\004:se=\E\142\004:us=\E\141\001:ue=\E\142\001: My|pty|psuedo teletype:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#80:li#24:am:cl=\EJ:le=^H:bs:cm=\EG%+ %+ :nd=\EC:\ :up=\EA:ce=\EK:cd=\EL:al=\EP:dl=\EN:ic=\EO:\ :so=\Ea$:se=\Eb$:us=\Ea!:ue=\Eb!: Mw|it2|intertube2|intertec data systems intertube 2:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:bs:cl=^L:co#80:ho=^A:li#25:up=^Z:ce=\EK:\ :cm=^N%+ %+ :ch=^P%\102%.:cv=^K%.:nd=^F:do=\n:ll=^K^X\r:\ :so=\E0P:se=\E0@: Mx|delta|dd5000|delta data 5000:\ :do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cl=^NR:cm=^O%\068%+9%\068%+9:co#80:li#27:ho=^NQ:nc:nd=^Y:\ :up=^Z:ce=^NU:dc=^NV:ma=^K^J^Z^P^Y :xr: My|mdl110|cybernex mdl-110:\ :cm=^P%+ %+ :co#80:li#24:am:cl=70^X:le=^H:bs:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :nd=^U:up=^Z:ho=^Y:ce=145^N@^V:cd=145^NA^W:al=65^NA^N^]:\ :dl=40^NA^N^^:im=:\ :ei=:ic=3.5^NA^]:dm=:ed=:dc=3.5^NA^^:so=^NF:se=^NG:ta=43\t:\ :ma=^Z^P:cd=6^N@^V Mz|zen30|z30|zentec 30:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :mi:co#80:li#24:ma=^L ^R^L^K^P:ul:\ :al=1.5*\EE:le=^H:bs:ce=1.0*\ET:cm=\E=%+ %+ :cl=\E*:\ :ho=^^:nd=^L:se=\EG0:so=\EG6:up=^K:im=\Eq:ei=\Er:\ :am:dc=\EW:dl=1.5*\ER:cd=\EY: # # -------------------------------- # # N: ANN ARBOR # N4|aa|annarbor|4080|ann arbor 4080:\ :cr=^M:do=^J:nl=^J:bl=^G:pt:ct=^\^P^P:st=^]^P1:\ :cm=^O%r%\066%.%>^S^L%+@:\ :co#80:li#40:le=^H:bs:cl=2^L:up=^N:nd=^_:ho=^K:am:\ :kb=^^:kd=^J:ku=^N:kl=^H:kr=^_:kh=^K:ma=^_ ^N^P: # Needs function keys added. # Originally from Mike O'Brien@Rand and Howard Katseff at Bell Labs. # Highly modified 6/22 by Mike O'Brien. # split out into several for the various screen sizes by dave-yost@rand # Modifications made 3/82 by Mark Horton # Modified by Tom Quarles at UCB for greater efficiency and more diversity # status line moved to top of screen, vb removed 5/82 # # assumes the following setup: # A: 0000 1010 0001 0000 # B: 9600 0100 1000 0000 0000 1000 0000 17 19 # C: 56 66 0 0 9600 0110 1100 # D: 0110 1001 1 0 # # Briefly, the settings are for the following modes: # (values are for bit set/clear with * indicating our preference # and the value used to test these termcaps) # Note that many of these settings are irelevent to the termcap # and are just set to the default mode of the terminal as shipped # by the factory. # # A menu: 0000 1010 0001 0000 # Block/underline cursor* # blinking/nonblinking cursor* # key click/no key click* # bell/no bell at column 72* # # key pad is cursor control*/key pad is numeric # return and line feed/return for key * # repeat after .5 sec*/no repeat # repeat at 25/15 chars per sec. * # # hold data until pause pressed/process data unless pause pressed* # slow scroll/no slow scroll* # Hold in area/don't hold in area* # functions keys have default*/function keys disabled on powerup # # show/don't show position of cursor during page transmit* # unused # unused # unused # # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # Baud rate (9600*) # # 2 bits of parity - 00=odd,01=even*,10=space,11=mark # 1 stop bit*/2 stop bits # parity error detection off*/on # # keyboard local/on line* # half/full duplex* # disable/do not disable keyboard after data transmission* # # transmit entire page/stop transmission at cursor* # transfer/do not transfer protected characters* # transmit all characters/transmit only selected characters* # transmit all selected areas/transmit only 1 selected area* # # transmit/do not transmit line seperators to host* # transmit/do not transmit page tab stops tabs to host* # transmit/do not transmit column tab stop tabs to host* # transmit/do not transmit graphics control (underline,inverse..)* # # enable*/disable auto XON/XOFF control # require/do not require receipt of a DC1 from host after each LF* # pause key acts as a meta key/pause key is pause* # unused # # unused # unused # unused # unused # # XON character (17*) # XOFF character (19*) # # C menu: 56 66 0 0 9600 0110 1100 # number of lines to print data on (printer) (56*) # # number of lines on a sheet of paper (printer) (66*) # # left margin (printer) (0*) # # number of pad chars on new line to printer (0*) # # printer baud rate (9600*) # # printer parity: 00=odd,01=even*,10=space,11=mark # printer stop bits: 2*/1 # print/do not print guarded areas* # # new line is: 01=LF,10=CR,11=CRLF* # unused # unused # # D menu: 0110 1001 1 0 # LF is newline/LF is down one line, same column* # wrap to preceeding line if move left from col 1*/don't wrap # wrap to next line if move right from col 80*/don't wrap # backspace is/is not destructive* # # display*/ignore DEL character # display will not/will scroll* # page/column tab stops* # erase everything*/erase unprotected only # # editing extent: 0=display,1=line*,2=field,3=area # # unused # N0|aaa-29-np|aaa-29 with no padding (for psl):\ :al=\E[L:ce=\E[K:cl=\E[H\E[J:\ :dc=\E[P:dl=\E[M:ic=\E[@:tc=aaa-29: NA|aaa-unk|ann arbor ambassador (internal - don't use this directly):\ :cr=^M:do=^J:nl=^J:bl=^G:al=3\E[L:am:le=^H:bs:\ :cd=\E[J:ce=5\E[K:cl=156\E[H\E[J:cm=\E[%i%d;%dH:co#80:\ :dc=4\E[P:dl=3\E[M:ho=\E[H:ic=4\E[@:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:mk=\E[8m:me=\E[m:\ :ku=\EM:kd=\ED:kl=\E[D:kr=\E[C:kh=\E[H:ko=cl,dc,dl,ce,cd:\ :ks=\EP`?z~[H~[[J`>z~[[J`8xz~[M`4xz~[[D`6xz~[[C`2xz~[D\E\\:\ :ke=\EP`?y~[H~[[J`>y~[[2J`8xy~[M`4xy~[[D`6xy~[[C`2xy~[D\E\\:\ :ch=\E[%i%d`:\ :ul:ei=:im=:pt:bw:bt=\E[Z:\ :mi:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:up=\EM: NB|aaa-18|ann arbor ambassador/18 lines:\ :ti=\E[2J\E[18;0;0;18p:te=\E[60;0;0;18p\E[18;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#18:tc=aaa-unk: NC|aaa-20|ann arbor ambassador/20 lines:\ :ti=\E[2J\E[20;0;0;20p:te=\E[60;0;0;20p\E[20;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#20:tc=aaa-unk: ND|aaa-22|ann arbor ambassador/22 lines:\ :ti=\E[2J\E[22;0;0;22p:te=\E[60;0;0;22p\E[22;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#22:tc=aaa-unk: NE|aaa-24|ann arbor ambassador/24 lines:\ :ti=\E[2J\E[24;0;0;24p:te=\E[60;0;0;24p\E[24;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#24:tc=aaa-unk: NF|aaa-26|ann arbor ambassador/26 lines:\ :ti=\E[2J\E[26;0;0;26p:te=\E[60;0;0;26p\E[26;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#26:tc=aaa-unk: NG|aaa-28|ann arbor ambassador/28 lines:\ :ti=\E[2J\E[28;0;0;28p:te=\E[60;0;0;28p\E[28;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#28:tc=aaa-unk: NH|aaa|aaa-30|ambas|ambassador|ann arbor ambassador/30 lines:\ :ti=\E[2J\E[30;0;0;30p:te=\E[60;0;0;30p\E[30;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#30:tc=aaa-unk: NI|aaa-36|ann arbor ambassador/36 lines:\ :ti=\E[2J\E[36;0;0;36p:te=\E[60;0;0;36p\E[36;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#36:tc=aaa-unk: NJ|aaa-40|ann arbor ambassador/40 lines:\ :ti=\E[2J\E[40;0;0;40p:te=\E[60;0;0;40p\E[40;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#40:tc=aaa-unk: NK|aaa-48|ann arbor ambassador/48 lines:\ :ti=\E[2J\E[48;0;0;48p:te=\E[60;0;0;48p\E[48;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#48:tc=aaa-unk: NL|aaa-60|ann arbor ambassador/60 lines:\ :ti=\E[2J\E[60;0;0;60p:te=\E[60;0;0;60p\E[60;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#60:tc=aaa-unk: NS|aaa-unk-s|ann arbor ambassador unknown with/status:\ :hs:es:i2=\E7\E[>51h\E[H\E[2K\E[>51l\E8:\ :ts=\E7\E[>51h\E[H\E[2K\E[%i%d`:fs=\E[>51l\E8:\ :ds=\E7\E[>51h\E[H\E[2K\E[>51l\E8:\ :tc=aaa-unk: NM|aaa-18-s|ambassador|ann arbor ambassador/18 lines + status line:\ :ti=\E[2J\E[18;1;0;18p:\ :te=\E[60;1;0;18p\E[17;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#17:tc=aaa-unk-s: NN|aaa-20-s|ambassador|ann arbor ambassador/20 lines + status line:\ :ti=\E[2J\E[20;1;0;20p:\ :te=\E[60;1;0;20p\E[19;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#19:tc=aaa-unk-s: NO|aaa-22-s|ambassador|ann arbor ambassador/22 lines + status line:\ :ti=\E[2J\E[22;1;0;22p:\ :te=\E[60;1;0;22p\E[21;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#21:tc=aaa-unk-s: NP|aaa-24-s|ambassador|ann arbor ambassador/24 lines + status line:\ :ti=\E[2J\E[24;1;0;24p:\ :te=\E[60;1;0;24p\E[23;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#23:tc=aaa-unk-s: NQ|aaa-26-s|ambassador|ann arbor ambassador/26 lines + status line:\ :ti=\E[2J\E[26;1;0;26p:\ :te=\E[60;1;0;26p\E[25;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#25:tc=aaa-unk-s: NR|aaa-28-s|ambassador|ann arbor ambassador/28 lines + status line:\ :ti=\E[2J\E[28;1;0;28p:\ :te=\E[60;1;0;28p\E[27;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#27:tc=aaa-unk-s: NT|aaa-30-s|ambassador|ann arbor ambassador/30 lines + status line:\ :ti=\E[2J\E[30;1;0;30p:\ :te=\E[60;1;0;30p\E[29;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#29:tc=aaa-unk-s: NU|aaa-36-s|ambassador|ann arbor ambassador/36 lines + status line:\ :ti=\E[2J\E[36;1;0;36p:\ :te=\E[60;1;0;36p\E[35;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#35:tc=aaa-unk-s: NV|aaa-40-s|ambassador|ann arbor ambassador/40 lines + status line:\ :ti=\E[2J\E[40;1;0;40p:\ :te=\E[60;1;0;40p\E[39;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#39:tc=aaa-unk-s: NW|aaa-48-s|ann arbor ambassador/48 lines+sl:\ :ti=\E[2J\E[48;1;0;48p:te=\E[60;1;0;48p\E[47;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\EP`?y~[[2J~[[H\E7\E[60;1;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#47:tc=aaa-unk-s: NX|aaa-60-s|ambassador|ann arbor ambassador/60 lines + status line:\ :ti=\E[2J\E[60;1;0;60p:te=\E[60;1;0;60p\E[59;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#59:tc=aaa-unk-s: NY|aaa-18-rv|ambassador/18 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-18: NZ|aaa-20-rv|ambassador/20 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-20: Na|aaa-22-rv|ambassador/22 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-22: Nb|aaa-24-rv|ambassador/24 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-24: Nc|aaa-26-rv|ambassador/26 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-26: Nd|aaa-28-rv|ambassador/28 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-28: Ne|aaa-30-rv|ann arbor ambassador/30 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-30: Nf|aaa-36-rv|ann arbor ambassador/36 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-36: Ng|aaa-40-rv|ann arbor ambassador/40 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-40: Nh|aaa-48-rv|ann arbor ambassador/48 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-48: Ni|aaa-60-rv|ann arbor ambassador/60 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-60: Nj|aaa-18-rv-s|aaa-18-s-rv|ambassador/18 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-18-s: Nk|aaa-20-rv-s|aaa-20-s-rv|ambassador/20 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-20-s: Nl|aaa-22-rv-s|aaa-22-s-rv|ambassador/22 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-22-s: Nm|aaa-24-rv-s|aaa-24-s-rv|ambassador/24 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-24-s: Nn|aaa-26-rv-s|aaa-26-s-rv|ambassador/26 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-26-s: No|aaa-28-rv-s|aaa-28-s-rv|ambassador/28 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-28-s: Np|aaa-30-rv-s|aaa-30-s-rv|ambassador/30 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8b[N>lӮ c*_*aby4)a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-30-s: Nq|aaa-36-rv-s|aaa-36-s-rv|ambassador/36 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-36-s: Nr|aaa-40-rv-s|aaa-40-s-rv|ambassador/40 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-40-s: Ns|aaa-48-rv-s|aaa-48-s-rv|ambassador/48 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-48-s: Nt|aaa-60-rv-s|aaa-60-s-rv|ambassador/60 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-60-s: NL|aaa-24-ctxt|ann arbor ambassador/24 lines:\ :ti=\E[30;1H\E[K\E[24;0;0;24p:te=\E[60;1;0;24p\E[60;1H\E[K:tc=aaa-24: NL|aaa-24-rv-ctxt|ann arbor ambassador/24 lines:\ :ti=\E[30;1H\E[K\E[24;0;0;24p:te=\E[60;1;0;24p\E[60;1H\E[K:tc=aaa-24-rv: NL|aaa-30-s-ctxt|ann arbor ambassador/30 lines with status line:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:te=\E[60;1;0;30p\E[59;1H\E[K:tc=aaa-30-s: NL|aaa-30-s-rv-ctxt|aaa-30-rv-s-ctxt|ann arbor ambassador/30 lines with status line:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:te=\E[60;1;0;30p\E[59;1H\E[K:tc=aaa-30-s-rv: NH|aaa-ctxt|aaa-30-ctxt|ann arbor ambassador/30 lines:\ :ti=\E[30;0;0;30p:te=\E[60;0;0;30p\E[60;1H\E[K:tc=aaa-30: NH|aaa-rv-ctxt|aaa-30-rv-ctxt|ann arbor ambassador/30 lines:\ :ti=\E[30;0;0;30p:te=\E[60;0;0;30p\E[60;1H\E[K:tc=aaa-30-rv: Nd|aaa-db|ann arbor ambassador 30/destructive backspace:\ :ti=\E[H\E[J\E[30;0;0;30p:te=\E7\E[60;0;0;30p\E8:li#30:\ :is=\E[60;0;0;30p\E[H\E[J\E[1Q\E[m\E[20l\E[>30h:le=\E[D:bc=\E[D:bs@:\ :tc=aaa-unk: # # # -------------------------------- # # T: TELETYPE # # We need descriptions for the model 40. There are known to be at least three # flavors of the 40, both seem more like IBM half duplex forms fillers than # ASCII terminals. They have lots of awful braindamage, such as printing # a visible newline indicator after each newline. The 40-1 is a half duplex # terminal and is hopeless. The 40-2 is braindamaged but has hope and is # described here. The 40-4 is a 3270 lookalike and beyond hope. # The terminal has visible bell but I don't know it - it's # null here to prevent it from showing the BL character. # There is an \EG in nl because of a bug in vi (if stty says you have # a "newline" style terminal (-crmode) vi figures all it needs is nl # to get crlf, even if cr is not ^M.) T0|40|tty40|ds40|ds40/2|ds40-2|dataspeed40|teletype dataspeed 40/2:\ :cl=160\ER:cd=160\EJ:al=160\EL:dl=160\EM:dc=50\EP:im=:ei=:ic=50\E\^:\ :nd=\EC:up=\E7:bs:cr=\EG:nl=\EG\EB:do=\EB:co#80:li#24:vb=:\ :so=\E3:se=\E4: T3|33|tty33|tty|model 33 teletype:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#72:hc:os: T4|43|tty43|model 43 teletype:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :kb=^h:am:le=^H:bs:hc:os:co#132: T7|37|tty37|model 37 teletype:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:hc:hu=\E8:hd=\E9:up=\E7:os: # From jwb Wed Mar 31 13:25:09 1982 remote from ihuxp # This entry appears to avoid the top line - I have no idea why. TT|4424|tty4424|teletype 4424M:\ :al=\EL:da:db:ip=2:im=:ei=:ic=\E\^:dc=\EP:dl=\EM:\ :co#80:li#23:am:cl=\E[2;H\E[J:bs:cm=\E[%i%2;%2H\E[B:\ :nd=\E[C:up=\E[A:pt:mi:sr=\ET:\ :ce=\E[K:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E[m\E[2;24r:\ :kd=\E[B:kl=\E[D:ku=\E[A:kr=\E[C:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS: # # -------------------------------- # # V: VISUAL # # The Visual 200 beeps when you type a character in insert mode. # This is a horribly obnoxious misfeature, and some of the entries # below try to get around the problem by ignoring the feature or # turning it off when inputting a character. They are said not to # work well at 300 baud. (You could always cut the wire to the bell!) V2|vi200|visual 200 with function keys:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EL:am:le=^H:bs:cd=\Ey:ce=4*\Ex:cl=\Ev:\ :cm=\EY%+ %+ :co#80:dc=4*\EO:dl=4*\EM:ho=\EH:\ :im=:ei=:ic=\Ei \b\Ej:\ :is=\E3\Eb\Ej\E\\\El\EG\Ed\Ek:\ :k0=\EP:k1=\EQ:k2=\ER:k3=\E :k4=\E!:k5=\E":k6=\E#:\ :k7=\E$:k8=\E%:k9=\E&:kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:\ :li#24:nd=\EC:ta=^I:pt:sr=\EI:up=\EA:vs=\Ed:ve=\Ec: VR|vi200-rv-ic|visual 200 reverse video using insert char:\ :ei=\Ej:im=\Ei:ic@:tc=vi200-rv: # The older Visuals didn't come with function keys. This entry uses # ks and ke so that the keypad keys can be used as function keys. # If your version of vi doesn't support function keys you may want # to use V2. Vf|vi200-f|visual|visual 200 no function keys:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\EL:am:le=^H:bs:cd=\Ey:ce=4*\Ex:cl=\Ev:\ :cm=\EY%+ %+ :co#80:dc=4*\EO:dl=4*\EM:ho=\EH:\ :im=:ei=:ic=\Ei \b\Ej:\ :is=\E3\Eb\Ej\E\\\El\EG\Ed\Ek:ks=\E=:ke=\E>:\ :k0=\E?p:k1=\E?q:k2=\E?r:k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:\ :k7=\E?w:k8=\E?x:k9=\E?y:kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:\ :li#24:nd=\EC:ta=^I:pt:sr=\EI:up=\EA:vs=\Ed:ve=\Ec: Vr|vi200-rv|visual 200 reverse video:\ :so=\E4:se=\E3:sr@:vs@:ve@:tc=vi200: Vt|vi200-ic|visual 200 using insert char:\ :ei=\Ej:im=\Ei:ic@:tc=vi200: # # -------------------------------- # # X: TEKTRONIX # Xa|tek|tek4012|4012|tektronix 4012:\ :cr=^M:do=^J:bl=^G:\ :is=\E^O:le=^H:bs:cl=1000\E^L:co#75:ns:li#35:os: Xb|tek4013|4013|tektronix 4013:\ :as=\E^N:ae=\E^O:tc=4012: Xc|tek4014|4014|tektronix 4014:\ :is=\E^O\E9:co#81:li#38:dF#1000:tc=tek4012: Xd|tek4015|4015|tektronix 4015:\ :as=\E^N:ae=\E^O:tc=4014: Xe|tek4014-sm|4014-sm|tektronix 4014 in small font:\ :is=\E^O\E\072:co#121:li#58:tc=tek4014: Xf|tek4015-sm|4015-sm|tektronix 4015 in small font:\ :as=\E^N:ae=\E^O:tc=4014sm: # I think the 1000UP is supposed to be so expensive it never happens. X4|tek4023|4023|tex|tektronix 4023:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :so=^_P:se=^_@:cm=\034%r%+ %+ :nd=\t:le=^H:bs:cl=4\E^L:co#80:li#24:am:\ :up=1000UP:vt#4: # Can't use cursor motion because it's memory relative, and because # it only works in the workspace, not the monitor. Same for home. # Likewise, standout only works in the workspace. # 145 ms padding on al and AL taken out since it doesn't seem to be needed much. X5|4025|4027|4024|tek4025|tek4027|tek4024|4025cu|4027cu|tektronix 4024/4025/4027:\ :cr=^M:sf=^F^J:do=^F^J:bl=^G:\ :is=\41com 31\r\n^_sto 9 17 25 33 41 49 57 65 73\r:\ :ks=^_lea p4 /h/\r^_lea p8 /k/\r^_lea p6 / /\r^_lea p2 /j/\r^_lea f5 /H/\r^_lea p5 /H/\r:\ :ke=^_lea p2\r^_lea p4\r^_lea p6\r^_lea p8\r^_lea p5\r^_lea f5\r:\ :am:le=^H:bs:da:db:ta=^I:pt:li#34:co#80:cl=^_era\r\n\n:up=^K:nd=^_rig\r:\ :al=^_up\r^_ili\r:dl=^_dli\r^F:\ :dc=^_dch\r:im=^_ich\r:ei=^F^_dow\r^K:nl=^F\n:\ :cd=^_dli 50\r:CC=^_:\ :AL=^_up\r^_ili %d\r:DL=^_dli %d\r^F:\ :UP=^_up %d\r:DO=^_dow %d\r:LE=^_lef %d\r:RI=^_rig %d\r: X7|4025-17|4027-17|tek 4025 17 line window:\ :li#17:tc=4025: X8|4025-17ws|4027-17ws|tek 4025 17 line window in workspace:\ :is=\41com 31\r\n^_sto 9,17,25,33,41,49,57,65,73\r^_wor 17\r^_mon 17\r:\ :ti=^_wor h\r:te=^_mon h\r:so=^_att e\r:se=^_att s\r:tc=4025-17: X9|4025ex|4027ex|tek 4025 w/!:\ :ti=\41com 31\r:te=^_com 33\r:\ :is=^_com 33\r\n\41sto 9,17,25,33,41,49,57,65,73\r:tc=4025: # From cbosg!teklabs!davem Wed Sep 16 21:11:41 1981 # Here's the comamnd file that I use to get rogue to work on the 4025. # It should work with any program using the old curses (e.g. it better # not try to scroll, or cursor addressing won't work. Also, you can't # see the cursor.) # (This "learns" the arrow keys for rogue. I have adapted it for termcap - mrh) Xr|4025-cr|tek 4025 for curses and rogue:\ :is=\41com 31\r\n^_sto 9 17 25 33 41 49 57 65 73\r:\ :am:le=^H:bs:ta=^I:pt:li#33:co#80:cm=^_jum%i%d,%d;:up=^K:cr=^M:\ :do=^F^J:bl=^G:cl=^_era;:nd=^_rig;:nl=^F\n:ti=^_wor 33h:te=^_wor 0: # next two lines commented out since curses only allows 128 chars, sigh. :ti=^_lea p1/b/^_lea p2/j/^_lea p3/n/^_lea p4/h/^_lea p5/ /^_lea p6/l/^_lea p7/y/^_lea p8/k/^_lea p9/u/^_lea p./f/^_lea pt/`era w/13^_lea p0/s/^_wor 33h:\ :te=^_lea p1^_lea p2^_lea p3^_lea p4^_lea pt^_lea p5^_lea p6^_lea p7^_lea p8^_lea p9/la/13^_lea p.^_lea p0^_wor 0: # The 4110 series may be a wonderful graphics series, but they make the 4025 # look good for screen editing. In the dialog area, you can't move the cursor # off the bottom line. Out of the dialog area, ^K moves it up, but there # is no way to scroll. Xs|4112|4113|4114|tek4112|tektronix 4110 series:\ :le=^H:cr=^M:nl=^J:do=^J:bl=^G:bs:am:cl=\ELZ:li#34:co#80: Xt|4112-nd|4112 not in dialog area:up=^K:ns:tc=4112: Xu|4112-5|4112 in 5 line dialog area:li#5:tc=4112: # # -------------------------------- # # a: ADDS # # Regent: lowest common denominator, works on all regents. a0|regent|adds regent series:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cl=^L:cm=^K%+ %\102^P%.:co#80:ho=^A:li#24:ll=^A^Z:nd=^F:up=^Z: # Regent 100 has a bug where if computer sends escape when user is holding # down shift key it gets confused, so we avoid escape. a1|regent100|adds regent 100:\ :cm=^K%+ %\102^P%.:k1=^B1\r:k2=^B2\r:k3=^B3\r:k4=^B4\r:\ :k5=^B5\r:k6=^B6\r:k7=^B7\r:k8=^B8\r:\ :kh=^A:kl=^U:kr=^F:ku=^Z:kd=^J:tc=regent: # Regent 20, untested a2|regent20|adds regent 20:\ :cd=\Ek:ce=\EK:cm=\EY%+ %+ :tc=regent: a3|regent25|adds regent 25:\ :k0=^B0\r:k1=^B1\r:k2=^B2\r:k3=^B3\r:k4=^B4\r:\ :k5=^B5\r:k6=^B6\r:k7=^B7\r:k8=^B8\r:k9=^B9\r:\ :kh=^A:kl=^U:kr=^F:ku=^Z:kd=^J:tc=regent20: # Regent 40: untested a4|regent40|adds regent 40:\ :al=\EM:dl=\El:is=\EB:se=\E0@:so=\E0P:ue=\E0@:us=\E0`:vb=\ED\Ed:\ :tc=regent25: # If you have standout problem with regent 200, try so=\ER\EOP:se=\E0@\EV: a6|regent60|regent200|adds Regent 60:\ :dc=\EE:ei=\EF:im=\EF:is=\EV\EB:ko=dc,im,ei:tc=regent40: a7|regent60na|regent 60 w/no arrow keys:\ :kl@:kr@:ku@:kd@:tc=regent60: # Note: if return acts weird on a980, check internal switch #2 # on the top chip on the CONTROL pc board. ac|a980|adds consul 980:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=13\E^N:am:le=^H:bs:cl=^L\200^K@:cm=^K%+@\E^E%2:co#80:dl=13\E^O:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :li#24:nd=\E^E01:so=^Y^^^N:se=^O:up=9: # From Onyx:edward Thu Jul 9 09:27:33 1981 av|viewpoint|addsviewpoint|adds viewpoint:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:li#24:co#80:cm=\EY%+ %+ :cd=\Ek:ce=\EK:nd=^F:\ :up=^Z:cl=^L:ll=^A:kl=^U:kr=^F:kd=^J:ku=^Z:kh=^A:\ :so=^N:se=^O:us=^N:ue=^O:is=^O\E0`:vs=^O\E0P:ve=^O\E0`: # # -------------------------------- # # b: BEEHIVE # # Reports are that most of these Beehive entries (except superbee) have not been # tested and do not work right. se is a trouble spot. Be warned. b2|sb2|sb3|fixed superbee:\ :xb@:tc=superbee: # set tab is ^F, clear (one) tab is ^V, no way to clear all tabs. # good grief - does this entry make sg/ug when it doesn't have to? # look at those spaces in se/so. Seems strange to me... bh|bh3m|beehiveIIIm:\ :if=/usr/lib/tabset/beehive:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=160^S:am:le=^H:bs:cd=^R:ce=^P:cl=^E^R:\ :co#80:dl=350^Q:ho=^E:li#20:ll=^E^K:\ :nd=^L:ta=^I:pt:se= ^_:so=^] :up=^K: # This loses on lines > 80 chars long, use at your own risk bi|superbeeic|super bee with insert char:\ :ic=:im=\EQ:ei=\ER:tc=superbee: bm|microb|microbee|micro bee series:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=\EJ:ce=\EK:cl=\EE:co#80:cm=\EF%+ %+ :\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\Ex:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:\ :li#24:nd=\EC:ta=^I:pt:se=\Ed@ :so= \EdP:ue=\Ed@:up=\EA:us=\Ed`: # Superbee - f1=escape, f2=^C. # Note: there are at least 3 kinds of superbees in the world. The sb1 # holds onto escapes and botches ^C's. The sb2 is the best of the 3. # The sb3 puts garbage on the bottom of the screen when you scroll with # the switch in the back set to CRLF instead of AEP. This description # is tested on the sb2 but should work on all with either switch setting. # The f1/f2 business is for the sb1 and the :xb: can be taken out for # the other two if you want to try to hit that tiny escape key. # This description is tricky: being able to use cm depends on there being # 2048 bytes of memory and the hairy nl string. bs|sb1|superbee|superb|beehive super bee:\ :ct=\E3:st=\E1:is=\EE:do=^J:\ :cr=^M:sf=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:bl=^G:\ :am:le=^H:bs:cd=3\EJ:ce=3\EK:cl=3\EH\EJ:co#80:cm=\EF%r%3%3:cr=1000\r:\ :dC#10:da:db:xb:dc=3\EP:dl=100\EM:so=\E_1:se=\E_0:\ :li#25:nl=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :nd=\EC:ta=^I:pt:up=\EA:ho=\EH:ve=\n:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA: # # -------------------------------- # # c: CONCEPT (HUMAN DESIGNED SYSTEMS) # # From vax135!hpk Sat Jun 27 07:41:20 1981 # Extensive changes to c108 by arpavax:eric Feb 1982 # # There seem to be a number of different versions of the C108 PROMS # (with bug fixes in its Z-80 program). # The first one that we had would lock out the keyboard of you # sent lots of short lines (like /usr/dict/words) at 9600 baud. # Try that on your C108 and see if it sends a ^S when you type it. # If so, you have an old version of the PROMs. # The old one also messed up running vi with a 132-character line-length. # You should configure the C108 to send ^S/^Q before running this. # It is much faster (at 9600 baud) than the c100 because the delays # are not fixed. # new status line display entries for c108: # hs - has status capability # es - escape sequences are OK on status line # i2 - second init str - setup term for status display - set programmer mode, # select window 2, define window at last line of memory, # set bkgnd stat mesg there, select window 0. # ts - to status line - select window 2, home cursor, erase to end-of-window, # 1/2 bright on, goto(line#0, col#?) # fs - from status line - 1/2 bright off, select window 0 # ds - disable status display - set bkgnd status mesg with illegal window # ca|c108-na|c108-na-8p|concept108-na-8p|concept 108 w/8 pages, no arrows:\ :ks@:ke@:k7=\E;:k8=\E<:k9=\E=:tc=c108-8p cA|c108-rv-na|c108-rv-na-8p|concept 108 w/8 pages, no arrows in rev video:\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :\ :ks@:ke@:k7=\E;:k8=\E<:k9=\E=:tc=c108-rv8p # this needs new frotz in the cm capability for 2-char addrs when > 95.... cw|c108-w|c108-w-8p|concept108-w-8p|concept 108 w/8 pages in wide mode:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E"\E^G!\E^HA@ :\ :ti=\EU\Ev 8^AD\Ep\r:te=\Ev ^A0^AD\Ep\r\n:pt@:cm@:\ :co#132:tc=c108-8p # # Concepts have only window relative cursor addressing, not screen relative. # To get it to work right here, ti/te (which were invented for the concept) # lock you into a one page window for screen style programs. To get out of # the one page window, we use a clever trick: we set the window size to zero # ("\Ev " in te) which the terminal recognizes as an error and resets the # window to all of memory. # # Some tty drivers use cr3 for concept, others use nl3, hence dN/dC below. # This padding is only needed at 9600 baud. # 2 nulls padding on te isn't always enough. 6 works fine. Maybe less # than 6 but more than 2 will work. cO|oc100|oconcept|c100-1p:\ :is=\EU\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E:\ :in:dc=16\E^A:tc=c100: cn|c100-rv-na|c100-rv-4p-na|concept100-rv-na|c100 with no arrows:\ :ks@:ke@:tc=c100-rv: # This is useful at 1200 baud. cs|c100-s|concept-s|concept100-s|slow concept 100:\ :vb=\Ek\200\EK:ta=^I:pt:dC@:dN@:tc=c100: cd|c100-rv-s|concept-rv-s|concept100-rv-s|slow reverse concept 100:\ :vb=\EK\200\Ek:ta=^I:pt:dC@:dN@:tc=c100-rv: # # -------------------------------- # # d: DEC (DIGITAL EQUIPMENT CORPORATION) # # Note that xn glitch in vt100 is not quite the same as concept, since # the cursor is left in a different position while in the weird state # (concept at beginning of next line, vt100 at end of this line) so # all versions of vi before 3.7 don't handle xn right on vt100. # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam below. # # Since there are two things here called vt100, the installer can make # a local decision to make either one standard "vt100" by including # it in the list of terminals in reorder, since the first vt100 in # /etc/termcap is the one that it will find. The choice is between # nam (no automatic margins) and am (automatic margins), as determined # by the wrapline switch (group 3 #2). I presonally recommend turning # on the bit and using vt100-am, since having stuff hammer on the right # margin is sort of hard to read. However, the xn glitch does not occur # if you turn the bit off. # # I am unsure about the padding requirements listed here. I have heard # a claim that the vt100 needs no padding. It's possible that it needs # padding only if the xon/xoff switch is off. For UNIX, this switch # should probably be on. # # The vt100 uses rs and rf rather than is/ct/st because the tab settings # are in non-volatile memory and don't need to be reset upon login. # You can type "reset" to get them set. dp|vt100-np|vt100 with no padding (for psl games):\ :cl=\E[H\E[2J:sr=\EM:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:me=\E[m:tc=vt100: d1|vt100|vt100-nam|vt100 w/no am:\ :am@:xn@:tc=vt100-am: d2|gt42|dec gt42:\ :cr=^M:do=^J:bl=^G:\ :le=^H:bs:co#72:ns:li#40:os: d3|vt132|vt132:\ :al=99\E[L:dl=99\E[M:ip=7:dc=7\E[P:ei=\E[4l:im=\E[4h:xn:dN#30:tc=vt100: d4|gt40|dec gt40:\ :cr=^M:do=^J:bl=^G:\ :le=^H:bs:co#72:ns:li#30:os: d5|vt50|dec vt50:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:co#80:li#12:nd=\EC:ta=^I:pt:up=\EA: d6|vt125|vt125-am|vt125:\ :cr=^M:do=^J:nl=^J:bl=^G:co#80:li#24:cl=50\E[;H\E[2J:le=^H:am:bs:\ :cm=5\E[%i%d;%dH:nd=2\E[C:up=2\E[A:ce=3\E[K:cd=50\E[J:so=2\E[7m:\ :se=2\E[m:us=2\E[4m:ue=2\E[m:md=2\E[1m:mr=2\E[7m:mb=2\E[5m:me=2\E[m:\ :is=\E[1;24r\E[24;1H:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:ks=\E[?1h\E=:\ :ke=\E[?1l\E>:rf=/usr/lib/tabset/vt100:ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :kb=^H:ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:ta=^I:pt:sr=5\EM:vt#3:\ :sc=\E7:rc=\E8:cs=\E[%i%d;%dr: dI|dw1|decwriter I:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:co#72:hc:os: dh|vt50h|dec vt50h:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :co#80:li#12:nd=\EC:\ :ta=^I:pt:sr=\EI:up=\EA: di|vt100-s|vt100 with status line at top:\ :li#23:i2=\E[2;24r\E[24;1H:\ :cm@:ho=\E[H^J:cl=50\E[;H^J\E[2J:\ :hs:es:ts=\E7\E[1;%dH\E[1K:fs=\E8:tc=vt100-am: dj|vt100-s-bot|vt100 with status line at bottom:\ :li#23:i2=\E[1;23r\E[23;1H:\ :hs:es:ts=\E7\E[24;%dH\E[1K:fs=\E8:tc=vt100-am: ds|vt100-nav|dec vt100 132 cols 14 lines (w/o advanced video option):\ :li#14:tc=vt100-w: dt|vt100-w|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: dt|vt100-w-nam|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:vt@:tc=vt100-nam: dv|vt52|dec vt52:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :co#80:li#24:nd=\EC:\ :ta=^I:pt:sr=\EI:up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:kb=^H: # DEC gigi color graphic terminal , same as vt52 dg|gigi|dec gigi terminal:\ :co#80:is=200\E>\E[?4l\E[?5l\E[?7h\E[?8h:\ :li#24:cl=100\E[;H\E[2J:bs:cm=50\E[%i%2;%2H:nd=200\E[C:up=100\E[A:\ :ce=120\E[K:cd=100\E[J:so=20\E[7m:se=20\E[m:us=20\E[4m:ue=20\E[m:\ :ks=200\E[?1h\E=:ke=200\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=200\EM:\ :dC=50:dF=200:dN=50:dT=50: dw|dw2|dw3|decwriter II:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :kb=^h:le=^H:bs:co#132:hc:os: # From cbosg!ucbvax!G:tut Thu Sep 24 22:10:46 1981 df|dw4|decwriter IV:\ :cr=^M:do=^J:nl=^J:bl=^G:le=^H:bs:co#132:hc:os:am:\ :ta=^I:pt:is=\Ec:k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:kb=^H: # # -------------------------------- # # h: HEWLETT PACKARD # # Note: no "ho" on HP's since that homes to top of memory, not screen. # Due to severe 2621 braindamage, the only way to get the arrow keys to # transmit anything at all is to turn on the function key labels # (f1-f8) with ks, and even then the poor user has to hold down shift! # The default 2621 turns off the labels except when it has to to enable # the function keys. If your installation prefers labels on all the time, # or off all the time (at the "expense" of the function keys) move the # 2621-nl or 2621-wl labels to the front using reorder. # Note: there are newer ROM's for 2621's that allow you to set strap A # so the regular arrow keys xmit \EA, etc, as with the 2645. However, # even with this strap set, the terminal stops xmitting if you reset it, # until you unset and reset the strap! Since there is no way to set/unset # the strap with an escape sequence, we don't use it in the default. # If you like, you can use 2621-ba (braindamaged arrow keys). h1|2621-ba|2621 w/new rom, strap A set:\ :ks@:ke@:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:tc=hp2621: # 2621 with function labels. Most of the time they are off, # but inside vi, the function key labels appear. You have to # hold down shift to get them to xmit. h2|2621|hp2621|hp2621a|hp2621p|2621|2621a|2621p|2621-pb|hp2621-fl|hp 2621:\ :is=\E&j@\r:bt=\Ei:cm=\E&a%r%dc%dY:dc=2\EP:ip=2:pb#19200:\ :so=\E&dD:se=\E&d@:us=\E&dD:ue=\E&d@:me=\E&d@:\ :kh=\Ep\r:ku=\Et\r:kl=\Eu\r:kr=\Ev\r:kd=\Ew\r:\ :kn#8:k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:ks=\E&jB:ke=\E&j@:ta=2^I:tc=hp: # 2621k45: untested # 2622: unsure if this is quite it, have only heard about the terminal. h3|2621k45|hp2621k45|k45|2622|hp2622|hp 2621 with 45 keyboard:\ :kb=^H:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:ks=\E&s1A:ke=\E&s0A:tc=2621: # This terminal should be used at 4800 baud or less. hn|hp2645-np|2645 w/no padding:cm=\E&a%r%dc%dY:tc=hp2645: # This entry does not use any of the fancy windowing stuff of the 2621. # Indeed, termcap does not yet handle such stuff. We are looking at it. h6|hp2626|hp2626a|hp2626p|2626|2626a|2626p|hp 2626:\ :dc=2\EP:ip=2:se=\E&d@:so=\E&dB:cd=500\EJ:\ :mr=\E&dB:us=\E&dD:mb=\E&dA:mk=\E&dS:me=\E&d@:ue=\E&d@:\ :kh=\Eh:ku=\EA:kl=\ED:kr=\EC:kd=\EB:ks=\E&s1A:ke=\E&s0A:\ :sf=\ES:ta=2^I:xs:tc=2621: # This entry is for sysline. It allocates a 23 line window with a 115 line # workspace for regular use, and a 1 line window for the status line. # This assumes port 2 is being used. # Turn off horizontal line, Create ws #1 with 115 lines, # Create ws #2 with 1 line, Create window #1 lines 1-23, # Create window #2 lines 24-24, Attach cursor to workspace #1. # Note that this clears the tabs so it must be done by tset before # it sets the tabs. 2626-23|hp 2626 using only 23 lines:\ :ts=\E&w7f2p2I\E&w4f2I\r\EK\E&a%dC:\ :fs=\E&d@\E&w7f2p1I\E&w4f1I:es:hs:\ :i2=\E&q3t0{0H \E&w0f115n1I \E&w0f1n2I \E&w2f1i0d0u22l0S \E&w2f2i0d23u23l0S \E&w7f2p1I \r:\ :li#23:tc=2626: 2626-12:li#12:tc=2626: 2626-12x40:co#40:li#12:tc=2626: 2626-x40:co#40:tc=2626: 2626-11:li#11:tc=2626: # cD is a pain - but it only screws up at 9600 baud. # You should use this terminal at 4800 baud or less. h8|hp2648|hp2648a|2648a|2648|HP 2648a graphics terminal:\ :cl=50\EH\EJ:cm=20\E&a%r%dc%dY:dc=7\EP:ip=5:tc=2645: # 2640a doesn't have the Y cursor addressing feature, and C is memory relative # instead of screen relative, as we need. ha|2640|hp2640a|2640a|hp 2640a:\ :cm@:ks@:ke@:tc=2645: hb|2640b|hp2640b|2644a|hp2644a|hp 264x series:\ :ks@:ke@:tc=2645: # 2621 using all 48 lines of memory, only 24 visible at any time. Untested. hl|2621-48|48 line 2621:\ :li#48:ho=\EH:cm=\E&a%r%dc%dR:tc=2621: # 2621 with no labels ever. Also prevents vi delays on escape. # Needed for UCB ARPAVAX console, since lsi-11 expands tabs (wrong). ht|2621-nt|hp 2621 w/no tabs:\ :pt@:tc=hp2621: # 2621 with labels on all the time - normal outside vi, function inside vi. hw|2621-wl|hp2621-wl|2621|hp2621|hp 2621 w/labels:\ :is=\E&jA\r:ke=\E&jA:tc=hp2621-fl: # # -------------------------------- # # i: INFOTON (GENERAL TERMINAL) # # Infoton is now called General Terminal Corp. or some such thing. # gt100 sounds like something DEC would come out with. Lets hope they don't. i1|i100|gt100|gt100a|General Terminal 100A (formerly Infoton 100):\ :cr=^M:do=^J:nl=^J:bl=^G:\ :cl=^L:cd=\EJ:ce=\EK:li#24:co#80:\ :al=\EL:dl=\EM:up=\EA:nd=\EC:ho=\EH:cm=\Ef%r%+ %+ :vb=\Eb\Ea:\ :am:le=^H:bs:so=\Eb:se=\Ea: i4|i400|400|infoton 400:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=\E[L:am:le=^H:bs:ce=\E[N:cl=\E[2J:cm=%i\E[%3;%3H:co#80:dl=\E[M:\ :li#25:nd=\E[C:up=\E[A:im=\E[4h\E[2Q:ei=\E[4l\E[0Q:\ :dc=\E[4h\E[2Q\E[P\E[4l\E[0Q: ia|addrinfo:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :li#24:co#80:cl=^L:ho=^H:nd=^Y:cd=^K:\ :up=^\:am:le=^Z:bc=^Z:cm=\037%+\377%+\377:ll=^H^\: ik|infotonKAS:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^Z:bc=^Z:cd=^K:cl=^L:co#80:li#24:nd=^Y:up=^\:ll=^H^\: # # -------------------------------- # # k: HEATHKIT (ZENITH) # kA|h19-a|heath-ansi|heathkit-a|heathkit h19 ansi mode:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=1*\E[1L:am:le=^H:bs:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%2;%2H:co#80:\ :dc=\E[1P:dl=1*\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:im=\E[4h:li#24:mi:\ :nd=\E[1C:as=\E[10m:ae=\E[11m:ms:ta=^I:pt:se=\E[0m:so=\E[7m:up=\E[1A:\ :vs=\E[>4h:ve=\E[>4l:kb=^h:ku=\E[1A:kd=\E[1B:kl=\E[1D:kr=\E[1C:\ :kh=\E[H:kn#8:k1=\EOS:k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:l6=blue:\ :l7=red:l8=white:k6=\EOP:k7=\EOQ:k8=\EOR:\ :sr=\EM:is=\E<\E[>1;2;3;4;5;6;7;8;9l\E[0m\E[11m\E[?7h: kB|h19-bs|heathkit w/keypad shifted:\ :ks=\Et:ke=\Eu:tc=h19-b: kp|p19:\ :al=2*\EL:dl=2*\EM:tc=h19-b: # # -------------------------------- # # l: LEAR SIEGLER (ADM) # # If the adm31 gives you trouble with standout mode, check the DIP switch # in position 6, bank @c11, 25% from back end of pc. Should be OFF. # If there is no such switch, you have an old adm31 and must use oadm31 l2|adm2|lsi adm2:\ :cr=^M:do=^J:nl=^J:bl=^G:al=\EE:am:le=^H:bs:cd=\EY:ce=\ET:cl=\E;:\ :cm=\E=%+ %+ :co#80:dc=\EW:dl=\ER:\ :ei=:ho=^^:ic=\EQ:im=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:li#24:nd=^L:up=^K: l4|adm42|42|lsi adm42:\ :vs=\EC\E3 \E3(:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=270\EE:am:le=^H:bs:cd=\EY:ce=\ET:cl=\E;:cm=\E=%+ %+ :co#80:\ :dc=\EW:dl=\ER:ei=\Er:im=\Eq:ip=6*:li#24:\ :bt=\EI:nd=^L:se=\EG0:so=\EG4:ta=\t:up=^k:\ :ma=^K^P:pc=\177: l5|adm5|5|lsi adm5:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :cd=\EY:ce=\ET:do=^J:kb=^H:kh=^^:\ :ma=^Hh^Jj^Kk^Ll^^H:se=\EG:sg#1:so=\EG:tc=adm3aplus: lb|adm3a+|3a+|adm3aplus:\ :kl=^H:kd=^J:ku=^K:kr=^L:tc=adm3a: lo|oadm31|o31|old adm31:\ :se@:so@:us@:ue@:tc=adm31: # # -------------------------------- # # m: MICROTERM # # These mime1 entries refer to the Microterm Mime I or Mime II. # The default mime is assumed to be in enhanced act iv mode. m3|mime3a|mime1 emulating 3a:\ :am@:ma=^X ^K^J^Z^P:ku=^Z:kd=^K:kl=^H:kr=^X:tc=adm3a: m4|microterm|act4|microterm act iv:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=^_:ce=^^:cl=^L:cm=^T%.%.:co#80:li#24:nd=^X:up=^Z:ho=^]: # The padding on sr and ta for act5 and mime is a guess and not final. # The act 5 has hardware tabs, but they are in columns 8, 16, 24, 32, 41 (!)... m5|microterm5|act5|microterm act v:\ :uc=\EA:sr=3\EH:ku=^Z:kd=^K:kl=^H:kr=^X:ma=^Z^P^Xl^Kj:tc=act4: # Act V in split screen mode. act5s is not tested and said not to work. mS|act5s|skinny act5:\ :ti=\EP:te=\EQ:li#48:co#39:tc=act5: # Mimes using brightness for standout. Half bright is really dim unless # you turn up the brightness so far that lines show up on the screen. # uc is disabled to get around a curses bug, and should be put back in someday. mf|mime-fb|full bright mime1:\ :so=^Y:se=^S:is=^S\E:tc=mime: mh|mime-hb|half bright mime1:\ :so=^S:se=^Y:is=^Y\E:tc=mime: mm|mime|mime1|mime2|mimei|mimeii|microterm mime1:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=80^A:am:le=^H:bs:cd=^_:ce=^^:cl=\035^C:cm=^T%+^X%> 0%+P:co#80:\ :dl=80^W:ta=2^I:li#24:nd=^X:ta=^I:pt:uc=^U:up=^z:ho=\035:do=^K:\ :is=^S\E^Q:ma=^X ^K^J^Z^P:ku=^Z:kd=^K:kl=^H:kr=^X:sr=3^R:vt#9: # These termcaps (for mime 2a) put the terminal in low intensity mode # since high intensity mode is so obnoxious. ms|mime2a-s|microterm mime2a (emulating an enhanced soroc iq120):\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=20*^A:am:le=^H:bs:cd=20*\EJ:ce=\EK:cl=\EL:cm=\E=%+ %+ :co#80:dc=\ED:\ :dl=20*^W:kl=^H:kr=^L:ku=^K:kd=^J:ho=^^:is=\E):sr=\EI\ :im=\EE:ei=^Z:ip=2:li#24:nd=^L:so=\E\072:se=\E;:up=\EI:\ :us=\E6:ue=\E7: # This is the preferred mode (but ^X can't be used as a kill character) mv|mime2a|mime2a-v|microterm mime2a (emulating an enhanced vt52):\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=20*^A:le=^H:bs:cd=20*\EQ:co#80:ce=\EP:cl=\EL:cm=\EY%+ %+ :is=^Y\ :dc=^N:dl=20*^W:ip=2:ei=^Z:ho=\EH:im=^O:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :li#24:nd=\EC:ta=^I:pt:se=\E9:so=\E8:up=\EA:sr=\EA:us=\E4:ue=\E5: mx|mime-3ax|mime1 emulating enhanced 3a:\ :al=80^A:dl=80^W:ta=^I:pt:ce=^X:cd=^_:tc=mime-3a: # # -------------------------------- # # p: PERKIN ELMER # pe|pe550|bantam|perkin elmer 550:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:co#80:ce=20\EI:cl=20\EK:cm=\EX%+ \EY%+ :\ :ho=\EH:li#24:ll=\EH\EA:nd=\EC:up=\EA:\ :ma=^Z^P:cd=6^N@^V: pf|fox|perkin elmer 1100:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cd=5.5*\EJ:ce=\EI:cl=132\EH\EJ:co#80:ho=\EH:li#24:\ :ll=\EH\EA:nd=\EC:cm=\EX%+ \EY%+ :up=\EA:vb=^P^B^P^C: po|owl|perkin elmer 1200:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:al=5.5*\EL:am:le=^H:\ :bs:cd=5.5*\EJ:ce=5.5\EI:cl=132\EH\EJ:ho=\EH:ll=\EH\EA:\ :cm=\EX%+ \EY%+ :co#80:dc=5.5*\EO:dl=5.5*\EM:ei=:ic=\EN:im=:ip=5.5*:\ :kb=^h:in:li#24:nd=\EC:up=\EA:se?=\E!\200:so?=\E!^H:vb=^P^B^P^C:\ :k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:\ :k7=\ERG:k8=\ERH:k9=\ERI:k0=\ERJ: # # -------------------------------- # # q: HOME MADE TERMINALS # qB|bc|bill croft homebrew:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cm=\E=%+ %+ :cl=^Z:co#96:ho=^^:li#72:\ :nd=^L:up=^K:vb=: qN|nucterm|rayterm|NUC homebrew:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :am:le=^H:bs:cl=1^L:li#24:co#80:nd=^C:up=^N:ho=^B:ll=^K:ce=^A:cd=^E: qb|ex3000:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :li#24:co#80:ho=^Q: qc|carlock|klc:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=^E:am:bs:ce=^U:cl=100^Z:cm=\E=%+ %+ :co#80:dc=\177:dl=^D:dm=:\ :ed=:ei=^T:ho=^^:im=^T:li#24:nd=^L:se=^V:so=^V:up=^K:vb=\EV\EV: qe|exidy|exidy2500|exidy sorcerer as dm2500:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=^P^J^X:am:le=^H:bs:ce=^W:cl=^^:cm=^L%r%n%.%.:co#64:\ :dc=\b:dl=^P^Z^X:dm=^P:ed=^X:ei=^X:ho=^B:ic=^\:\ :im=^P:li#30:nd=^\:ta=^I:pt:so=^N:se=^X:up=^Z: qn|netx|netronics:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=2000^F^E:ce=1600^E:cl=466^L:cm=\E=%+@%+@:co#64:ho=^D:\ :li#16:ma=j^Jk^Pl :nd=\E+@A:pc=\200:sr=\E=@@^K:up=^K: # This came from the comp ctr who got it from some user. Smart indeed! qs|sexidy|exidy smart:\ :cr=^M:do=^J:nl=^J:bl=^G:li#24:co#64:cl=^l:ho=^q:nd=^s:\ :up=^w:le=^H:bs:le=^a:bc=^a:ma=^x^J:kd=^S: qu|ubell|ubellchar:\ :if=/usr/lib/tabset/ubell:\ :cr=^M:do=^J:nl=^J:bl=^G:am:le=^H:bs:ta=^I:pt:\ :ce=\Ed:cl=^Z:cm=\E=%+ %+ :co#80:li#24:nd=^L:up=^K:\ :ma=j^Jk^P^K^Pl :ho=^^: qw|ttyWilliams:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :co#80:li#12:le=^Y:bc=^Y:do=^K:up=^Z:cl=^^:ce=^_:am:ho=^]:nd=^X: qx|xitex|xitex sct-100:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=2000^F^E:ce=1600^E:cl=400^L:cm=\E=%+@%+@:co#64:ho=^D:\ :li#16:ma=j^Jk^Pl :nd=\E+@A:pc=\200:sr=\E=@@^K:up=^K: # # -------------------------------- # # s: SPECIALS # # Special "terminals". These are used to label tty lines when you don't # know what kind of terminal is on it. The characteristics of an unknown # terminal are the lowest common denominator - they look about like a ti 700. # # -------------------------------- # # t: TEXAS INSTRUMENTS # t3|ti|ti700|ti733|735|ti735|ti silent 700:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:co#80:hc:os:dC#162: t4|ti745|745|743|ti silent 745:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:co#80:hc:os: t8|ti800|ti omni 800:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:co#132:hc:os: # # -------------------------------- # # v: TELEVIDEO # # There are some tvi's that require incredible amounts of padding and # some that don't. I'm assuming 912 and 920 are the old slow ones, # and 912b, 912c, 920b, 920c are the new ones that don't need padding. v1|tvi912|912|920|tvi920|old televideo:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :al=33*\EE:am:le=^H:bs:ce=\ET:cm=\E=%+ %+ :cl=^Z:co#80:dc=\EW:dl=33*\ER:ei=:\ :kb=^h:ku=^K:kd=^J:kl=^H:kr=^L:k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:\ :k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:\ :ho=^^:im=:ic=\EQ:li#24:nd=^L:ta=^I:pt:se=\Ek:so=\Ej:up=^K:us=\El:ue=\Em:\ :ma=^K^P^L :sg#1:ug#1: # the 912 has a key that's like shift: 8 xmits "^A8\r". # The 920 has this plus real function keys that xmit different things. # Termcap makes you use the funct key on the 912 but the real keys on the 920. v2|912b|912c|tvi912b|tvi912c|tvi|new televideo 912:\ :al=5*\EE:dl=5*\ER:tc=tvi912: v3|920b|920c|tvi920b|tvi920c|tvi|new televideo 920:\ :k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:k4=^AD\r:k5=^AE\r:\ :k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:tc=tvi912b: # set to page 1 when entering ex (\E-17 ) # reset to page 0 when exiting ex (\E-07 ) v4|tvi912-2p|tvi920-2p|912-2p|920-2p|tvi-2p|televideo w/2 pages:\ :ti=\E-17 :te=\E-07 :tc=tvi912:\ v5|tvi950-ap|tvi 950 w/alt pages:\ :is=\E\\1:ti=\E-06 :te=\E-16 :tc=tvi950: v6|tvi950-b|bare tvi950 no is:\ :is@:tc=tvi950: v7|tvi950-ns|tvi950 w/no standout:\ :so@:se@:us@:ue@:tc=tvi950: # entry by Tim Curry 5/21/82 Univ. of Central Fla. duke!ucf-cs!tim v9|925a|tvi925a|TeleVideo Model 925:\ :al=\EE:am:bs:bt=\EI:bw:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :co#80:dc=\EW:\ :dl=\ER:do=^V:ei=:ic=\EQ:if=/usr/lib/tabset/std:im=:kb=^H:kd=^V:\ :kh=^^:kl=^H:kn#12:kr=^L:ku=^K:li#24:nd=^L:pt:se=\EG0:sg=#1:so=\EG4:\ :ue=\EG0:ug#1:ul:up=^K:us=\EG8:is=\El\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :ve=\E.4:vs=\E.2: # The following tvi descriptions from B:pjphar and virus!mike # is for all 950's. It sets the following attributes: # full duplex (\EDF) write protect off (\E() # conversation mode (\EC) graphics mode off (\E%) # white on black (\Ed) auto page flip off (\Ew) # turn off status line (\Eg) clear status line (\Ef\r) # normal video (\E0) monitor mode off (\EX or \Eu) # edit mode (\Er) load blank char to space (\Ee\040) # line edit mode (\EO) enable buffer control (^O) # protect mode off (\E\047) duplex edit keys (\El) # program unshifted send key to send line all (\E016) # program shifted send key to send line unprotected (\E004) # set the following to nulls: # field delimiter (\Ex0\200\200) # line delimiter (\Ex1\200\200) # start-protected field delimiter (\Ex2\200\200) # end-protected field delimiter (\Ex3\200\200) # set end of text delimiter to carriage return/null (\Ex4\r\200) # va|tvi950|950|televideo950:\ :ct=\E3:st=\E1:cr=^M:do=^J:nl=^J:bl=^G:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\Ef\r:\ :al=\EE:am:le=^H:bs:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :co#80:dc=\EW:dl=\ER:do=^V:ei=\Er:ho=^^:im=\Eq:k0=^A0\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^V:kh=^^:kl=^H:\ :ko=ic\054dc\054al\054dl\054cl\054bt\054ce\054cd:kr=^L:\ :ku=^K:li#24:ma=^Vj^Kk^Hh^Ll^^H:mi:ms:nd=^L:ta=^I:pt:se=\EG0:\ :sg#1:so=\EG4:sr=\Ej:ue=\EG0:ug#1:up=^K:us=\EG8:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :xn:hs:ts=\Eg\Ef:fs=\r:ds=\Eg\Ef\r: # # is for 950 with two pages adds the following: # set 48 line page (\E\\2) # place cursor at page 0, line 24, column 1 (\E-07 ) # set local (no send) edit keys (\Ek) # # two page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 48 line page (\E\\2) # place cursor at 0,24,1 (\E-07 ) # set duplex (send) edit keys (\El) when entering vi # set local (no send) edit keys (\Ek) when exiting vi # vb|tvi950-2p|950-2p|televideo950 w/2 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\2\E-07 \ :te=\E\\2\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # is for 950 with four pages adds the following: # set 96 line page (\E\\3) # place cursor at page 0, line 24, column 1 (\E-07 ) # # four page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 96 line page (\E\\3) # place cursor at 0,24,1 (\E-07 ) # vc|tvi950-4p|950-4p|televideo950 w/4 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\3\E-07 \ :te=\E\\3\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # is for reverse video 950 changes the following: # set reverse video (\Ed) # # set vb accordingly (\Ed ...nulls... \Eb) # vd|tvi950-rv|950-rv|televideo950 rev video:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=tvi950: # # uses the appropriate entries from 950-2p and 950-rv # ve|tvi950-rv-2p|950-rv-2p|televideo950 rev video w/2 pages:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\2\E-07 :\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :te=\E\\2\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # uses the appropriate entries from 950-4p and 950-rv # vf|tvi950-rv-4p|950-rv-4p|televideo950 rev video w/4 pages:\ :is=\EDF\EC\Eb\EG0\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\3\E-07 :\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :te=\E\\3\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # -------------------------------- # # y: TELERAY # # Note two things called "teleray". Reorder should move the common one # to the front if you have either. A dumb teleray with the cursor stuck # on the bottom and no obvious model number is probably a 3700. y1|t3700|teleray|dumb teleray 3700:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cl=^L:co#80:li#24: y3|t3800|teleray 3800 series:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :le=^H:bs:cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :co#80: \ :do=\n:ho=\EH:li#24:ll=\EY7 :nd=\EC:ta=^I:pt:up=^K: y6|t1061|teleray|teleray 1061:\ :ct=\EG:st=\EF:\ :cr=^M:do=^J:nl=^J:bl=^G:\ :al=2*\EL:am:le=^H:bs:cd=1\EJ:ce=\EK:cl=1^L:cm=\EY%+ %+ :co#80:\ :dc=\EQ:dl=2*\EM:ei=:ho=\EH:ic=\EP:im=:ip=0.4*:\ :k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:k8=^Z8:\ :li#24:nd=\EC:ta=^I:pt:se=\ER@:so= \ERD:\ :is=\Ee\EU01^Z1\EV\EU02^Z2\EV\EU03^Z3\EV\EU04^Z4\EV\EU05^Z5\EV\EU06^Z6\EV\EU07^Z7\EV\EU08^Z8\EV\Ef:\ :up=\EA:us=\ERH:ue=\ER@:xs:xt:sg#2:ug#1: # "Teleray Arpa Special", offically designated as # "Teleray Arpa network model 10" with "Special feature 720". # This is the new (1981) fast microcode updating the older "arpa" proms # (which gave meta-key and pgmmable-fxn keys). 720 is much much faster, # converts the keypad to programmable function keys, and has other goodies. # Standout mode is still broken (magic cookie, etc) so is suppressed as no # programs handle such lossage properly. # Note: this is NOT the old termcap's "t1061f with fast proms." # From Univ of Utah, J.Lepreau Tue Feb 1 06:39:37 1983 # lepreau@utah-cs, harpo!utah-cs!lepreau # y7|t10|teleray 10 special:\ :so@:se@:us@:ue@:\ :al=\EL:bs:cd=\EJ:ce=\EK:cl=30\Ej:cm=\EY%+ %+ :co#80:\ :dc=\EQ:dl=\EM:ei=:ho=\EH:ic=\EP:im=:km:li#24:nd=\EC:nl=\n:pc=\200:pt:\ :se=\ER@:so=\ERD:sf=\Eq:sg#2:sr=\Ep:up=\EA:ug#1:ue=\ER@:us=\ERH:\ :xs:xt: yf|t1061f|teleray 1061 with fast PROMs:\ :al=\EL:ip@:dl=\EM:tc=t1061: # # ------------------------ # # The following have been included for upward compatibility with previous # names. They are considered obsolete and the new name (which typically # contains an extra dash) should be used instead. These names will go # away eventually (read: "soon") so you should start converting! # hp2621nl|2621nl:tc=2621-nl: hp2621nt|2621nt:tc=2621-nt: hp2621wl|2621wl:tc=2621-wl: 9122p:tc=912-2p: 9202p:tc=920-2p: 9502p:tc=950-2p: 9504p:tc=950-4p: 950rv:tc=950-rv: 950rv2p:tc=950-rv2p: 950rv4p:tc=950-rv4p: aaa18:tc=aaa-18: aaa20:tc=aaa-20: aaa22:tc=aaa-22: aaa24:tc=aaa-24: aaa26:tc=aaa-26: aaa28:tc=aaa-28: aaa30:tc=aaa-30: aaa36:tc=aaa-36: aaa40:tc=aaa-40: aaa48:tc=aaa-48: aaa60:tc=aaa-60: aaadb:tc=aaa-db: c1004p:tc=c100-4p: c100rv:tc=c100-rv: c100rv4p:tc=c100-rv-4p: c100rv4pna:tc=c100-rv-4p-na: c100rv4ppp:tc=c100-rv-4p-pp: c100rvna:tc=c100-rv-na: c100rvpp:tc=c100-rv-pp: c100rvs:tc=c100-rv-s: c100s:tc=c100-s: c108-4:tc=c108-4p: c108-8:tc=c108-8p: h19A:tc=h19-A: h19b:tc=h19-b: h19bs:tc=h19-bs: h19u:tc=h19-u: h19us:tc=h19-us: mime2as:tc=mime2a-s: mime2av:tc=mime2a-v: mimefb:tc=mime-fb: mimehb:tc=mime-hb: tvi2p:tc=tvi-2p: tvi9122p:tc=tvi912-2p: tvi9202p:tc=tvi920-2p: tvi9502p:tc=tvi950-2p: tvi9504p:tc=tvi950-4p: tvi950b:tc=tvi950-b: tvi950ns:tc=tvi950-ns: tvi950rv:tc=tvi950-rv: tvi950rv2p:tc=tvi950-rv2p: tvi950rv4p:tc=tvi950-rv4p: vt100am:tc=vt100-am: vt100nam:tc=vt100-nam: vt100s:tc=vt100-s: vt100w:tc=vt100-w: vi200rvic:tc=vi200-rv-ic: vi200f:tc=vi200-f: vi200rv:tc=vi200-rv: vi200ic:tc=vi200-ic: tek4014sm|4014sm:tc=tek4014-sm: # # END OF TERMCAP # ------------------------ b[x?lٺC 0*u*vby4#!/bin/sh cp /dev/null /fastboot /etc/reboot $* b[z@lٺm **by4cp /dev/null /etc/vipw.lock chmod 0 /etc/vipw.lock ln /etc/vipw.lock /etc/ptmp > /dev/null 2>& 1 case $? in 0) trap '' 1 2 3 15 vi /etc/passwd rm /etc/ptmp ;; *) echo Temporary file busy, try again later. ;; esac b[|AlٺE Y**by5  80 $G"I#HTHS/N4 /NtXNuNuNV.#P```X n P -fV n R @HH dg pg( wg `$R\`SoX n #``RSn## Hy^/9`NP-@f/9`Hy`NDPHxNtX`jBB L @HH-@ @g gJg"`, gJfR L @BR maZ/.HxHxHyDN grB9L~DHyTNXaaBNtX..N^NuNVH0 9|Df#TX` 9{Df6JXg*|4` 9TXѭPDeBX`j 9TnP 9TN// 94N// 98"9/9L/9H .NN//HyND N^NuNV.*|4` /.HUaPPDe*nN^NuNVJ g -y`-yT nJg .-@Jo PѨ n!nJ fJ9Lf nB`-|`J nJgLB .Ю @".L AfR m l 4eB .L @ .Ю"@R m n N^NuNVH Jfp`^B`P й @*PB ."HA HABAЁІ @fJg gR mRmBL N^NuNVHnNXJfFHnN:X0.<#HnN$X @J g` 94ѹ 9ToN^NuNVJ\g* 9S-@HnN XX/HyNDPN^NuNV/.aX/aXN^NuNVH HnN:X0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN -@Jl QS*| .r*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NnPJmJn -|`-n(f9:HH/NxXJgm+|l+|l+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NDP.JgJm/NXHx` afvJgp`p//.NP.lB lf6Hx/.NDP.Jg Jm/NXHx/.NP.Jm.HxB/Nj `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0J f8 < #  < # #  $#  .^rN.*y B , g`(*(U g " Ҁe " Ҁd(M *@b $f gB`R ,  ,o "<N # ,BNX(@ 9 ," Ҁe 9 ,/NX(@g y $ 9 $Xg y $  9 ," ҀY(# $ <  A ` " Ҁ#  c A# ( A 9 *A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  ( L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLJ $ ?&.5;CrJPW\Nbi6q xx(\xx$.Dd.dtt< ><h'x038?FMU ^emxw<*< t~4r0D=` v "(1 : @ G MT 4Z;b rDhW o?$z4 gX(tj X\?p:&N< $`OF  V d. [(fl1p:@LBHnO lW _Qmnsfy$x   ly;3x iJx[ Ys|"Q@)Rj5*;ZTBjI lP.DW]biov|7  0crt0.oac.o_sccsidctime.oOftime.oprintf.oprintf.ordwr.ofilbuf.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printffflti_loop_newday_pcount_midnightfdivi__ctype__lastime_pptr_pflag_ubuf_among_tbuf_update_ibuf_ctime_localtime_day_dtime_printfcmpi_fopenieeeused_bydayfmuli_ftimefaddi_fread_upall_time_wtmp_pdate_dysizelmodtldivt_asctime_gmtimecerror__pfile__print__iob_fwrite__flsbuf__filbuf_read_fflush_fstat__sibuf_malloc_gettimeofday_fcvt_ecvt_isnan_strlen_isinfffixi_modf__cleanup_write__sobuf_free_close__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpfdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_errno_creat_openptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[BlٺU} -.**by6  :0$$G"I#HTHS/N4 /N,XNuNuNV o n /(`BNXJgHy4NXHxN,XBN,XN^NuN|Hx3N@eNuNVH *|` 9tl @ @*PJgN@eNuNVHn/.NPJlB`pN^NuN|HxN@eBNuNV/. Hyt /.N& N^NuNV/. Hy@t/.N& N^NuN|Hx6N@eNuNVH0JBf8 <B#B <B#B#BB$#BB .^rN*.*yB BB, g`(*(U g " Ҁe " Ҁd(M *@bB$fBgB`RB, B,o "<N0#B,BNX(@ 9B," Ҁe 9B,/NX(@g yB$ 9B$Xg yB$  9B," ҀY(#B$ <B A ` " Ҁ#B B c A#B( A 9B *A L0N^NuNVH0*n(MY#B (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN*.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ B( L0N^NuN|HxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL o n (` </HyrHy HN HxNXX*|<`$J g/-/HyN@ Jf#P #\ /9haX# /9taX# /9aX# Hx/9 NP# Jf(/9 HyHy HN HxNXXJ g./9 /9 /9 /9 /9 HyN@B/9D/94NN HxHy /94NϪ B/9/94NN HxHy /94NϪ /9 HyN@PHx/9 NP#SB/9 /94NN 9 "HAHABAЁ//9S/94NϪ$ 9 "HAHABAЁgHyNlXHxNXXB/9/94NN HxHy /94NϪ B/9/94NN HxHy /94NϪ /9 HyN@PHxJ/9 NP#SB/9 /94NN 9 "HAJJHABAЁ//9S/94NϪ$ 9 "HAJJHABAЁgHyNlXHxNXX/9aX-@/9aX. r N#S Hx/NP#;Jf$/HyHy HN HxNXXB/9afX//94NN //9;/94NϪ gHy7NlXHxNXXB/9/94NN HxHn/94NϪ B/9/94NN HxHy; /94NϪ S; /9; HyAN@PHx/9; NP# Hx 9; /NP# B .R//94NN 9; //9 /94NϪ "9; 灰gHyUNlXHxNXX 9S(@`)lZZ)lJ,g0,(H/HybN@P ,f Hyk` , g/,ZHysN@P0,4H/HyN@P ,Z "<N-@B`6 .Їй /aTX-@ .?/HyN@PR0,4HmHyN@XB0,4Hl .Їй /aX-@//a PJgHxHnHTa R` ,6Ь:Ь>"<N./,NHyN@P S"<N/HxHx /,Na S"<N/Hx ,6"<N"/ ,N /aj)| Z0,4Hr WЬZ)@JVg. ,V rJN"HAJJHABAЁйS)@V l(gHTa zXJf#;`a , g0,(H# B` ЬZ$@fx0*@gnp0*@ eLp0*@ d:p0*@ R"HA HABAЁй; @(gHx`HxHRHTa B R6mpJ gHyN@XB` ,6ЬZ"Ё$@fx0*@gnp0*@ eLp0*@ d:p0*@ R"HA HABAЁй; @(gHx`HxHRHTa R:mhJ gHyN@XB`0,4Hr ЬZ"偐$@fx0*@gnp0*@ eLp0*@ d:p0*@ R"HA HABAЁй; @(gHx`HxHRHTa R>m\J gHyN@XBHx Ь/HTa R mJ gHyN@XJ gHyN@X 9 "HAHABAЁйSe&yS`J . l"HAHABAЁ-@RJn`..N^NuNV. 8gn 9 "HAHABAЁй *@R 9; "9 o HyHy HNPHxNXX: ;nnn*nN^NuNVH0*n(n 0H2HL0N^NuNVH8*y `BB//-a8PJfBBHxHxaHzHx/9 /9 Nl 9 S"HAHABAЁй (@ To0H/HxHyN@ `J gHTaXA&H0H2,HЁ2Ho Hy3N@XHTaXHSaX`F0H2,HЁ2Hl20H2,HЁ2H/0H2,HЁ/HyNN@ ] bfJ g /9 a0XJSg0H2,HЁ/HyoN@PL8N^NuNV.*n-HH @/0-H/0H/HyN@-HH g gHyN@X`*-HйS @0((H/HyN@P`*nN^NuNVB .?r //94NN Hx . r  //94NϪ g,HyNlX/.HyHy HN B`pN^NuNVH0(n*n p0-@( g fB`B r //94NN HxHn/94NϪ g(HyNlX/HyHy HN ` . g g( gD`z ,6ЬZ" 䁲=m(`^0,4Hr ЬZ䀰=Hl:Hy=HHy=HUHTa P/HTa *J g/HyN@Pf0-@gp0-@ R"HA HABAЁй; @(f-fB r //98NN HxHn/98NϪ g&/HyHy HN HyNlXBBAAgRR mJfJ gHyN@X L0N^NuNV.*nBJ g" - g0-(H/Hy N@PB - gJ g& .Э @p0(@/HyN@PB .Э @p0(@r //94NN Hx .r ;//94NϪ gnHy!`ZJ8m^B -NЮr //98NN Hx .r ;//98NϪ gHy.NlXRR mJ g - gHy;N@X .*nN^NuNVH0*n p0-@. й (@ fJg| gJ g" . @//Hy=N@ JSg/.HU/.a -@f" gJ gVHyHN@X`FJ f, g" . @//HyJN@ /.HyVN@P m  oHyhN@X/9 . @//Hy`P/HyN@Pp0-@/HyaPHTaX/9 . @//,HyN@`"/.HTa$PJfR,9y )UL0N^NuNV  f nJg gp`B` n(HHN^NuNV n0(H/HH @/ . /HyN@N^NuNVH 9 V.` й *@Jf/HyaP  R, "HA HABAЁй; @(g2 "HA HABAЁй; @(g /Hya,PJ g /HyaPR mbL N^NuNV. .  R-@/. /./.HyN@ ."HA HABAЁй;*@p0- @/p0-/HyN@ -g- @gdp0- @ ep0- @/Hy N@P`Jp0- @"HAHABAЁйS @0((H/Hy!`p0- @ ep0- @/Hy,`p0- @"HAJJHABAЁйS @ (8 "<N-@HyAN@X ."HAHABAЁйS @0((H/HyHN@P ."HAHABAЁйS @J^g< ."HAHABAЁйS @ (^ "<N-@`nHyLN@XHyNN@Xp- @/N@X-gHyQN@X-gHyWN@X-gHy]N@X-gHycN@X-gHyiN@X -?g.p-/ -/HyrN@ 0-@gVp0-@Sй /p0-@/HyN@ p0-@S cHyN@XHyN@X*nN^NuNVHB.9 `n* "HA HABAЁй; @p0@, "HA HABAЁй; @(fX Sй / Sй /HyN@ Sй /HyaP Sй /HyaP Sй  o@ Sй / Sй /HyN@ Sй /HyaP Sй й @JSg Sй /HyanP Sй Rй @JSg Sй R/Hy a2PSlLN^NuNVB/./94NN HxHn/94NϪ g,Hy%NlX/.Hy*Hy HN B` .N^NuNVH8*n(n&n . 6l< . -@ "<NЭV @$ . "<NvԀ `d <>". eHxHnHSHx </`*BHnHTHx -6". /a .L8N^NuNVH0*n(n -6ЭZd@ Z`. -6ЭZeJ -6"-6ҭZ$ Ђ`F0-4Hr ЭZ"->偐c0-4Hr ЭZ"< L0N^NuNVH8..*n(n| A&HJm Ю o*Hy`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|L 9s(`l  @*PJgXh$:LXjy%;JViz4Kb|"2Im8M`Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV4.-nBL`b yS$ S m. .R @HH yS$"(R!AS AHH` /9S$ .R @HH/NPPRL nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-||-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N̸X-@8/.N̸XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|} PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.N̸X".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNvЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N\PJf/./.N̄PJfHnHn .R l .R`p//./.Nd-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9h/9d .".NȠgP .S-@HJlD-@HJHg6 .Hr Nv0S n .Hr N`S n0A .ذbJn/9p/9l .".NȠfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N\PJf/./.N̄PJfHnHn *LZ`0SR`*0Pb1 nRJfPc0R 9nB <PL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NRPJmJn -|`-n 4f9 FHH/N\XJgm+|s0+|s0+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| ` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NφXJl~0-g /-NѶXBBBB BmB- L N^NuNVNì/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` eB` 0,f -+fp`B, wf0Hx/.N(P.JgJm/NφXHx` afvJgp`p//.NϚP.lB s(f6Hx/.N(P.Jg Jm/NφXHx/.NϚP.Jm.HxB/NN `Jgp`B//.NϚP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NϚ N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jf8 <# <### .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<N#BNҶX(@ 9" Ҁe 9/NҶX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL, %s: %x<%x>too many disk blocks lost swap map: start %x size %x overlap in swap mappings: lost swap map: start %x size %x swap space ends at %x at %4x size %4x type %s pid %dreadgetpt error reading frame %x readError reading core page %x %xswap page %x: read samepid %d u. pages: %xcore u. readswap u. read page %x %s page %x %s, %d bytes differ page number out of range: page %x type %s pid %d dup page pte %xpte %x and as %s in pid %d page %x type %s pid %d lostlockedmemcm %x %s page %x [%x, %x [text c->c_ndx %d?] (=pid %d) [text c->c_ndx %d?] (=pid %d)] free gone lock want intrans blkno %x mdev %d hlink %x page %x <<< link to non free block: in %x to %x bad free link into non free blockfree list link out of range: in %x to %x bad link infreefreereadget failed on %x vstodbpanic!: %s @(#)analyze.c 4.6 (Berkeley) 4/11/83_proc_usrpt_Usrptmap_firstfree_maxfree_text_freemem_cmap_ecmap_swapmap_nproc_ntext_nswapmapDFREEDDATADSTACKDTEXTDUDOTDPAGETlostdatastackudotpagettextfreeintransitsystextdatastackrUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ . 40&.(6e@J@S@\.cNlk|t.|L6>Jl$ LdddPX ttŐ!6(-Ř1:Ŋ=^@DİIPV?_eĪlosŠ{8ƶʰˌDɐʒHʚʢȸ,ǀ  ^pHp%ɠ+1ɸ6?LFƌM"T[._fl q?zŸɴVɤɾ2ʂ\ ɬ@\\̸$ .((H/.H7X?IXS<Xfg"k΂v<zL\3πϔϤϴҜ\< < %-X39~4?rH0OXϪ^td`lk@s y   .     I  I   O`  @ L N     =    v    !j)  .  4  <$DLvU c `  fFlt  z P;k` ; w 5;p4 S6BϚ S!48;φl S{|.  d#<' YS-6 XS <CyѶIPX_tfNm$̸ue(|L&| S$[fPR S( s(`nfd̄ ȠN\"(.4?T: @ìJ  s0R \3\dki.ryxĸ[tŠYŮs`Q$RNZ8.(pϴ7Ҷ Ңcrt0.oanalyze.o_sccsidcalloc.onlist.ofseek.ofprintf.ofprintf.oprintf.oprintf.ordwr.oqsort.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_tynames_read_vtod_qsort_printf_dump_ntext_swapmap_dnames_nproc_dflg_Dflg_freemem_pdmseg_nlist_paginfo_dsort_duse_atext_lseek_fprintf_maxfree_mflg_aproc_Usrptma_minlmodt_dblks_usrpt_dprint_pid_vflg_ndblks_dumpcm_ptdmap_fixfree_firstfree_uflgldivt_vstodb_p0br_cmap_calloc_getpt_nswapmap_typepg_bad_u_area_count_sflg_ptetov_open_text_fcore_fswap_close_perror_proc_getu_get_panic__iob_summary_dmcheck_pdmap_nl_fflg_checkpg_ecmxulmult_freeuldivt_malloc_cfree_fopen_fread_strlen_fseek_fclose_fflush__filbuf__pfile__print_fwrite__flsbuf_fstat__sibuflmult_sys_errlist_write_errno_sys_nerr__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatcerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[Dlٺ X**by9$,4< 8@ P$G"I#HTHS/N4 /N4XNuNuNVH0SX l4HyHyN4PHyHyN4PHxN4X*|4` n //NPJgJf n /HyHyN4 HyHyN4P*|4`/Hy*HyN4 JfHy.HyN4PHxN4X n /(Hy0HnNp UP Jf(BHnNBP-@JlHnNXHxN4XB -r //.N Hn/.NTX/Hy:Nt HxHyH/.NR gHy`N4XHxN4X/9HHyNtPp09N gJgp09N/HyNtPB(|PB lp0rr2,Ё-@JlBN4XHxHnNBP-@JlHnNXHxN4X . X @/NX#HSByL -".n ~oHyNtX - ~oHyNtX`HyNtX`p0,/p0,/p0/p0"- N`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9Ll h @*PJg*LZ`0SR`*0HTb1 nRJfHTc0R 9nB <HTL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|P+|P+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX@e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N.XJl~0-g /-N^XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N|PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JHf8 <H#H <H#H#HH#HH .^rN.*yHBH g`(*(U g " Ҁe " Ҁd(M *@bHfHgB`RH Ho "<N#HBN^X(@ 9H" Ҁe 9H/N^X(@g yH 9HXg yH  9H" ҀY(#H <H A ` " Ҁ#HHc A#H A 9H*A L0N^NuNVH0*n(MY#H (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ H L0N^NuNHxN@e#DBNu /йD/@HxN@e 9D#DNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLqDNJtR<Y H`gTmt4}Y4FpFB. Hh L$f,\nff@ `|*"8)/5;?0AGQ  PYy^_Lgn;.u@3i x[P|Ys<QR*Z (P |%,\27;^AH HMJRcrt0.obad144.o_sccsidfprintf.ofprintf.oprintf.oprintf.oatoi.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.otell.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_atoilmult_printfulmult_dkbad_write_tell_lseek_fprintflmodt_diskinfo_sprintfldivt_strcmp_open_perror__iob__pfile__print_sys_errlist_errno_sys_nerr_strlen__flsbuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufcerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[Elٺ  [**by:DLT\dl 8D4 0$G"I#HTHS/N4 /NXNuNuNVH*LZ`0SR`*0Kb1 nRJfKc0R 9nB <KL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nf .B`T0-f(mfHn-HH/NPJmJn -|`-nDf9VHH/NXJgm+|++|++n 0-gl(m m R Э "-d f -,/HT-HH/Nf .+L`/.N`X(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nf . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nf g m p`BL0N^NuNV.*|0` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN\/.NPXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|0`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N2P.lB +,f6Hx/.NP.Jg Jm/NXHx/.N2P.Jm.HxB/N `Jgp`B//.N2P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N2 N^NuNpHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N PJlB`pN^NuNVH B/.N2P. g `/NXB`Hx N`X*@Jg*B L N^NuNpHxN@eBNuNpHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNpHxN@eNuNpHx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NF N^NuNV/. Hy@t/.NF N^NuNpHx6N@eNuNpHx N@eNuNVH0JLf8 <L #L <L#L #L L(#LL$ .^rNZ.*yL$BL0 g`(*(U g " Ҁe " Ҁd(M *@bL(fLgB`RL0 L0o "<N`#L0BNX(@ 9L0" Ҁe 9L0/NX(@g yL( 9L(Xg yL(  9L0" ҀY(#L( <L A ` " Ҁ#L$L$c A#L, A 9L$*A L0N^NuNVH0*n(MY#L$ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNZ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ L, L0N^NuNpHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL %s%s /bin/sh /usr/lib/makewhatis /bin/sh/bin/sh/usr/lib/makewhatis/bin/sh /usr/lib/makewhatis@(#)catman.c 4.4 (Berkeley) 3/22/83Unknown error: F/bin/shsh-c-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83L4. 40<%L-\5l=|G|QZc.l.hu$~PXX$DDFK^!*1$9$A@GNSHW`:cfj`ov|?ZPf`<@BJ Rhp#0(/6 <C KPQWh\el<sz ?~hdTn2 \ x% - 5h>$F.NU.]evoy<~2<(`;3 ,<!@P `)088B8LHV<[Pjnjy<}DD`p~4r04:  RzX| Z`1B $uV$<-b4FD=tD(L  $S\hd!lrzr.0 p  (L  ,`f +,`$hJP +4&3$<DxKSf\n:bfh&n4uF`{P r?\  +y;3ixh[$PY^s~ &Q-R9?ZFM.T2ZD_ f lFsy7<Z L4crt0.ocatman.o_sccsidOumask.ochmod.ochdir.omkdir.ofprintf.ofprintf.oprintf.oprintf.ofilbuf.operror.oerrlst.osystem.oOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTrindex.ostrcmp.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_man_printf_cat_nflag_system__ctype__chmod_execl_fprintf_pflag_closedir_umask_buf_unlink_readdir_chdir_sprintf_fopen_strcmp_wflag__filbuf_perror_strcpy_stat_rindex_mkdir__iob_fclose_opendircerror__pfile__print_read_fflush_fstat__sibuf_malloc_sys_errlist_write_errno_sys_nerr_strlen_wait__exit_fork_signal__sigfunc__sighandler_syscall_execle_execv_execve__flsbuf_fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_close__lastbuf_isattyd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_creat_openptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[FlقWo Y7bx*by;HPX`hp 8A $G"I#HTHS/N4 /NlXNuNuNV. lHy4NXHxNlXHyR n /(N`PJfR`X S n /(aXJg n /(NX#\`H n /(NX#f" n /(HyUNPHxNlX y#\~`lHy Ю @/NP09(H//9\ Ю @/N Jl&J`f Ю @/N,X#XRm/9XNlX..N^NuNV. .R @HH.g ) @fB`p..N^NuNTHxN@eNuNV.N N*@Jg//.N`PJfNF *nN^NuNVJfHyHyNP#`/9NXN^NuNVJg/9NXBN^NuNV.*n` :gRJfJgB *nN^NuNV.Jf"HyHyNP#fB`/9HxHyDtNX *@g#HxHUazX*@#H|HUajX*@HUNX#HHUaPX*@HUNX#HBH#HHUa&X*@#HHUaX*@#HHUaX*@#H`  gRJfB <Hx*nN^NuNVA -H#dHn/.NP09 gp`BN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n|f +|l`D/.N`X+@f,mJf,0-g-HHH+@`m+n |f09gHyN:X0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9$ll  @*PJg*LZ`0SR`*0Hb1 nRJfHc0R 9nB <HL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NJ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|$t+|$t+n 0-gl(m m R Э "-d f -,/HT-HH/NJ .+L`/.N`X(@+Lfm`m+n B,`* -.,o+L/HT-HH/NJ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NJ g m p`BL0N^NuNV.*||` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N`XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (||` eB` 0,f -+fp`B, wf0Hx/.NN@eNuNVHn/.N0PJlB`pN^NuNTHxN@eBNuNTHxN@eNuNTHxN@eNuNTHx&N@eNuNV/. Hyt /.NV N^NuNV/. Hy@t/.NV N^NuNTHx6N@eNuNVH0JIf8 <I#I <I#I#II#II .^rNZ.*yI BI g`(*(U g " Ҁe " Ҁd(M *@bIfIgB`RI Io "<N`#IBNX(@ 9I" Ҁe 9I/NX(@g yI 9IXg yI  9I" ҀY(#I <I A ` " Ҁ#I I c A#I A 9I *A L0N^NuNVH0*n(MY#I (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNZ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ I L0N^NuNTHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL Hx Hy$D/N g" n /(HyxNPHxNX T)gHyNXHxNX~`< Ю @/aXJf Ю @/Hy` Ю @/NPX-@Jf Ю @/Hy` ."9$N" 9%N$ ."9$N"9$`F" 9$\NԀԹ$T ."9$N`"9$N"9$Ԁ 9$p -BB//N> /9$tHyD/N $tg$ Ю @/HyNP# /9$tHyD/N ."9$N`-@B .DЮ @BR mB/./N> /9$tHyD/N Rm/9`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBP`b yDD S m. .R @HH yDD"(R!AS AHH` /9DD .R @HH/NPRP nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHQ @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHQ @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNfЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|)`-|,`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|/`J.g -|1`J.g-|3AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr Nf0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HHQ @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Tb1 nRJfTc0R 9nB <TL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NBPJmJn -|`-nf9HH/NLXJgm+|DL+|DL+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX4e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NvXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N< n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jf8 <# <### .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<N#BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#8BNu /й8/@HxN@e 98#8NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLdjqvyJh$$8.8HH<Vr<<L(3p07>EMV]eLoy<<~4r0qP <> D"`) $D07=JG DDO\W.]cPlnrfxffF$<Z?f  DLyLB;v43L2 'i.<50;xB[^HOUY ^s*gmQtRjZ dL7  Lcrt0.oclri.o_sccsidprintf.oprintf.oatoi.olmult.oneg_resultpos_resultzero_resulta_negb_neg_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_atoi_printfulmult_write_status_lseek_bufulmodt_sb_unuldivt_open_isnumber__pfile__print__ioblmult__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufcerrorptwo_gtty_ioctl_stty_realloc_sbrk_end_brk_errnob[Hlٺ< :**by=x <$G"I#HTHS/N4 /NpXNuNuNV.BNJg BNpXHyHN6XHy(HyJHy4N HyS(m 9,R, @`Hy(N@X, ,g g ff`gS(m 9,R, @`Hy(N@X/aX*mS(m 9,R, @`Hy(N@X, g fbR`Hy(N@X`4 g@ %f| S(m 9,R, @, f B`H*L g< fhhHy(NX`2S(m 9,R, @`Hy(N@X,`L0N^NuNVH..B`N "HA HABAЁЇ0,S(m 9,R, @`Hy(N@X. % @fHy(/NxP dop` LN^NuNV/.aX/aXN^NuNVH HnNX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN-@Jl QS*|Dt .rHxNX-@HyDNXJg8/.HxNP/.NXN^NuNVHxHyDN.P`PJg" .c .`-n-|HzHxNP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n(f +|`D/.NX+@f,mJf,0-g-HHD+@`m+n (f09LgHyX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n Jm m#p`T .# @(P .# @ gf ` <//.Hx0N `NqL0N^NuNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNHx;N@eNuNHxN@eJgBNuH // |# pNLNw //W.BN@d W/N WNNVBHnN^PJlp`Jg n .N^NuNHxtN@eNuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nN@eNuNVHn/.NHPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNV/. Hyt /.Nn N^NuNV/. Hy@t/.Nn N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JDf8 <D#D <D#D#DD#DD .^rN.*yDBD g`(*(U g " Ҁe " Ҁd(M *@bDfDgB`RD Do "<N#DBNX(@ 9D" Ҁe 9D/NX(@g yD 9DXg yD  9D" ҀY(#D <D A ` " Ҁ#DDc A#D A 9D*A L0N^NuNVH0*n(MY#D (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ D L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL.EK;RYa.jqwL>  #|\Q^  $Xfh3H n'(-3: D?nDcrt0.ocron.o_sccsidctime.oOftime.ofreopen.ochdir.osleep.oOalarm.oOpause.osetjmp.osetjmp.ofilbuf.oOsignal.oexec.oexec.oexecve.ofork.osighandler.osyscall.otime.ogettimeofday.octype_.oflsbuf.oexit.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostat.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_realloc__ctype__execl_wait_free_number_sleep_freopen_localtime_chdir_cmp_ungetc_loct_ex_fork_crontab_init_slp__filbuf_stat_signal_malloc_time_itime_flag__iob_listsize_list_fclose_dysizelmodt_ctimeldivt_ftime_asctime_gmtimecerror_lseek_errno_creat_open_close_alarm_setjmp_longjmp_pause_read_fflush_fstat__sibuf__sigfunc__sighandler_syscall_execle_execv_execve_gettimeofday__cleanup_write__sobuf__flsbuf__lastbuf_isatty__exitptwoulmodt_gtty_ioctl_stty_sbrkuldivt_end_brkb[/Ilٺ P**by> 0], \$G"I#HTHS/N4 /N4XNuNuNV.`B n /(NtX-@Jg" $ @ X SR m $ @B`TX n P -f: n P(HH ig n P(HH/Hy4NPR$t n /aXSf 9$t..N^NuNVHB/.N P#$xJl/.HyANPR$t`B$/.HyQNPNNHx HytHxa T g /.HyV` 9,"9Nj#$|R/NtX#lJf&/9$|/.HymN HxN4XB` йl @BR$|oB$B`z 9,/Hy$| 90"Nj$ 9F"€ 9NjԀԹ 9/a8 B` $|/aXR$R,mRm~B$B`z 9,/Hy$| 90"Nj$ 9F"€ 9NjԀԹ 9/a B` $|/a&XR$R,mRm~/9lN&XLN^NuNVH0*np0 @fB-M#$`"Hl/9$/HyNR$tHna2X(@`zJg $|b eB`: .$ @ f"Hl/9$/HyNR$tR .$ @Jf йl @R`zf~L0N^NuNVH *n.9$p0f йl @Jgd0-H"ҹl AfJmfHJ$fHyNXR$0-H/ йl @//9$HyNL N^NuNVH0*n m  mB` "9-@fv/aX-@Jg l .R"9 m"( m 9` m ( "9FйS/Hm ."9/a0 A 9F(Hp0,ѕJgJ L0N^NuNV.B .r //9$xN /./. /9$xN g(/.HyNPB` . Ї @BRm..N^NuNV l 9$(".Ё @`\  .o/9$HyNPB`2Hx Hn y$ (X"9/a A . N^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^NuNVA -H#$Hn/.NP09 gp`BN^NuNhHx$N@eNuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBd`b y$ S m. .R @HH y$"(R!AS AHH` /9$ .R @HH/N,PRd nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|0-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|1 PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|3`J.g-|5J.g"/.NX".-A< o-@ .Xf -|7L`-|HLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNt-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|Y`-|\`Jl-| n P @-h-h/./.N8PJf/./.N`PJfHnHn .R l .R`p//./.N@-@Jg -|_`J.g -|a`J.g-|cAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".N|gP .S-@HJlD-@HJHg6 .Hr N0S n .Hr Nt`S n0A .ذbJn/9$/9 .".N|fp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N8PJf/./.N`PJfHnHn *LZ`0SR`*0db1 nRJfdc0R 9nB <dL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N^ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N^ .+L`/.NtX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N^ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N^ g m p`BL0N^NuNV.*|` HUaXde*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N&XBBBB BmB- L N^NuNVN/.NtXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNhHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NDPJlB`pN^NuNhHxN@eBNuNhHxN@eNuNhHxN@eNuNV/. Hyt /.Nj N^NuNV/. Hy@t/.Nj N^NuNhHx6N@eNuNVH0Jef8 <e#e <e#e#ee #ee .^rNn.*yeBe( g`(*(U g " Ҁe " Ҁd(M *@be fegB`Re( e(o "<Nt#e(BN&X(@ 9e(" Ҁe 9e(/N&X(@g ye 9e Xg ye  9e(" ҀY(#e <e A ` " Ҁ#eec A#e$ A 9e*A L0N^NuNVH0*n(MY#e (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNn.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ e$ L0N^NuNhHxN@e#hBNu /йh/@HxN@e 9h#hNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLG b$tOzV $xZaHg $|m $|u {t $ $ $ $ $.hXnff@f,`Ft|*$8!?0'-7^>  $FLNU;\df3nvt}i x[P|Ys<QR*Z DXDj$ 7P&n e,%* d1crt0.odcheck.o_sccsidatol.oprintf.oprintf.osync.olmult.oneg_resultpos_resultzero_resulta_negb_neg_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_pass1_pass2lmult_atol_printf_sync_ecount_lseek_free_fsun_readdir_nerror_bread_fi_check_bmap_itab_nfiles_open_malloc_ilist_ino_headpr_gip__pfile__print__iobcerrorulmult__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_fflush_fstat_close__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[EJlٺ 4 Y**by? 8^\ $G"I#HTHS/N4 /NXNuNuNVH8HzHxNPHxNX o n h -fRSX JgBHxHyPNP#4HxHy/N BB/94N BHy8 o n (` <`/NPJ9NN0SR/9*LZ`0SR`*0eb1 nRJfec0R 9nB <eL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N" .B`T0-f(mfHn-HH/NPJmJn -|`-ntf9HH/NXJgm+|E+|E+n 0-gl(m m R Э "-d f -,/HT-HH/N" .+L`/.N8X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N" . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N" g m p`BL0N^NuNV.*|`` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N8XN^NuNV .". nJ/H?N n g B5H 4` !FLN^Nu?H<"Ba` H<"a&atLBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|``eB` 0,f -+fp`B, wf0Hx/.N\P.JgJm/NXHx` afvJgp`p//.NP.lB Ef6Hx/.N\P.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN,HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN,HxN@eBNuN,HxN@eNuN,HxN@eNuNV/. Hyt /.N. N^NuNV/. Hy@t/.N. N^NuN,Hx6N@eNuNVH0JfDf8 <fH#fD <fD#fH#fHfP#fDfL .^rN2.*yfLBfX g`(*(U g " Ҁe " Ҁd(M *@bfPffDgB`RfX fXo "<N8#fXBNX(@ 9fX" Ҁe 9fX/NX(@g yfP 9fPXg yfP  9fX" ҀY(#fP <fD A ` " Ҁ#fLfLc A#fT A 9fL*A L0N^NuNVH0*n(MY#fL (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN2.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ fT L0N^NuN,HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLej "&+28?A,GNQU]dlkrx}x |HL`>|  !(/V6=bAH<N S?\ckrxfN"@t$.\ |.|!+5<:IVMX<\dm3u|(8 <(B<,8~4!r*017p? H"OV]dfmWPt {o  .`84<O?hF8~ ,t; N$e# +LZ3< %D4L[T[ %c8k Eu EQ* nf2?>  Ey38!ib(/5x<[6BIOYXsagQXnRzBZl.\.72 f\crt0.odmesg.o_sccsidctime.oOftime.onlist.ofseek.oprintf.oprintf.ordwr.oOalarm.ofilbuf.oOsignal.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_printf_msgbufp_write_alarm_nlist_lseek__flsbuf_ctime_omesg_done_sflg_open_msgbuf_signal_time__iob_pdate_nl_of_timeout_dysizelmodt_localtimeldivt_ftime_asctime_gmtimecerror_fopen_close_fread_strlen_fseek_fclose_fflush__filbuf__pfile__print_fwrite_fstat__sibuf_malloc__sigfunc__sighandler_errno_syscall_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[]KlٹJ h**by@ @x t$G"I#HTHS/N4 /N0XNuNuNV.BNXB n /(NPJg n /(N(XHxN0XBHx BN Hx Hy(0BN g n /(N(XHxN0XHy(PN,X//9-Hy4Nd /9(D/9(@/9(R .+mHyNdXBB` 9(̐(`l 9(̐` 9(`-@/HxNP".+ A B ."9(hNй("9(r /BN /. .+ @/BN g n /(N(XHxN0X 9(`ѮR .(m,B`v ."9(+ @ "9(F®Ё-@Jg .rNJfHyNdX n/( /(//(HyNdR .(\m~HyNdX 9("9(NJgZ 9("9(N-@/HyNdP ."9(N"9($9(Np/HyNdPHyNdXB` /.aXR .(\m$.N^NuNV./.HyNdPB 9(".N$"9(LF® 9(HNԀԹ(< 9(p /BN BNX-@/9(`Hy0BN (`gHy NdX`Hy8N,X//./9 Hy3Nd/9D09BH/09@H//9`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9H4l  @*PJgQ^rError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVHxB/.N N^NuNV4.-nBx`b yH0 S m. .R @HH yH0"(R!AS AHH` /9H0 .R @HH/N(PRx nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHE @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHE @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-| LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNp-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-| `Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn .R l .R`p//./.N<-@Jg -|#`J.g -|%`J.g-|'AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NxgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr Np`S n0A .ذbJn/9/9 .".Nxfp+`p-S n.HHE @gpE`peS n`Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn *LZ`0SR`*0|b1 nRJf|c0R 9nB <|L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NZ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|H8+|H8+n 0-gl(m m R Э "-d f -,/HT-HH/NZ .+L`/.NpX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NZ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NZ g m p`BL0N^NuNV.*|` HUaX(e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N"XBBBB BmB- L N^NuNVN/.NpXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNdHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N@PJlB`pN^NuNdHxN@eBNuNdHxN@eNuNdHxN@eNuNV/. Hyt /.Nf N^NuNV/. Hy@t/.Nf N^NuNdHx6N@eNuNVH0Jf8 <# <### .^rNj.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<Np#BN"X(@ 9" Ҁe 9/N"X(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#Թc A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNj.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNdHxN@e#,BNu /й,/@HxN@e 9,#,NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL$G"I#HTHS/N4 /NXNuNuNV.|0 o n hPB*|4`.gee*|4 3 HyBNP||||||HnHytBN HnHytBN HxN(XHyBNPHx aXHx aXHx HnNPHna\XHyXaPX/-aFXaJgJf Jg3JgyJgyJgyHyBNPHx aXBHyHyeHyZNHxNXm`8NVH BBB*|HxHnBN Jn BNX..fB`2 f HxNX g gd am znR`x Am ZnR`` f.cXSHxaXHx aXHxaX`4 fHx aXHx aX` f~_.HH/aX`B fRJgHxNX-@HyFpNXJg8/.HxN(P/.NXN^NuNVHxHyFpNP`PJg" .c .`-n-|HzHxN(P-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH0*n Jm m#hp`T . @(P . @ gf ` <@//.Hx0Nl `NqL0N^NuNV/9Hn /.N6 N^NuNV/9/. /.N6 N^NuNVA -H .X @Jf n/Hn /.N6 N^NuNHx;N@eNuH // | pNLNw //W.BN@d W/N WNNVN/.N$XN^NuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHxN@eNu#hpNuHxN@NVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N:PJmJn -|`-nN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNVH0JFf8 <F#F <F#F#FF#FF .^rNv.*yFBF g`(*(U g " Ҁe " Ҁd(M *@bFfFgB`RF Fo "<N|#FBN.X(@ 9F" Ҁe 9F/N.X(@g yF 9FXg yF  9F" ҀY(#F <F A ` " Ҁ#FFc A#F A 9F*A L0N^NuNVH0*n(MY#F (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNv.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ F L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL ('. 8@E hLlU]d6lv$}  pf,y.L:;n|.(3D &p7X.F|v F` crt0.ogetty.o_sccsidgethostname.osleep.oOalarm.oOpause.osetjmp.osetjmp.oOsignal.oexec.oexec.oexecve.osighandler.osyscall.octype_.oexit.oread.ostty.oioctl.owrite.ocerror.o_exit.oflsbuf.odata.ofstat.oisatty.oclose.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.o_exitstart_main_environmcount_read_write_tmode__ctype__gethostname_puts_ioctl_name_execl_crmod_sleep_upper_putchr_stty_itab_lower_partab_getnamecerror_alarm_setjmp_longjmp_signal_pause__sigfunc__sighandler_errno_syscall_execle_execv_execve__cleanup__exit_gtty__sobuf__flsbuf_free_fflush_fstat_close__lastbuf_malloc__iob_isatty_fclose__sibuf_realloc_sbrkldivtuldivt_end_brkptwob[Mlٹ c**byB  @? $$G"I#HTHS/N4 /N$XNuNuNVHHxNPX-@B-|SX Jn^Jg:HyNXЮ @ df HyHyNPHxN$XHxHxNPHxHxN"P f HyHyNPHxN$XJfn~Hx HxN"P f6 hgHHyNXHxHxN"PHxN$X oHyHyNP .faJf, .faNNHxaXNZ/.Hx7NlPHy,NX`Hy3 n /NPJf `rHy6 n /NPJfB`RHy9 n /NPJfR`4Hy /NX..N^NuNVHnNXHnNX-@HypHy[NP-@JgvHxB/N, n (l//( (^ @/ n (B @/ n/(/(Hyr/.N /.NXN^NuNV/.aX/aXN^NuNVH HnNX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J8 @, -J< @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrNB" L N^NuNVH n "<QNB-@ n "<QNT-@Jl QS*|G$ .r HxHyHxN> HUNX/HUHxN> HxHyHxN> L N^Nu0:Tfx)9HYm*@Zx,Nl>Wq2ERfzError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#hp`T .& @(P .& @ gf ` <@//.Hx0Nl `NqL0N^NuH // |& pNLNw //W.BN@d W/NH WNNVBHnNPJlp`Jg n .N^NuNHHxtN@eNuNV4.-nBG\`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRG\ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH! @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH! @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNBЮLЮ@ @S"n .P".DNT-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N(PJf/./.NPPJfHnHn .R l .R`p//./.N0-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NlgP .S-@HJlD-@HJHg6 .Hr NB0S n .Hr NT`S n0A .ذbJn/9/9 .".Nlfp+`p-S n.HH! @gpE`peS n`Jl-| n P @-h-h/./.N(PJf/./.NPPJfHnHn *LZ`0SR`*0G`b1 nRJfG`c0R 9nB <G`L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N> .B`T0-f(mfHn-HH/NrPJmJn -|`-nf9HH/N|XJgm+|'+|'+n 0-gl(m m R Э "-d f -,/HT-HH/N> .+L`/.NTX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N> . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N> g m p`BL0N^NuNV.*|t` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNx/.NTXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|t`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB hf6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N$PJlB`pN^NuNVH B/.NP. g `/NXB`Hx NTX*@Jg*B L N^NuNHHxN@eBNuNHHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHHxN@eNuNHHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NJ N^NuNV/. Hy@t/.NJ N^NuNHHx6N@eNuNVH0JGf8 <G#G <G#G#GG#GG .^rNN.*yGBG g`(*(U g " Ҁe " Ҁd(M *@bGfGgB`RG Go "<NT#GBNX(@ 9G" Ҁe 9G/NX(@g yG 9GXg yG  9G" ҀY(#G <G A ` " Ҁ#GعGc A#G A 9G*A L0N^NuNVH0*n(MY#G (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ G L0N^NuNHHxN@e#dBNu /йd/@HxN@e 9d#dNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL$FP$Z<_2nrN}<P <;l|3 !DT ,$,.<8<=DLP^[<_8f8nHwT$~4r0Sp>dJ h h4l^? t"![B'-;4<DJT$\.tbe,i $po[Px.ZOBWFT .HL r T ! &+@8QF OnVUf0[fdPklqz(? x  'y3|Tix[@lYzs,QR)/Z6.=8B<IQZ<[d!lr {$J70N Gcrt0.ohalt.o_sccsidctime.oOftime.okill.ofseek.ofprintf.ofprintf.oOalarm.oOpause.ostrncpy.osync.ofilbuf.operror.oerrlst.oOsignal.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_setalarm_write_strncpy_alarm_sync_dingdong_lseek_fprintf_errno_wtmpf_syscall_months_localtime_fopen_strcmp_kill_days_open_close_perror_signal_time_markdown_strlen__iob_fseek_wtmp_ttyname_fclose_log_entry_pause_dysizelmodt_ctimeldivt_ftime_asctime_gmtimecerror_fflush__filbuf__pfile__print_read_fstat__sibuf_malloc_sys_errlist_sys_nerr__sigfunc__sighandler_gettimeofday__ctype__fcvt_ecvt__flsbuf_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_strcat_closedir_readdir_strcpy_stat_opendir_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[Nlٹ́ |** byD    $ ,  P l$G"I#HTHS/N4 /NXNuNuNV.#)$` dg. mg0 sg0HyN|X n /aX`R)`R)`|RQ`tX n P -f n P(HH bfB n /(NB` 9Q Ї @BReB` 91"N$ 91 F"€ 91NԀԹ1-BJf 91"N-@`4 91"N$ 91 F"€ 91NԀԹ1 -B/HyHnN$ ` /914Hn/.a 91<Ѯ .m 91"N$ 91 F"€ 91NԀԹ1-B/HyHnN$ ` /914Hn/.ad 91<Ѯ .m 91"N$ 91 F"€ 91NԀԹ1-B.91|`J 9YЇ//9YHy HnN$/914Hn/.a ߹Y 91<Ѯ .mJfF 918Sй1"918N(Ѯ`/918Hy/.a R .mR10mBYBQ$B`z 91/HyQ 91"N$ 91 F"€ 91NԀԹ1 91h/a B` Q/aHXRYR1mR10m~BYNJQg.a n/9QNêXJQ g/9Q NX`B)B) B`^ 91"N-@/91Hy 91"N$ 91 F"€ 91NԀԹ1 91h/a U g/HyN|PB`.R) /914Hy4 .Ю/a 91<Ѯ .1l"91 91<"91(N".m$/. /9Y/.Hy2N|p`. ."91X-@1B .rNšt .rN( @S ,R eB . ` @BB . ".Ё @BPR mR mJf 918Sй1"918N(Ѯ-n`, .rNštF .rN( @R .mB`BB` .ЮЮrN(йQ @HH .ЮЮrNšrāf4 .ЮrNšt .ЮrN( @R`0 .ЮrNštF .ЮrN( @R .హ1 n/(8Hy-HyN< N^NuNV n (8S b@0;N^Dv"vvv` . Ю @B`r .rF .Ю @`P .rF .` .rF .` n/(8HyEHyN< N^NuNV n (8S bz@0;NZBp"ppp`| . Ю @`l .r .Ю @`L .r .` .r .` n/(8Hy^HyN< N^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^NuNVH0 .". N-@/N(X*@fB`(M .VrN".`BSl L0N^NuNV/.NXN^NuNVA-H#YHn/. NP n0( gp`BN^NuNVA -H#YHn/.NP09 gp`BN^NuNHx$N@eNuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9Y l  @*PJg*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NvPJmJn -|`-nf9HH/NÀXJgm+|Y+|Y+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N(X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|t` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NêXJl~0-g /-NXBBBB BmB- L N^NuNVNBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jhf8 <l#h <h#l#lt#hp .^rN".*ypB| g`(*(U g " Ҁe " Ҁd(M *@btfhgB`R| |o "<N(#|BNX(@ 9|" Ҁe 9|/NX(@g yt 9tXg yt  9|" ҀY(#t <h A ` " Ҁ#ppc A#x A 9p*A L0N^NuNVH0*n(MY#p (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN".d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ x L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@||||Bad flag %s: Not enough core; duplicates unchecked No Updates spare super block %dcylinder group %dinodes %d-%dcsumcg %d: bad magic number free blockfree fragfiles %6u (r=%u,d=%u,b=%u,c=%u,sl=%u) used %7ld (i=%ld,ii=%ld,b=%ld,f=%ld) free %7ld (b=%ld,f=%ld) %ld missing missing%5ld bad mode %u logical data block %d1st indirectlogical data block %d2nd indirectlogical data block %d%ld bad; inode=%u, class=%s %ld dup block; inode=%u, class=%s %ld arg; frag %d of %d, inode=%u, class=%s %ld dup frag; inode=%u, class=%s bad size %d to duped bad bno %d to duped bad super block%s: bad magic number FS SEEKFS WRITENo Update isblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d @(#)icheck.c 2.4 (Berkeley) 11/18/82Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ . 40<#t,<6<@|I|R.Ya0lw".P$$$F> "* 07<(@ILOS@X_e?nt:{~0F@p h"*2HP %,40:x@HEfNU\cjnlu{ ?^HjDn4Nr~<XH'$l..l6|>H|R<WŠfFj¦u<ypÀ3äø(ǀ<2<   $(,28~4>rG0NT[ ^ a{kqt<w| )  I)|  )r< ) )|yBš ;)  ")$ >0| 0!F$* b02 18 ?F(EOkWv4_ *Qh QlTs z HQ  Q Qsþ<êP Q Q Q (z Q$ Q(.tX Q, Q4 Y"(% Y-5<I Y PZ$HbQpfy nf0Rp?<  YLv 3Àf( ipdxH&[,309Y>Bs^KQQXRdjZq yy ~”7 crt0.oicheck.o_sccsidatol.ocalloc.ofprintf.ofprintf.oprintf.oprintf.osync.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_pass1_cgun_setblocklmult_atol_printf_nbfree_dflg_fragtbl124_write_sync_nblock_lseek_fprintf_nffree_mflg_fragtbl_free_chklmodt_isblock_nlfile_blist_nindir_clrblock_fragtbl8_nfrag_sprintf_nerror_sbun_breadldivt_fragacct_calloc_around_niindir_fi_getsb_check_bmap_itab_sflg_makecg_open_close_perror_bwrite_nbfile_nrfile_ndup_malloc_time_duped_cginit_ncfile__iob_inside_ndfile_fsblist_inoulmultuldivt_cfree__pfile__printcerror_sys_errlist_errno_sys_nerr_strlen_gettimeofday__flsbuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_fflush_fstat__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[Olقn Ebx*byE   ( (E$$G"I#HTHS/N4 /NXNuNuNVBNX# oX n h -fJB n (R-@` sg$ nJg.HHR af``-|HyNdXHz HxN(PHz HxN(PHxHxN(PHxHxN(PHxHxN(P-n-|Hy8NdXJfa( .ga/.aXJga"aD`NVH HxHy\N$P/N^XHxHxN(P*|`HUaXB @eHz`HxN(PHxNJXBHx HxN~PR mBNX fBNJXaL N^NuNVNFJfDHxHytNrP-@Hx7Hy/N HxNXHxNXHxNXaHxHy8NvPN^NuNVHBN>XBHxN(PB/N^XR mHxHyfNrP,JmtHxB/NJ HxHyHy @N HxHyHy HN Hy PNXHxHy @/N /N^XpLN^NuNVHNF.JfrBHxN(PBHxN(PBHxN(PHxHytNrPBNnXBNnXBHyHHy4N BNXBNX,g f pf gVLN^NuNVHNF.JfBHyNrPBNnXBNnX .g BHyJHy4Hy4N`$BHyHyJHy4Hy4NHxNXHnNXfJgB`HxHyfNrP,JmHxB/NJ HxHyHy @N HxHyHy HN Jg# PB`Hy PNXHxHy @/N /N^XpLN^NuNVHzHxN(P#lN^NuNVH `aBlHzHxN(PBNX.Jlf g8*| @d - g fHUa2XHUaX`L N^NuNV.*nJ gHUaXHx /- N~PB *nN^NuNVHa.JlB`Jga.JoHxHyHyN Ba.Jo" AR l`al.JnJ9g 90gxHyHyxNPHxHyHyxN HxHyxNZPJm2pLN^NuNVHxHn/9N gp` . fB`.HHN^NuNV.BHyRNrP#Jm*|` B-  @e`8/9N^X*|`- 9-g- yadJg*|` HxHyHUN Jg @e*| @dJfHxHyHUN - ``- f HUaXB- gHUaXHUaX @e*nN^NuNV.BHnNX nR n . HxNJX-@HyLNdXJg8/.HxN(P/.NJXN^NuNVHxHyLNvP`PJg" .c .`-n-|HzHxN(P-@/.NJXNZ`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuT\f .@Lbt (@Mcr~,=\s+JZq>`uError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#pp`T . X @(P . X @ gf ` <X//.Hx0N `NqL0N^NuNV/9Hn /.N6 N^NuNV/9/. /.N6 N^NuNVA -H .X @Jf n/Hn /.N6 N^NuNHx;N@eNuNHxN@eJgBNuH // | X pNLNw //W.BN@d W/N WNNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNVN\/.NXN^NuNVH *nB`RJf L N^NuNV/. Hx/.Nr N^NuNHxN@eNuNHx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N\PJlB`pN^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNVH0JM f8 <M#M <M #M#MM#M M .^rNv.*yMBM g`(*(U g " Ҁe " Ҁd(M *@bMfM gB`RM M o "<N|#M BN.X(@ 9M " Ҁe 9M /N.X(@g yM 9MXg yM  9M " ҀY(#M <M  A ` " Ҁ#MMc A#M A 9M*A L0N^NuNVH0*n(MY#M (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNv.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ M L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL'0-Z4;dE  XOX\emt6|Q\|   fy.L|.h3 ,\< 7X.F|v% M$*/crt0.oinit.o_sccsidOvhangup.oacct.ochmod.ochown.odup.okill.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrncat.ostrncmp.ostrncpy.oerrlst.oOsignal.oexec.oexec.oexecve.ofork.osighandler.osyscall.otime.ogettimeofday.oexit.ostrlen.ocreat.olseek.oaccess.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTclose.oopen.oread.ostrcpy.oioctl.optwo.owait.owrite.ocerror.o_exit.oflsbuf.odata.ofstat.oisatty.ostty.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRST_exitstart_main_environmcount_sjbuf_read_shell_strncmp_shutdown_sys_errlist_ctty_utmp_vhangup_ifile_multiple_write_rline_strncpy_alarm_chmod_ioctl_lseek_dup_setjmp_execl_longjmp_shutpass_waitlmodt_chown_mergflag_errno_sleep_wtmpf_dfork_minus_reset_term_tty_runcom_strncat_time0_fi_line_setmerge_kill_dev_creat_itab_fork_runc_open_getty_merge_access_close_shutfailm_strcpy_signal_single_get_shutreset_time_strlen_idle_wtmp_shutend_acct_rmut_pausecerror_sys_nerr__sigfunc__sighandler_syscall_execle_execv_execve_gettimeofday__cleanup__exitptwoulmodt__sobuf__flsbuf_free_fflush_fstat__lastbuf_malloc__iob_isatty_fclose__sibuf_gtty_stty_realloc_sbrkldivtuldivt_end_brkb[Plٹ- b**byF 0 8 @ H P X? @?4 4$G"I#HTHS/N4 /NXNuNuNVB`b pg| rglHyNXHxNX`6JoZ n P -fN n P(HH bfR-|SX ` hfR`R`R`Jo n #X SHyJ/9NPJ9Nf(/9HyHyN HxNXJo n #Rt/./9NP#JlB/./9NP#Jl.Hy HyNP/9NXHxNX/9HyHyN JgHy/HyNPJgHy=HyNPJgHyKHyNPBBBJtg 9R-@B//9N 9^"HAHABAЁ#^/NhX#JfHyYNXHxNX/9^/9/9N HxaX-@Jg -|`JgB`-nJg"JfJfHy`HyNPaFJga/.a XJg <` </HyzHyN N^NuNVHxaXHxHyNP-@JlHyN`HxaX#HxaX#B//9a -y`^ l .` </Hn/9N l .` </Hn/.NR JnHxafX#xrNb-@/NhX#|Hxa:X-@B//9a /./9|/9N -@g8/./.HyHyNHyNXHxNX 9xrdNb"HA HABAЁ-@/NhX#HxaX-@B//9aL /./9/9N -@g8/./.HyHyNHyNXHxNXHxa X#Jg"/9x/9HyHyN .rNh-@B`> .й| @JPg& .й-@ .й| @0-@`Jg\ ."HA HABAЁй @/( ."HA HABAЁй @//.HyHyN-n ."HA HABAЁй @-P ."HA HABAЁй @-hHx Hn/.NR ."HA HABAЁй @0(`JfR .찮m/.NXN^NuNVHxaXHxHnN,PHxaDX#Hxa4X#  B/9/9a -y`R l .` </Hn/9NR JlHy;NXHxNXJnHxaX#xrNb-@Hxa|X-@B//9a@ -n`R l .` </Hn/9NR JlHyFNXHxNXJn 9xrdNb"HA HABAЁ-@HxaX-@B//9a -n`R l .` </Hn/9NR JlHySNXHx NXJnN^NuNV-yvfHy^NXHx NXB/./9a HxHn/9NR N^NuNV ."HA HABAЁR @-Pf: ."HA HABAЁJ @/HyNPHx NXB/./9ah fHyNXHx NXHxHn/9N gHyNXHx NX .N^NuNVJtg0 . r й @p0(@r ". Ё-@ /./. /.N N^NuNVH0B(n B`4 TJg2B,BBlB,/NX*o-E RJfHy/.N@P-@JfB`/.HxHx HnN@ g& g  g/.NXp`P  f <`p ЮЮЮЮ-@Ю-@..Jg,<l,B/./.N /.Hx/HnN@*ݮA(H mJgp,fB .Д//.N /.Hx .R/HnN@*n `f UJgdB` Ѕ @AfBR Ѕ @JfAJf,+ll;llSf/.N:X`x Jf `4L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/N "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/N -@ nBJg n S m n (R!@S @`t/.NdX`f n0(gV/NX n0(gB nh n"H#h/./. n(HH/N -@ fp`BLN^NuNVA-H#Hn/. NdP n0( gp`BN^NuNVA -H#Hn/.NdP09 gp`BN^NuNVH0*n(nBJ f<`D-n Sm ,R @` HTNdX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NPSf0, fR .e .L0N^Nu"o /B/gS @`"Q g2gNuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.NhX+@f,mJf,0-g-HHF+@`m+n f09gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9&l x @*PJg*LZ`0SR`*0Fb1 nRJfFc0R 9nB <FL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NR .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|&+|&+n 0-gl(m m R Э "-d f -,/HT-HH/NR .+L`/.NhX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NR . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NR g m p`BL0N^NuNV.*|` HUaXle*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NhXN^NuNV .". nJ/H?ND n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`leB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB &f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN\HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N8PJlB`pN^NuN\HxN@eBNuN\HxN@eNuN\HxN@eNuNV/. Hyt /.N^ N^NuNV/. Hy@t/.N^ N^NuN\Hx6N@eNuNVH0JGf8 <G #G <G#G #G G(#GG$ .^rNb.*yG$BG0 g`(*(U g " Ҁe " Ҁd(M *@bG(fGgB`RG0 G0o "<Nh#G0BNX(@ 9G0" Ҁe 9G0/NX(@g yG( 9G(Xg yG(  9G0" ҀY(#G( <G A ` " Ҁ#G$G$c A#G, A 9G$*A L0N^NuNVH0*n(MY#G$ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNb.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ G, L0N^NuN\HxN@e#pBNu /йp/@HxN@e 9p#pNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLW]Belr"yF~~Rp,$@..*<.2=<AIR3ZahoXwh@@P<X&r<LL\h~4r0d! ]t(. x:BIRPW_nPjr |y      ?@{, +Fh.b ; -h. J$ *t@1N@8$@eG:OLWd` hdp[xf x &nf&Db?n  &yl&3.h5i<DC8IxP[fV]cYls2u{QRrZ\L8^7D G4crt0.okgmon.o_sccsidnlist.ofseek.ofprintf.ofprintf.oprintf.oprintf.ordwr.obzero.obzero.ofilbuf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_dumpstate_kflag_read_s_textsize_printf_kmemf_write_nlist_system_turnonoff_kfetch_froms_lseek_fprintf_pflag_tos_Sysmap_s_lowpc_rflag_bflag_resetstate_bzero_sbuf_klseek_debugldivt_creatuldivt_open_ssiz_close_perror_hflag_malloc__iob_nl_kmem_fopen_fread_strlen_fseek_fclose_fflush__filbuf__pfile__print_fwrite__flsbuf_fstat__sibuf_sys_errlist_errno_sys_nerr__ctype__fcvt_ecvtlmodt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltiscerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[Qlق bx*)byH 4 < D L T \ d l t# X$ $G"I#HTHS/N4 /NlXNuNuNV.BSX HyrNX lHytNlXHxNlX n #r/(NX-@Hx/9rNP#rJl /9rHyNlPHxNlXB/9rNbP#rJl /9rHyNlPHxNlXJn/.HyNlPHxNlX o n /(NX#3@` # 3@ o n /( NX#3<` #3Jg /95HyNlPHxNlX ."92-@#2"93N"93DN#3H ."93N$ 93H"93DNoR3H-| 3HlHy NlXHxNlX 3"93@N-@ ."92N-@ .5".Ё @ Pf .7 @B`, .5".Ё @0H".7 A .5".Ё @0` 92#2 92"92"93$92N"93Dn/92/93JgR2 93D"93LN"93N>JgP/93L/933H 93H"93DN"93N-@#2BJg@ ."93N$ 93HS"93DN 93D/Hy NlP 93T$HBHBBBЂ$"92F 92NԀԹ2#30 92й2S2#34 92rN-@SF#3B3`R3 .-@ n 93D"95N"93$92SЁ"93$92Nb-@й2S2#3/934HxNP#r#T7#2 oB n /(NX#2Jm c2o&Hx n /(Hy ENl # 2#2 92rN#2 o n /( NX#2` #<2B5lB3XB3\B3`B3dB93hB93j/93@/93JfHy NlX 93T".N$"92F® 92NԀԹ2 92/Hy NlPR .2m~Hy NlXa#r2Hy2Hx Hxa B`` 9rЮ/ 9342l 934` 92/ ."92й30"92/a: 92Ѯ .34mB`RHy2Hx 93T".N$"92F® 92NԀԹ2 92/a R .2mBNlX$.N^NuNVH  93T".N-@й3T-@찹2o-y2 93T".N$"92F® 92NԀԹ2-B 93T".N$"92F® 92NԀԹ2-B .йr*@#r# U# 92S".f 93H"93LN>3` 33N33R .쐮#BBB BBBB B` .$ @BR .谹2mB`L-y3`0 .rN>tF .rN @RSJn 93ѹ .谹3PmJflB .rN>t .rN @SR e`, .rN>tF .rN @R mB 93T".N$"92F® 92NԀԹ2 92p //9rN 93P/Hy1/9rNԶ "93Pg&/9rNX"92/Hy NlPB .D @BB .".Ё @BPR mR mJf\ 92Sй34"92NѮB .l"92N/HyHy2a 92Ѯ`B` ."92N/HyHy2a R ."93N"93DND @R ."93N"93DN$ ."93N"93@N>"93@NԀ BRP 92Ѯ .m@ .ѹ2 9ѹ2`0 ."92N/HyHy2a 92Ѯ .mưo$ @R .S-@`0 .rN>t .rN @RS .谮l` ."92N/HyHy2a R ."93N"93DND @R ."93N"93DN$ ."93N"93@N>"93@NԀ BRP 92Ѯ .й2".쒮o4 .쐮".l .쐮$ @R`0 .rN>t .rN @RR .쐮".l.` .rN>tF .rN @R ."92N>Jf ."92N-@`/.HyHy2a R 92"92".m 9ѹ3X 9ѹ3d 9 ѹ3\ 9ѹ3` |*+h+h+h Hy/92 93T".N$"92F® 92NԀԹ2 92/a , L N^NuNV#r2&#r2.#r26HxHy\a4P-|`8p09rXP/ .R/HylN  .2m#23A232#22"p092//92"aP#2>HyR/92""92/aD Hy1aHX#23A232HxHyDaRP#2"p092//92a*P#2>HyR/92"92/a Hy1aXN^NuNVH *n-|-|RB` ."HAHABAЁ$ Ԁ B4(XP ."HAHABAЁ" Ҁ A1B ."HAHABAЁ" Ҁ A0(//. ."HAHABAЁ" Ҁ/N ."HAHABAЁ" Ҁ A0(Ѯ ."HAHABAЁ" Ҁ A0(R . S".m "HAHABAЁ" Ҁ A1n ."HAHABAЁ" Ҁ A0(XP//. ."HAHABAЁ" Ҁ/N ."HAHABAЁ" Ҁ A0(XPѮ .RL N^NuNV.Hy/938 93T$HBHBBBЂ$"92F 92NԀԹ2 92/a UgHy `Hy ,NlXB`LJ gB`4 ."92N/HyHy2a Jf 92Ѯ .mHy S` ."92N/HyHy2a S S3\ yrS . @gRR3X yrR ."93N"93DND @S ."93N"93DN$ ."93N"93@N>"93@NԀ BSP .2g 92SЮ"92N-@ 92А yrѨ 92Аѹ3d 92Аѹ 92А$ @R-n`2 .ЮrN>t .ЮrN @R .2mHy/938 93T$HBHBBBЂ$"92F 92NԀԹ2 92/a .$.N^NuNVH *n -"93PN-@Hy/938 93T$HBHBBBЂ$"92F 92NԀԹ2 92/a UgHy ~NlXHxNlXS -rN8t -rN @Hy/938 93T$HBHBBBЂ$"92F 92NԀԹ2 92/a S3` yrS 93P"92N"-e/-Hy NlPHxNlX -"93PN" 93TN$ -"93PN"92F" 92NԀԹ2 -"93PN8"93N"92Ԁ 92-BHn/92/aN A& -"93N8CЉ"@ <"QHn/92/.a L N^NuNVB .r //9rN Jl,/.Hy NlPHy N$XHxNlX/. /./9rNr -@ g,/.Hy NlPHy N$XHxNlXN^NuNVB .r //9rN B .r //9rN Jl,/.Hy NlPHy N$XHxNlX/. /./9rNԶ -@ g,/.HyNlPHyN$XHxNlXN^NuNV n (8S b@0;Nl0` . Ю @ fp`B` .rA .Ю @r.r.f` .rA .Ю @r.r.f`| .rA .Ю @r.r.fH`> n/(8HyHyN, N^NuNV n (8S b@0;N^Dv"vvv` . Ю @B`r .rF .Ю @`P .rF .` .rF .` n/(8Hy.HyN, N^NuNV n (8S bz@0;NZBp"ppp`| . Ю @`l .r .Ю @`L .r .` .r .` n/(8HyGHyN, N^NuNVH0 .". N-@/NX*@fB`(M .VrN.`BSl L0N^NuNV/.N~XN^NuNVA-H#rHn/. NP n0( gp`BN^NuNVA -H#lrHn/.NP09| gp`BN^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9rl  @*PJgЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NpPJf/./.N͘PJfHnHn .R l .R`p//./.Nx-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NɴgP .S-@HJlD-@HJHg6 .Hr N>0S n .Hr N`S n0A .ذbJn/9/9 .".Nɴfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NpPJf/./.N͘PJfHnHn *LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NԶ .B`T0-f(mfHn-HH/NPJmJn -|`-nlf9~HH/N$XJgm+|r+|r+n 0-gl(m m R Э "-d f -,/HT-HH/NԶ .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NԶ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NԶ g m p`BL0N^NuNV.*|X` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NNXJl~0-g /-N~XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.Nb N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NϜPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0J f8 <# < ###  .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bf gB`R  o "<N# BN~X(@ 9 " Ҁe 9 /N~X(@g y 9Xg y  9 " ҀY(# <  A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL>... lost+found...usage: mkfs special size [ nsect ntrak bsize fsize cpg minfree rps ] %s: cannot create %s: cannot open preposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d maximum block size with nsect %d and ntrak %d is %d cylinder groups must have at least 1 cylinder cylinder groups are limited to %d cylinders cylinder groups must have a multiple of %d cylinders file systems must have at least one cylinder too many sectors per cylinder (%d sectors) %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impared. nsect %d, and ntrak %d, requires block size of %d, and fragment size of %d cylinder group too large (%d cylinders); max: %d cylinders per group mkfs: nsect %d, ntrak %d, cpg %d is not tolerable as this would would have cyl groups whose size is not a multiple of %d; choke! inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group must be increased Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated %s: bogus minfree reset to %d%% %s: %d sectors in %d cylinders of %d tracks, %d sectors %.1fMb in %d cyl groups (%d c/g, %.2fMb/g, %d i/g) super-block backups (for fsck -b#) at: %d, write error %D cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 cg 0: bad magic number fsinit: inode value out of range (%d). seek error: %ld rdfsread error: %ld rdfsseek error: %ld wtfswrite error: %D wtfsisblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d @(#)mkfs.c 2.10 (Berkeley) 4/11/83Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$$. 40#,-,7l@lI.QY]cgmtq|$$xx xd!l(ň0ň8Ƥ>JEJƬNWƞZr]afms?| žƴL̠Xʤ˦\(ˮ,˶@Ȕ&r-̄3\:˄BʴHNS\`cǠj6qxB| ?jʸF˖.p  Tp$p,5$=D.L TΎ^ h<m.|J<$3H\l|ϼdҤ$ҤҴ<Ҽӊ<"Ӱ)԰1:BlHN~4Tr]0drj ^p{zqlƴYԶzD, 1>( 1 2 R N8T")l\9F?kG rMbV wr]?hcji.pw r}b$.X rZL r|y~ r r$Q &n,fx2fd;͘BɴHpOU[agq  ryL:;N3$iBx[ňstQ8Rb" Ӱ Ϝ| 7Ѩ)~/ $4j9crt0.omkfs.o_sccsidcalloc.ofprintf.ofprintf.oprintf.oprintf.obcopy.obcopy.oretbloopbwdbytesatoi.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.otell.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_cgun_setblock_atoilmult_printffflti_initcgulmultfdoublei_write_root_dir_tell_lseek_fprintf_makedir_alloc_zinolmodt_isblock_node_fsun_buf_fsinitulmodt_clrblock_bcopy_lost_found_dirldivt_calloc_fsysieeeused_utimefmuli_wtfs_creatuldivt_fscs_open_perror_time_rdfs__iob_fsiffltis_fso_iput_free_malloc_cfree__pfile__print_ovbcopy_sys_errlist_errno_sys_nerr_strlen_gettimeofdaycerror__ctype__fcvt_ecvt__flsbuf_isnanfcmpi_isinfffixifdivi_modffaddi__cleanup__sobuf_fflush_fstat_close__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpfsingleif_rcpffixisfloatflavorfmodi__sibufptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[Rlقc Nbx*1byI ` h p x  0 .က//. n /(Nb JlHy?NXBNXHyENpXN^NuNVB`< 0m 9op`> ."HA HABAЁЮ0-@ .R @HH-@f .N^NuNHxN@eBNuNVA -H#tHn/.NDP09 gp`BN^NuNVH *| 9l X @*PJgЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N>0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Db1 nRJfDc0R 9nB <DL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-ntf9HH/N$XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|`` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NNXJl~0-g /-N^XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N$ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N|PJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDTf8 <DX#DT <DT#DX#DXD`#DTD\ .^rN.*yD\BDh g`(*(U g " Ҁe " Ҁd(M *@bD`fDTgB`RDh Dho "<N#DhBN^X(@ 9Dh" Ҁe 9Dh/N^X(@g yD` 9D`Xg yD`  9Dh" ҀY(#D` <DT A ` " Ҁ#D\D\c A#Dd A 9D\*A L0N^NuNVH0*n(MY#D\ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Dd L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL$XGDPDYNcDjszz?< |!&-$49AIQXZcj\ov~pN,fr L ? !")06=&BvHO^W2^ePkrz $ .  <.J<$3H\ D%-7AK<P_jcn<ry~4r0pb D.`X  $ &n,f2f;>AHFNT]dj$pBv?|N  y^Lj;N3$ir$x[FYsQh&R2R8Z|? $GL8S|Y`\f7o^u| DlJcrt0.omknod.o_sccsidmknod.oprintf.oprintf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_number_perror_mknodcerror__pfile__print__iob_sys_errlist_write_errno_sys_nerr_strlen__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[%Slٹā j*9*:byJ |  H\ $G"I#HTHS/N4 /NDXNuNuNV g Hy`HyDNPHxNDXHx n /(NP#IB n /(NP#IJImJl n /(NXHxNDX#%I/9IHx Hxa$ yI/(HxN n!@6 n0(& g @g `g fB`0 l2 .N".Ё @ .Ю"@ R n .m n o yI/(0aX n!@~B`8 . Ю @ .Ю"@" . Ю @BR yI (t ".m/./(0 n (~ yI"(d/a n ( yI"(N" yI (N$ n ( yI"(N yI"(F" (NԀ yIԨ n ( yI"(N\ yI"(xN yI"(`Ԁ yI (d-BHn yI/(0/aF .& @"n )"yI")xN\CЉ"@ <"QHn yI/(0/.a `. n0(&/HyNPHxNDX`$.N^NuNV.Hy/9&\ 9&x"9ZN$"9%F¹Z 9%NԀԹ% 9& /a` U gD/9ZHy%NP`(RZ yI 9Z,mrHy>NXB`XJgB`4 ."9%N/Hy Hy%a< Jf& 9%Ѯ .m/9ZHyP`l ."9%N/Hy Hy%a SS& 9ZйI @S ."9&8N"9&hN @S ."9&8N"9&hN$ ."9&8N"9&dNb"9&dNԀ BSP .%g 9%SЮ"9%N-@ 9%"9ZҹI AѨ 9%ѹ& 9%ѹ 9% @R-n`2 .ЮrNbt .ЮrN @R .%mHy/9&\ 9&x"9ZN$"9%F¹Z 9%NԀԹ% 9& /av yI"( 9NЮ$.N^NuNVH *nRV+yV -"9&tN-@Hy/9&\ 9&x".N$"9%F® 9%NԀԹ% 9& /a4 U g/.Hy|NPHxNDXp0-&@gRR&| .йI @RS -rN\t -rN @Hy/9&\ 9&x".N$"9%F® 9%NԀԹ% 9& /a S& .йI @S 9&t"9%N"-e/-HyNPHxNDX -L N^NuNVB .r //9IN: Jl,/.HyNPHyNXHxNDX/. /./9IN -@ g,/.HyNPHyNXHxNDXN^NuNVB .r //9IN: B .r //9IN: Jl,/.HyNPHyNXHxNDX/. /./9IN -@ g,/.HyNPHyNXHxNDXN^NuNV n (8S b@0;Nj,` . Ю @ fp` .rA .Ю @r.r.g` .rA .Ю @r.r.f\` .rA .Ю @r.r.f"`F n/(8HyHyDN BN^NuNV n (8S b@0;N^Dv"vvv` . Ю @B`r .rF .Ю @`P .rF .` .rF .` n/(8Hy-HyDN N^NuNVH0 .". N-@/NX*@fB`(M .VrN.`BSl L0N^NuNV/.NXN^NuNVA-H#IHn/. NP n0( gp`BN^NuNVA -H#0IHn/.NP09@ gp`BN^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N>PJmJn -|`-nf +|I`D/.NX+@f,mJf,0-g-HH+@`m+n f09@gHy0NX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|H 9i԰\l  @*PJg*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N>PJmJn -|`-n0f9BHH/NHXJgm+|i+|i+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NrXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NrXHx` afvJgp`p//.NP.lB if6Hx/.NP.Jg Jm/NrXHx/.NP.Jm.HxB/N: `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDf8 <H#D <D#H#HP#DL .^rN.*yLBX g`(*(U g " Ҁe " Ҁd(M *@bPfDgB`RX Xo "<N#XBNX(@ 9X" Ҁe 9X/NX(@g yP 9PXg yP  9X" ҀY(#P <D A ` " Ҁ#LLc A#T A 9L*A L0N^NuNVH0*n(MY#L (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ T L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL I i\QnvfPf< p:!H(.4:?@@FP  iXb3Hjryix[`YsLQR:Z$. 7 \crt0.omkproto.o_sccsidcalloc.ofprintf.ofprintf.oprintf.oprintf.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_errslmult_printf_protoulmult_write_ucg_lseek_fprintf_alloc_ialloc_ufslmodt_gmode_isblockulmodt_token_clrblockldivt_getstr_fopen_calloc_getnum_wtfs_fs_newblkuldivt_entry_fscs_open_descend_close__filbuf_perror_strcpy_time_rdfs_strlen__iob_ino_fsi_fso_iput_free_malloc_cfree__pfile__print_fflush_fstat__sibuf_sys_errlist_errno_sys_nerr_gettimeofdaycerror__ctype__fcvt_ecvt__flsbuf_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[ATlقMw Y|bx*BbyK  8A< $G"I#HTHS/N4 /NXNuNuNV.BHy4N~P-@HxHyx/N f*|x` JgHUHm Hy>N @xeBNX`fJ|g nHxNjXHxN:XNJfFHyHNXHxNX`(R|SX oHyS n /(NPJgHyV n /(NPJfRp`HyY n /(NPJfR`Hy\ n /(NPJfRx`lHy_ ./NPJglHya . /NPJfp`B#pJpfHyd . /NPJf/9p .//.af Np-@fjBNX g HygHyNDPHxNX/9p n /(/(a *nN^NuNVH0JfB/./. /.N6 Jl(/.HyHyND /. N`JJxg4Jg <` <//. /.HyHyND*nJfS`BS /gcS /f /fR-M(|x`/.Hl NPJg*@xe(|x`@xdJfA *H` .R @fSA?e*L` . R @fS Ae(|x@JgHxHyNP-@ xR/Hyx/.N /.NjXL0N^NuNHx)N@eNuNV.*n ` .gRJfJf@B`^HH @g` H@ H@B@ހHH0ހR`8B .S//. /.N A *nN^NuNVH B*n JfJf4BL N^NuNV./9HxHnND Jf(p` n ` .gRJfJgA `A*HHx:HxHU/.a*@fB`Hx:HxHU ./a*@fp`~Hx:HxHU . /a*@fp`RHx:HU .$/a *@fp`*Hx HU .(/a *@fp`p*nN^NuNVJga,HyHyNP#f BB`pN^NuNVJg/9NXpN^NuNVJf aJfB`*HyHa`X-@ g f <HN^NuNV.aZJg$a*@JgHx/.HUN Jf `B*nN^NuNV.aJg(ap*@JgHx/.HmN Jf `B*nN^NuNHxN@eBNuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#Hn/.NP09 gp`BN^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N6PJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HHH+@`m+n f09gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9(l  @*PJg*LZ`0SR`*0Hb1 nRJfHc0R 9nB <HL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N6PJmJn -|`-nf9HH/N@XJgm+|(+|(+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXhe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NjXJl~0-g /-NXBBBB BmB- L N^NuNVNX/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`heB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NjXHx` afvJgp`p//.N~P.lB (f6Hx/.NP.Jg Jm/NjXHx/.N~P.Jm.HxB/N `Jgp`B//.N~P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N~ N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JI$f8 <I(#I$ <I$#I(#I(I0#I$I, .^rN.*yI,BI8 g`(*(U g " Ҁe " Ҁd(M *@bI0fI$gB`RI8 I8o "<N#I8BNX(@ 9I8" Ҁe 9I8/NX(@g yI0 9I0Xg yI0  9I8" ҀY(#I0 <I$ A ` " Ҁ#I,I,c A#I4 A 9I,*A L0N^NuNVH0*n(MY#I, (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ I4 L0N^NuNHxN@e#lBNu /йl/@HxN@e 9l#lNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLAELMT[bb\h8mt{<>FNdl, Ld8&-18> C?LzSd[b`hpwP}j.Xtd$.. r%<*9=.H<LU0]@f3dnxu|@<<~4r#0*08 p<pFPW:\De xk6r  x{. |~;j. A*Pt+D  !*L269 AIV (]g$don6uf{f"0FLn?X  (yh3@i xd[ $L*YZ3sz< BQIRU[Zbinu{7 I<crt0.omount.o_sccsiddup.ofstab.omount.ofprintf.ofprintf.oprintf.oprintf.ostrncmp.ostrncpy.ofgets.ofilbuf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_printf_ro_getfsent_setfsent_write_dup_fprintf_mtab_mount_verbose_strcmp_creat_all_open_close_perror__iob_fake_mountfscerror_strncmp_strncpy__ctype__endfsent_fopen_getfsfile_fgets_getfsspec_fclose__pfile__print__filbuf_fflush_fstat__sibuf_malloc_sys_errlist_errno_sys_nerr_strlen_fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseekptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[YUlٺ * Q*J*KbyM o 0 $G"I#HTHS/N4 /NXNuNuNV` ig~ mg sg n P(HH/Hy4HyNt R  n /aX`X n P -f n P(HH afR `xB/d`H 9/d"HA HABAЁ @ #/dX SR/d /dl( n /(NX-@Jg`R`R/lSfT 9 N^NuNVHB/.NP#/`Jl$/.HyIHyNt R `B/.HyaNPNHx HyHxa T g/.HyfNP`BTB` 9T/Hy/l 9X"N$ 9F"€ 9NԀԹ 9/a B`* /l @JPg /l/aXRTRTmRmn 9R"HA HABAЁ @BBTB` 9T/Hy/l 9X"N$ 9F"€ 9NԀԹ 9/a B`* /l @JPg /l/aXRTRTmRmnBTB` 9T/Hy/l 9X"N$ 9F"€ 9NԀԹ 9/a( B`* /l @JPg /l/aXRTRTmRmn/9/`NXB "HA HABAЁ/t @BR m.9/d` "HA HABAЁ @BR m#/dLN^NuNV.*nJgB` ."HA HABAЁ @ 9Tfd ."HA HABAЁ @0 ."HA HABAЁ @0 ."HA HABAЁ @0R ./dmdp0 @gJ/lg lp0 `g p0 gp0 g 9"HA HABAЁ @ T 9"HA HABAЁ @0 9"HA HABAЁ @0 9"HA HABAЁ @0R`Hx/9Ta P*nN^NuNVH0*np0 @fB-M#XHnaZX(@`lJgB/aP-@JgHTa XJf n!yT 9 n!@HlN@XRѹHl n/(NP`fL0N^NuNVH0*np0 @fB-M#XHnaX(@`J f HTa\XJfJ/lf J/dgB`( ."HA HABAЁ @ g&R ."HA HABAЁ @Jf ."HA HABAЁ @JgXJg ."HA HABAЁ @0H/ ."HA HABAЁ @0H/ ."HA HABAЁ @0/Hy}N/HyNPB/9Ta^PHlHyNPB/aPJgHyNXHyNX`pfvL0N^NuNVH0*n m  mB` "9-@fx/aTX-@Jg l .R"9 m"( m 9` m ( "9FйS/Hm ."9/an A 9F(Hp0,ѕJgH L0N^NuNV.*n -.fJ- g -. f J- fp`B*nN^NuNV. gTB/.aTP*@JfHy`HyNX`, nR /. /-aP/-HyNP*nN^NuNV. ."< N"HA HABAЁ/t*@` gX e*|/tJfJ fB`8R m HyHyNtPHxNX* *nN^NuNV.B .r //9/`Nj /./. /9/`N g0/.HyHyNt B` . Ї @BRm..N^NuNV l 9X(".Ё @`r  .o /9THyHyNt B`@Hx Hn 9XX".Ё @ "9/a A . N^NuNVH *nBB`8 9n^ ."HA HABAЁHHЁ0-@`.RR`(RHH g g +g -g 0lJg .D` .L N^NuNVA-H#\Hn/. NP n0( gp`BN^NuNVA -H#\Hn/.NP09 gp`BN^NuN8Hx$N@eNuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBh`b y\ S m. .R @HH y\"(R!AS AHH` /9\ .R @HH/NPRh nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|P-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N@X-@8/.N@XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|Q PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|S`J.g-|UJ.g"/.N@X".-A< o-@ .Xf -|WL`-|hLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DND-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|y`-||`Jl-| n P @-h-h/./.NPJf/./.N PJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9*LZ`0SR`*0lb1 nRJflc0R 9nB <lL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N. .B`T0-f(mfHn-HH/NnPJmJn -|`-nf9HH/NxXJgm+|d+|d+n 0-gl(m m R Э "-d f -,/HT-HH/N. .+L`/.NDX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N. . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N. g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN4/.NDXN^NuNV .". nJ/H?Nh n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuN8HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN8HxN@eBNuN8HxN@eNuN8HxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N: N^NuNV/. Hy@t/.N: N^NuN8Hx6N@eNuNVH0Jf8 <# <### .^rN>.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<ND#BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#Ĺc A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN>.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuN8HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLZ8`elhsx`"*@H(p@^ %)d06 ;?DVK@SbZ<`fho,uF|j v4P@$d.dtt <!>%0<4h<xE3MT[d!k4sD|,<4N<((8D~4r 0 "d),07=tCK S Yj`ti o ww 1 }  b    /`LH@ q/d /l, /l /t; !$@ .  T X" \*289@InOfUf^d kFDq(wJh?4.  dyLnD3x^Dih \x@[$(*Y63sV<BQIRU[Zb dj(ou:|7 >  dcrt0.oncheck.o_sccsidatol.ofprintf.ofprintf.oprintf.oprintf.osync.olmult.oneg_resultpos_resultzero_resulta_negb_neg_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_strngloc_read_pass1_pass2_pass3lmult_atol_printf_nxfile_sync_lseek_fprintf_mflg_sblock_aflg_dotnameulmodt_readdir_nerror_bread_strngtab_fi_check_bmap_iflg_itab_lookup_pname_sflg_open_htab_close_nhent_strcpy_strlen__iob_ilist_ino_gip__pfile__printcerrorulmult__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_fstat__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwo_gtty_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[oVlٹ *R*SbyN " X>D $G"I#HTHS/N4 /NXNuNuNV.SX Jo0 n P -f" n *PX RS`n TfR `jn afR x`Vn ifR `BR 0`:Jg4SR Hy /Hy?NP -R/HyDNP /HyINP -V/HyNNPHySNX ."HAHABAЁЮeJL @N^NuNVH0HyUNXJ Dg 9#B/9/9 |N HxZHn/9 |N2 (|]HTNXBHnaPJ9pgJ Dg$ 9t#t 9h#hB/9t/9 |N HxHn/9 |N2 /.HyNPB/9h/9 |N ."HAZZHABAЁ/Hn/9 |N2 A*H` A rZN/HUaPZ ."HAZZHABAЁAЈeJ9gJ Dg$ 9# 9#B/9/9 |N HxHn/9 |N2 /.HyNPB/9/9 |N ."HAZZHABAЁ/Hn/9 |N2 A*H` A rZN/HUaPZ ."HAZZHABAЁAЈeJ9gJ Dg 9#HyNXB/9/9 |N Hx @Hn/9 |N2 A*H`A rZN/HUaPZA@eL0N^NuNV./. HyNP*n-EHH/HyNP/- HyNP/-HyNP/-:HyNP/-4HyNP-DHH/HyNP-FHH/HyNPHxT ->/aPHxW ->/a|PHxO ->/afPHxC ->/aPPHxB -> /a:PHxA ->@/a$PHxX ->/aPHxH ->/aP0-BH/HyNP-EHH g( gHyNX`HyNX`Hy`*nN^NuNVH B 9 -@ .Ю̑/.anX-@/.a`X-@ .ЮѮ .ЮѮ - f HUarXѮ ."HAHABAЁЮeTJ g4 .ЮrdN/ .rdN/HywN ` 9 4rN".䒀 .Юؒ//./././.HyNHyNX-y 4`JB`R/./.a*PJfJg/./.HyN .rN-@ .Ȱ lHyNXL8N^NuNVH..B*9 `܅ 4l H@H@B@ڀm LN^NuNV. n (6"<N. n (6Ш:Ш>"<NV..N^NuNV n(F g (4"<N nШ4` n (4N^NuNVH8*nA(HJ o .  4n&L`  m  o^ +"9 4N"9 4-Al>  mf +Ё.  -@&Jg Ю //.HUaN `<.+ . ѫ . fP'k'Sf rNJf `PJfTBL8N^NuNVH Jo*J o" .P*@-M`Jg P -och -ЭmZ -Эn . ѭJg .Ю m .Ю n ѭJgP+m+U` .Ю m"Jg .Ю nt .  . ѕ`r.-+n-G.* P-G fA"ncJQ -Э//- n/(HyN+U+mB*`HyNXL N^NuNVH0 .". N-@/NX*@fB`(M .VrN.`BSl L0N^NuNV/.NԖXN^NuNVH0B(n B`4 TJg2B,BBlB,/N@X*o-E RJfHy/.NdP-@JfB`/.HxHx HnN( g& g  g/.NXp`P  f <`p ЮЮЮЮ-@Ю-@..Jg,<l,B/./.N /.Hx/HnN(*ݮA(H mJgp,fB .Д//.N /.Hx .R/HnN(*n `f UJgdB` Ѕ @AfBR Ѕ @JfAJf,+ll;llSf/.N^X`x Jf `4L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/N "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/N -@ nBJg n S m n (R!@S @`t/.NX`f n0(gV/NŮX n0(gB nh n"H#h/./. n(HH/N -@ fp`BLN^NuNVA -H#  Hn/.NP09  gp`BN^NuNVH0*n(nBJ f<`D-n Sm ,R @` HTNX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NPSf0, fR .e .L0N^NuNVHn /.Hy N N^NuNVHn/. /.N N^NuNV.*n=|A-M-MB`RJf-nHn/. HnN *nN^NuNVH0*n (nBBHH.Jg& gz gp gf %g, n S m n (R!@S @`HH. %gB *g LX-H`HH.B-|`* ."HA HABAЁЇ0-@HH.  5 @fJf-|u0 lf-|`BHH.` hg [f HUaX*@  5 @g  .-|Jfp`Hn/./././/.aJg JgRJg|Jg` n S m n (R!@S @` /.NX-@ g g g g/./NҌP`/.NX-@g g*/./NҌP .L0N^NuNVH c g s g [ f././././. Jg n `B/a`BBB e g f f-|| o f|` x f|A*HBB n S m n (R!@S @` /.NX. g g g -fFR n S m n (R!@S @` /.NX.S` +fS n S l/.NX` am fo Am FnR f .` f .Ю` .-@-G  5 @g0` am fnW`7߮.. n S mB n (R!@S @.Sm  5 @f< g .f fJgR` eg Ef~Jfx fpJgjJgdR n S m n (R!@S @` /.NX. +g -g 0m 9oJg .D-@ g/./NҌP nB` n JgAgJgAfB`B .退 bJ@0;N^jj@@@@@@@@@@@@@&&DHnNXNV n P p`2HnNX n P !A` n P0` n P `L N^NuNVH8*n(n nB&M c f u0f-|B s f-|Sm ,R @` HTNX. @HHg f-| c fB`` [ fV-|`L  @HHf>gSo,Sm ,R @` HTNX. f gJo HT/NҌP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y -y -y -y -|-|HH. g -f -|`f +g^S`Z/9 x/9 t .".N(l< 0N(///./. 9 "9 NN˒-@-A`RHH.  5 @f .gZ`t/9 x/9 t .".N(l< 0N(///./. 9 "9 NN˒-@-ASHH.  5 @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  5 @fJl D*܅-FJl D,B g(  | @/(/ .".N-@-AJg R mJl/./. .".Nh`/./. .".N-@-A/.//N@ -@-AJl ` .".L N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n f +| `D/.NX+@f,mJf,0-g-HHM+@`m+n  f09 gHy NŮX0-gp` - //--HH/N2 *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBM`b y S m. .R @HH y "(R!AS AHH` /9 .R @HH/NPRM nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH 5 @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH 5 @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N@X-@8/.N@XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| `J.g-| J.g"/.N@X".-A< o-@ .Xf -| L`-| LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| `-| `Jl-| n P @-h-h/./.NPJf/./.N PJfHnHn .R l .R`p//./.N-@Jg -| `J.g -| `J.g-| AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".N(gP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9 /9 .".N(fp+`p-S n.HH 5 @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.N PJfHnHn *LZ`0SR`*0Mb1 nRJfMc0R 9nB <ML0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n f9 HH/NXJgm+|-+|-+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| ` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NԖXBBBB BmB- L N^NuNVN4/.NXN^NuNV .". nJ/H?Nh n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` eB` 0,f -+fp`B, wf0Hx/.NаP.JgJm/NXHx` afvJgp`p//.N"P.lB Mf6Hx/.NаP.Jg Jm/NXHx/.N"P.Jm.HxB/N `Jgp`B//.N"P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N" N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N\PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N҂ N^NuNV/. Hy@t/.N҂ N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JN,f8 <N0#N, <N,#N0#N0N8#N,N4 .^rN.*yN4BN@ g`(*(U g " Ҁe " Ҁd(M *@bN8fN,gB`RN@ N@o "<N#N@BNՖX(@ 9N@" Ҁe 9N@/NՖX(@g yN8 9N8Xg yN8  9N@" ҀY(#N8 <N, A ` " Ҁ#N4N4c A#N< A 9N4*A L0N^NuNVH0*n(MY#N4 (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ N< L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLFLR\cjsy%x/vmcoreCan't find %s no namelist pstat: one or more of -[aixptfsu] is required usage: pstat -[aixptfs] [-u [ubase]] [system] [core] %3d/%3d inodes %d/%d active inodes LOC FLAGS CNT DEVICE RDC WRC INO MODE NLK UID SIZE/DEV %8.1x %4d%4d,%3d%4d%4d%6d%6x%4d%4d%6d,%3d%10ld %c %3d/%3d texts %d/%d active texts LOC FLAGS DADDR CADDR RSS SIZE IPTR CNT CCNT %8.1x %5x%11x%5d%5d%10.1x%5d%5d %3d/%3d processes %d/%d processes LOC S F POIP PRI SIG UID SLP TIM CPU NI PGRP PID PPID ADDR RSS SRSS SIZE WCHAN LINK TEXTP CLKT %8x %2d %4x %4d %3d %8x %4d %3d %3d %4d %3d %6d %6d %6d %8x %4x %4x %5x %7x %7x %7x 1 cons # RAW CAN OUT MODE ADDR DEL COL STATE PGRP DISC %d dz lines %d dh lines 32 pty lines %2d%4d%4d%4d%8.1x %8.1x%3d%4d %6d ntty netpcb %x arg %.1x %9.1x segflg %d error %d uids %d,%d,%d,%d procp %.1x ap %.1x r_val? %.1x %.1x base, count, offset %.1x %.1x %ld cdir rdir %.1x %.1x dirp %.1x dent %d %.14s pdir %.1o file %9.1x %9.1x pofile %9.1x %9.1x ssave %9.1x sigs %.1x code %.1x ar0 %.1x prof %X %X %X %X eosys %d ttyp %.1x ttyd %d,%d exdata %.1D comm %.14s start %D acflag %D cmask %D sizes %.1x %.1x %.1x ru %D cru %D ???kernelfsysfiledirbdevcdevprocsocketdomaintty%3d/%3d files %d/%d open files LOC TYPE FLG CNT INO OFFS|SOCK %8x %-8.8s8d%4d%9.1x %x %ld %3d/%3d 00k swap %d used (%d text), %d free, %d wasted, %d missing avail: %d*%d %s: rmap ovflo, lost [%d,%d) bad rmfree @(#) (Berkeley) 83/04/30/dev/kmem/vmunix_inode_text_proc_dz_tty_dz_cnt_cons_file_Usrptmap_usrpt_nswap_swapmap_dh11_ndh11_nproc_ntext_nfile_ninode_nswapmap_pt_tty_dmmin_dmmax_nswdevr@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ ND. 40$,4e=F.(MNU^:el |r tz.h*RZfM6Ǿ%* .7:=A8FMS?\ǀb2ilp(x>8h`ɜ"Π*@δH˒ "((p.@3^<CJʪQX̶\dcΐi n?wV~@b<f,Fjκ ɢvΔ4P @$d.а%,.4<NFP<UdѪh s<w3,<|ҌA|ռ<ռ<֢<"+39?~4ErN0U2[Jcks7\| "  c $ d (RD  ,8C  0 : 4yԖ+  8  <  @  D#+   H1F7  P?  xGkO  |S  Y @ `g > o"u!4| l }       <     td;N($@e ^LŮ%  -5. ;[CfLx4T:]dnjZs 4|sVAҌ(hx@(?˒  of Jdž4  -' 139@iȶGhN\T[ˊZaY6jpQɬwR͖Z M.а\҂<7Ֆ NDՂcrt0.opstat.o_sccsidcalloc.onlist.ofseek.oprintf.oprintf.ordwr.oscanf.odoscan.oatof.oatof.o_exp5_twoe56filbuf.olmult.oneg_resultpos_resultzero_resulta_negb_neg_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_dotext_printf_doproc_rmalloc_nswdev_file_filf_putf_nlist_up_doswap_sscanf_rmfree_lseek_Usrptma_vusize_fnlist_usage_prcf_dmmax_freelmodt_dofile_usrpt_oatoi_ubase_nfile_kflg_xdsize_swpfldivt_cdevsw_allflg_calloc_fc_ttyf_dmmin_dotty_partab_open_fcore_fileNFILE_getw_usrf_totflg_doinode_inof_ttyprt_nl_bdevsw_dousr_txtfulmultuldivt_malloc_cfree_fopen_close_fread_strlen_fseek_fclose_fflush__filbuf__pfile__print__iob_fwrite__flsbuf_fscanf__doscan_scanf_atof__getccl__ctype_fsinglei__instr__innum_ungetcieeeused__sctabffltifdivi_ldexpfcmpifmulifaddi_fstat__sibuflmult_fcvt_ecvt_isnan_isinfffixi_modf__cleanup_write__sobuf__lastbuf_isatty__exitd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltis_errno_creatcerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[Wlٹ l'*]*_byP   H $G"I#HTHS/N4 /NXNuNuNVH BN`X#B "HAHABAЁ @ R m`T.- nH "HAHABAЁ @Jf(/a $X "HAHABAЁ @ N *@Jf fHy4HyNPHxNX` n P (nfRp`z n P (ffR`d n P (cfRt`N n P (vfRx`8 n P (hf*R`"X n P -g n /aXJfaXSfBL N^NuNVHDB/.NrP#Jl/.HyLNHPp`/.Hy\NHPN"Hx HyrHxa6 JpgXSm 9R @`HyNX-@ @gHy/.NP 9s"9s N#B 9Ȱd&"9sN." 9sN$ 9"9sN."9rF" 9rNԀԹr 9"9sN"9sXN."9s@Ԁ 9sD-B/9sHy/a BsXdN 9Ȱd>R dL`ZHyNX-@ g gSm 9R @` /aXR`xBLDN^NuNVH0*np0gPJfn - "9s0-@"9sN l".R$9s0$- m"9s`"9s(F­ ҹsS¹s,$9s4Ё-@`HyaNHXHxNX ."9sN"<N4-@JtgVp0 @gp0 fr m .ѹ-| . @R`B ml80- @ .ѐ 9А 'o0- @ .ѐ 9А Oo0- @ .ѐ 9А vo0- @ .ѐ0- @RJpgJfHyHyNPJol 9ܰb\dHSm 9R @`HyNX@ g .fB`0- @(Pg HTHy`0-H/HyNHPSm 9R @`HyNX@ g . gSl\Hy.HH/NP`` . g`Sm 9R @`HyNX@Sm.HH"9R AHH .fBL0N^NuNVB .r //9N /./. /9N g/.HyNHPHxNXN^NuNVH0*n(n op`* lp` JgJfB`/,/-NPL0N^NuNV.Jpf2JtgBB  @Jg>" A" NѮ/.  @//HyNHR m 9Ю//9HxHyNH`HzHxHxHyNB "HAHABAЁ @Jg` "HAHABAЁ @/HyNHPJg, "HAHABAЁ @/HyNHP "HAHABAЁ @Jg& "HAHABAЁ @/Hy`$ "HAHABAЁ @/HyNHPJxgj "HAHABAЁ @/ "HAHABAЁ @/ "HAHABAЁ @/HyNHHyNHXR m..N^NuNVH B`R .Ї @Jf R/N4X*@B`R .Ї @ Ї"@f L N^NuNVJfHyHyN|P#`/9N XN^NuNVJg/9NvXBN^NuNV.*n` :gRJfJgB *nN^NuNV.Jf"HyHyN|P#fB`/9HxHyN *@g#HUazX*@#HUajX*@HUN,X#HUaPX*@HUN,X#B#HUa&X*@#HUaX*@#HUaX*@#`  gRJfB <*nN^NuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#Hn/.NP09 gp`BN^NuNV## . ".NЮ//.aPN^NuNVH0.9 . -@찇cH" .N." N-@ .Ю-@-@*n . (@`./.HUa P`/.HU yNP-@gJljǻe``HT߮/.aP`NHT߮/.HUa ߮*n`0HT/. yNP-@gJogHTHUaP`ǹbʻfL .". m/. .Ї/aP-n `/./.aP .Ї-@`HU/.HTaH (n`$L0N^NuNVH0-y *n(n SfL0N^NuNVH8-y *n(n &nHH-@SfL8N^NuNVHn /.HyN N^NuNVHn/. /.N N^NuNV.*n=|A-M-MB`RJf-nHn/. HnN *nN^NuNVH0*n (nBBHH.Jg& gz gp gf %g, n S m n (R!@S @`HH. %gB *g LX-H`HH.B-|`* ."HA HABAЁЇ0-@HH.  @fJf-|u0 lf-|`BHH.` hg [f HUaX*@  @g  .-|Jfp`Hn/./././/.aJg JgRJg|Jg` n S m n (R!@S @` /.NX-@ g g g g/./NP`/.NX-@g g*/./NP .L0N^NuNVH c g s g [ f././././. Jg n `B/a`BBB e g f f-|| o f|` x f|A*HBB n S m n (R!@S @` /.NX. g g g -fFR n S m n (R!@S @` /.NX.S` +fS n S l/.NX` am fo Am FnR f .` f .Ю` .-@-G  @g0` am fnW`7߮.. n S mB n (R!@S @.Sm  @f< g .f fJgR` eg Ef~Jfx fpJgjJgdR n S m n (R!@S @` /.NX. +g -g 0m 9oJg .D-@ g/./NP nB` n JgAgJgAfB`B .退 bJ@0;N^jj@@@@@@@@@@@@@&&DHnNpXNn n P p`2HnNpX n P !A` n P0` n P `L N^NuNVH8*n(n nB&M c f u0f-|B s f-|Sm ,R @` HTNX.B @HHg f-| c fB`` [ fV-|`L B @HHf>gSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg B @` B @R mHH. ]g*Jg B @` B @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9/9 .".N@l< 0N@///./. 9 "9NN-@-A`RHH.  @f .gZ`t/9/9 .".N@l< 0N@///./. 9"9NN-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g(  @/(/ .".N-@-AJg R mJl/./. .".N`/./. .".N-@-A/.//NX -@-AJl ` .".L N^NuN(Hx$N@eNuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N*PJmJn -|`-nf +|`D/.N4X+@f,mJf,0-g-HH+@`m+n f09gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNVBHnNPJlp`Jg n .N^NuN(HxtN@eNuNV4.-nB$`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPR$ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|4-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NXX-@8/.NXXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|5 PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|7`J.g-|9J.g"/.NXX".-A< o-@ .Xf -|;L`-|LLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN4-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|]`-|``Jl-| n P @-h-h/./.NPJf/./.N$PJfHnHn .R l .R`p//./.N-@Jg -|c`J.g -|e`J.g-|gAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".N@gP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N4`S n0A .ذbJn/9(/9$ .".N@fp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.N$PJfHnHn *LZ`0SR`*0(b1 nRJf(c0R 9nB <(L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N*PJmJn -|`-nf9HH/N4XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N4X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXhe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N^XJl~0-g /-NXBBBB BmB- L N^NuNVNL/.N4XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`heB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N^XHx` afvJgp`p//.NrP.lB f6Hx/.NP.Jg Jm/N^XHx/.NrP.Jm.HxB/N `Jgp`B//.NrP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nr N^NuN(HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN(HxN@eBNuN(HxN@eNuN(HxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN(Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0Jxf8 <|#x <x#|#|#x .^rN..*yB g`(*(U g " Ҁe " Ҁd(M *@bfxgB`R o "<N4#BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# <x A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN..d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuN(HxN@e#lBNu /йl/@HxN@e 9l#lNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLEKRZ@`fXkvt{,| ?nXzT~D^"L$h+4<DXM$|U.]d.ltf~<"<$43Xl|A4  #-<2$AE>P<T[c(l4tz~4r0`H p " Atf  x @F4A $ r+ /6>.E K S iYr_ irx4`. B   Y6 q,t|+v  x: np&sn/7x?HBP@V\xXc@i?ou(|L* Qo*f$$XbL  y;^h34 4i"t([.5YN>DQKRW]Zd k.rw}7 crt0.oquot.o_sccsidgetpwent.ofprintf.ofprintf.oprintf.oprintf.oqsort.oscanf.odoscan.oatof.oatof.o_exp5_twoe56sync.oatoi.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negrew.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_readlmult_qsort_printfulmult_report_nflg__ctype__sync_cflg_lseek_fprintf__flsbuf_getpwent_vflgulmodt_breadldivt_ungetc_du_sb_un_fi_check_strcmpuldivt_itab_nfiles_hflg_open_overflow__filbuf_qcmp_malloc_time__iob_sizes_acct_ino_fflg_copy_now_scanf_atoi_setpwent_fopen_fgets_endpwent_fclose_rewind__pfile__print_fscanf_sscanf__doscan_atof__getcclfsinglei__instr__innumieeeused__sctabffltifdivi_ldexpfcmpifmulifaddicerror_fflush_fstat__sibuf_gettimeofday_fcvt_ecvtlmodt_isnan_strlen_isinfffixi_modf__cleanup_write__sobuf_free_close__lastbuf_isatty__exitd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltis_errno_creatptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[Xlٹf Z*g*hbyQ    ( 8?4 |$G"I#HTHS/N4 /NXNuNuNVHBBSX B`fHy n /NPJfR`BHy n /NPJf ` HyHydNPHxNXSX JnHxHxNXPHxHxNP f HyHydNPHxNXJfn~Hx HxNP f6 gHHyNXHxHxNPHxNX oHyHydNP .faRJf* .faNNNNHxalXN/.Hx7NPHyNXHxHxNPHxNX` /a XNR`LN^NuNVN^NuNVHzHxNXP/.NXN^NuNV.HxHy4NFP.JmtHxB/N HxHyHyN HxHy HyN HyN4XHxHy/N /N2X..N^NuNVHnN4XHnNX-@Hy'HyNPP-@JgvHxB/N n (l//( (^ @/ n (B @/ n/(/(Hy)/.N /.NJXN^NuNV/.aX/aXN^NuNVH HnNX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN-@Jl QS*|F .r*LZ`0SR`*0Fb1 nRJfFc0R 9nB <FL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nPf9bHH/NXJgm+|&t+|&t+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|<` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N2XJl~0-g /-NbXBBBB BmB- L N^NuNVN /.NXN^NuNV .". nJ/H?NT n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|<`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N2XHx` afvJgp`p//.NFP.lB f6Hx/.NP.Jg Jm/N2XHx/.NFP.Jm.HxB/N `Jgp`B//.NFP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NF N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JGf8 <G #G <G#G #G G(#GG$ .^rN.*yG$BG0 g`(*(U g " Ҁe " Ҁd(M *@bG(fGgB`RG0 G0o "<N#G0BNbX(@ 9G0" Ҁe 9G0/NbX(@g yG( 9G(Xg yG(  9G0" ҀY(#G( <G A ` " Ҁ#G$G$c A#G, A 9G$*A L0N^NuNVH0*n(MY#G$ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ G, L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLTDrJ?P~V `  &thybnx3iTHx,[vY"sBQRZ. `7b") G4.N3crt0.oreboot.o_sccsidctime.oOftime.okill.ofseek.ofprintf.ofprintf.oOalarm.oOpause.ostrncpy.osync.ofilbuf.operror.oerrlst.oOsignal.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_setalarm_write_strncpy_alarm_sync_dingdong_lseek_fprintf_errno_wtmpf_syscall_months_localtime_fopen_strcmp_kill_days_open_close_perror_signal_time_markdown__iob_fseek_wtmp_fclose_log_entry_pause_dysizelmodt_ctimeldivt_ftime_asctime_gmtimecerror_fflush__filbuf__pfile__print_read_fstat__sibuf_malloc_sys_errlist_sys_nerr_strlen__sigfunc__sighandler_gettimeofday__ctype__fcvt_ecvt__flsbuf_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[Ylٺ) YH*p*qbyR   $ , 4 < 8A $G"I#HTHS/N4 /NXNuNuNV.BBBSX la Hy4 n /NPJf -|` Hy7 n /NPJf-|X S n /NX-@SX o-| l-|Jf/.B/.a Ѯ` n /NX*@f n /Hy:`J-m/././.ar Ѯ`< g n /NX-@Jl n /HyTHypN SX JnJgp`B/NX*nN^NuNV/. /.NP-@ fVJgN/. HykHypN Hyx` /. HyHypN HyNtXp`8/./. /.N Jm/././. HyNBN^NuNVHyHypNPHyHypNPHyHypNPHxNXN^NuNHxdN@eNuNV.NN*@Jg//.NPJfN> *nN^NuNVJjfHypHy\N8P#j`/9jNXN^NuNVJjg/9jN2XBjN^NuNV.*n` :gRJfJgB *nN^NuNV.Jjf"HyrHy\N8P#jfB`/9jHxHyDN *@g#HHUazX*@#HHUajX*@HUNX#HHUaPX*@HUNX#HBH#hIHUa&X*@#IHUaX*@#IHUaX*@#I `  gRJfB <H*nN^NuNVA-H#Hn/. N\P n0( gp`BN^NuNVA -H#\Hn/.N\P09l gp`BN^NuNHx`N@eNuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nHf +|`D/.NX+@f,mJf,0-g-HHI+@`m+n Hf09lgHy\NX0-gp` - //--HH/N> *+mSl. fm0-gm`m B` mR*nN^NuNVH *|t 9హl  @*PJg*LZ`0SR`*0I(b1 nRJfI(c0R 9nB <I(L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n\f9nHH/NXJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|H` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NJXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N< n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|H`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N.P.lB f6Hx/.NP.Jg Jm/NXHx/.N.P.Jm.HxB/N `Jgp`B//.N.P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N. N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NhPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JIxf8 <I|#Ix <Ix#I|#I|I#IxI .^rN.*yIBI g`(*(U g " Ҁe " Ҁd(M *@bIfIxgB`RI Io "<N#IBNJX(@ 9I" Ҁe 9I/NJX(@g yI 9IXg yI  9I" ҀY(#I <Ix A ` " Ҁ#IIc A#I A 9I*A L0N^NuNVH0*n(MY#I (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ I L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL?GTMTW[cjqx ~<4ptf D2'.5~<CG8NdT Y?b*iq6x~:>vJh$$8..'"1;<@O~S^<bks|3(8H0pp<V<|| $*~40r90@qFNYV_Cff mwCt.H>t8+2 \> L  (5<F$NU^ndfjfsyF<Z?f  $yJ;3i<0x [^ Y )s*28Q?RKjQZX._.e|jqhw~H7tJ I6crt0.orenice.o_sccsidgetpriority.ogetpwnam.ogetpwent.ofprintf.ofprintf.oprintf.oprintf.osetpriority.oatoi.ofgets.ofilbuf.operror.oerrlst.orew.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_atoi_printf_donice_fprintf_usage_errno_getpwnam_setpriority_getpriority_strcmp_perror__iobcerror_getpwent_setpwent_endpwent_fopen_fgets_fclose_rewind__pfile__print__filbuf_read_fflush_fstat__sibuf_malloc_sys_errlist_write_sys_nerr_strlen_lseek__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creat_openptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[Zlٹ w6*y*zbyS 0 8 @ H P X `  PDX$G"I#HTHS/N4 /NXNuNuNVH8a #@a#, o n h -fX S-| n Ю @Jg n Ю @HH0 Fb@0;NPPPPPPPPPPF,@6RxR`(R`R#`R`R`R|#`R#`R`R#`R#x`~R#`jR$``R`VRR`F 98"HA HABAЁ n "Ү AHH0Ё#8` R`R<`R`R`J8f #8Jfa> lHya fXJg`LSgX n /a DX`JgaJf`*y`LA(HAi|&Hc 9` &@` Jg g B Ю @ ?gR m  fJ4fHyaX#4 y4 , Ѩ y4/,/, ("(N!@!A y4/,/, ("(N!@!A y4/,"/, ("("N!@!A" y4/,*/,& (&"(*N!@&!A* y4/,2/,. (."(2N!@.!A2B6e*UfJgBHxHxN$PHyHy NP-@gXB`F/.aX-@g/.HxHx /`/.HxHxHyNNR .԰@mHy/HyNP-@fHy1N XBNX*y`PA(HAi|&Hc 9` &@`(Jg g/.HxHx6HTN6e*Uf/.NRXHx/98N,PBHxN$PJgatBNX/9`/9\/90/9,/9/9/9/9 /9/9/9/9a0Hy=N XB*y`JA(HAi|c 9Аr6N` <-@Hz Hx6/HTN8R*UfHx/.NP-@B*y`TA(HAi|c 9Аr6N` <-@ .Ю @ .Ю @!nR*Uf`B-|`0 .Ю @/ .Ю @/a 0PJl-nR .m .Ю @ 6 6(@ .Ю @ (S!@f`jHna4X*@ .N// 9"9N##+n /./. 9"9N##+n+n/./. 9 "9N# #+n+n/./. 9"9N##+n+n"/./. 9\"9`N#\#`+n.+n2/./. 9,"90N#,#0+n&+n*/.HxHx6HnNL g/.NRXHyUHyDNP-@gfB`2Jg(/.aX(@gA <C "QR/.HxHxHnNL g/.NRXL0N^NuNVH<J`B g8Sm 9R @`HyNtX-@Jf6e*Uf\L<N^NuNV. .. .r -@`SJf ..N^NuNV/.HyHyGN G <GN^NuNVB`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNVH0*n Jm m#'Dp`T .'L @(P .'L @ gf ` <//.Hx0N `NqL0N^NuH // |'L pNLNw //W.BN@d W/N WNNHxN@eNuNVA-HA#@=|B-n-|Hn/. N|PSm .R @BHH`HnBNP .N^NuNV4.-nBL0`b y@ S m. .R @HH y@"(R!AS AHH` /9@ .R @HH/NPRL0 nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHq @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHq @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N(X-@8/.N(XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|! PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|#`J.g-|%J.g"/.N(X".-A< o-@ .Xf -|'L`-|8LA`-H-H`P .P-@@ .P-@P".DNRЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|I`-|L`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|O`J.g -|Q`J.g-|SAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".NgP .S-@HJlD-@HJHg6 .Hr NR0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HHq @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn 0SR/9/9 .".NfrLdf`/9/9 .". NoF/9/9/9/9 .". N-@-ANl-n-n S` .L4(@Jf n L4d B9L4`b\LdT/9/9 .". N-@-A Hn//Nz -@-A .".N>0`LeB9L`>*LZ`0SR`*0L4b1 nRJfL4c0R 9nB <L4L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NRPJmJn -|`-nf9HH/N\XJgm+|'+|'+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXTe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NņXJl~0-g /-NǶXBBBB BmB- L N^NuNVN(/.NXN^NuNV .". nJ/H?N\ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JLf8 <L#L <L#L#LL#LL .^rN.*yLBL g`(*(U g " Ҁe " Ҁd(M *@bLfLgB`RL Lo "<N#LBNȶX(@ 9L" Ҁe 9L/NȶX(@g yL 9LXg yL  9L" ҀY(#L <L A ` " Ҁ#LLc A#L A 9L*A L0N^NuNVH0*n(MY#L (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ L L0N^NuNHxN@e#XBNu /йX/@HxN@e 9X#XNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLF,  DF  & + y1t8k@I?OT Z ak qq  w.,~b 64   tNL$ $ , P4~. 8)8 Rv Y< <-L4zǶ:AI4PrV+ ]e @m|uf~ŪLR D 'DŚ;ņT 'Lpnf$( >z((/  '73\?FiM\TPZx4a[~gnY*wsJQRŠZLŴ7ȶ LȢcrt0.osa.o_sccsid_UserKeycalloc.ogetpwent.ofprintf.ofprintf.oprintf.oprintf.ordwr.oqsort.ostrncpy.oatoi.ofgets.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_negrew.oOsignal.osighandler.osyscall.olseek.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcountlmult_qsort_printf_Dcmp_dcmp_tabinitfflti_tio_utmp_ncmp_oflg_getnames_sum_dflg_Dflgfdivi_ncom_enter_strncpy_doacct_nflg_alloctail_bcmp_cflg_tsys_fprintf_mflg_acctbuf_fwrite_bflg_maxuser_nexttablmodt_Kcmp_kcmp_lflg_printmoney_getpwent_setpwent_aflg_vflg_taballoc_htaballoc_cellcmp_kflg_Kflg_wasuser_sprintf_tcmp_uflg_allochead_expandldivt_tabsleftfcmpi_cmp_jflg_fopen_callocieeeusedfmuli_col_tflg_ntabs_endpwent_iflg_tcpu_creat_finduser_treal_init_junkp_sflg_getmaxuidfaddi_htab__filbuf_fread_signal_rflg_timem_newbox_strip__iob_sname_thres_makekey_fclose_column_fflg_htabinstallulmult_freeuldivt_malloc_cfree_atoi_fgets_rewind__pfile__print__flsbuf_read_fflush_fstat__sibuf_lseek_errno_open_close__lastbuf__sigfunc__sighandler_syscallcerror__ctype__fcvt_ecvt_isnan_strlen_isinfffixi_modf__cleanup_write__sobuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpfdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[[lٹ̐ vl**‚byU D L T \ d l t | H?( $G"I#HTHS/N4 /NXNuNuNV g* g HyHyxNPHxNX n # @ f# P.B 9 Lй//a HxHn/a  /NX..N^NuNVH >. ,. HyN(X*@BHy HyJdNhPHUNX-@g|P/HyJiNhPHnHyJdN6PJgHyJdNX`p0.fnfHyJdNXR/NX-@HyJd/NhPHUNXJgB/.NP-@l:0/0H/HyHyxNHxNX/.NX .L N^NuNVHy4Hy2N4PJ`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|| 9*\l  @*PJg*LZ`0SR`*0Nb1 nRJfNc0R 9nB <NL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-ndf9vHH/NXJgm+|*d+|*d+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|P` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NĎXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|P`eB` 0,f -+fp`B, wf0Hx/.NXP.JgJm/NXHx` afvJgp`p//.NP.lB *\f6Hx/.NXP.Jg Jm/NXHx/.NP.Jm.HxB/N~ `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuNHx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N¬PJlB`pN^NuNVH B/.NP. g `/NXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N& +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JOf8 <O#O <O#O#OO#OO .^rN.*yOBO$ g`(*(U g " Ҁe " Ҁd(M *@bOfOgB`RO$ O$o "<N#O$BNŎX(@ 9O$" Ҁe 9O$/NŎX(@g yO 9OXg yO  9O$" ҀY(#O <O A ` " Ҁ#OOc A#O A 9O*A L0N^NuNVH0*n(MY#O (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ O L0N^NuNHxN@e# 8BNu /й 8/@HxN@e 9 8# 8NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLGNV^dfkpt}?(htx D"H'.6\:@E:LSYx`hnty|R^ 8 ? bJ<#*29pBJR[$ c.Xkxr.xz<b<;3( | 0@%h.!Œ5=FtMŴU4_Ŵis<xƚ<~4r0&q~jGt&-44  <<#D@LW~^:e 1 @ox  D s LZf  JW   v <?F F,)t 08 ) @A+HP.XW[]ciq;xN$!h  D6  H  L$.P C PeDt4 (  TO!*( 1F9@LVHR  XZ0b[jq  \yl *\Qnf~.?:  *dyĎ3#i^*17x>[2DKQYZsciQTpR~|>Zh¬Œ7ĸŎ O(zcrt0.osavecore.o_sccsidctime.oOftime.onlist.ofseek.ofdopen.ofprintf.ofprintf.oprintf.oprintf.ordwr.oatoi.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.oaccess.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_Read_atoilmult_printf_clear_dump_check_kmem_save_core_write_Write_nlist_system_Create_strcat_read_kmem_lseek_Lseek_dumptime_fprintf_panicstr_panic_mesg_closedir__flsbuf_vers_read_number_path_months_ctime_core_vers_dumpdev_localtime_get_crashtime_readdir_sprintf_dump_existsldivt_check_space_fopen_fdopen_dirname_fgets_strcmp_creat_days_open_Open_access_close__filbuf_perror_fread_strcpy_dumpmag_stat_malloc_time_ddname_dumplo_strlen__iob_dumpsize_fseek_fclose_find_dev_nl_opendir_log_entry_now_dysizelmodt_ftime_asctime_gmtimecerror_fflush__lastbuf__pfile__print_fwrite_fstat__sibufulmult_sys_errlist_errno_sys_nerr_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[\lٹɘ x*‹*‹byW h p x  H?x$G"I#HTHS/N4 /NdXNuNuNVH0NP# Hx Hy `NPSX Jnr l n /Hy N` #B`  hf#FHH.f` l n "@"X R .SJn  @B . # rJgHy/.NP*|`/Hy/.N XJf/.Hx N$P/.Hx N$PHxNX/.NXBNXHxHy H/N gJ nHyNfHy NHxNX-@HyNNXJg8/.HxNPP/.NXN^NuNVHxHyNNP`PJg" .c .`-n-|HzHxNPP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +| `D/.NX+@f,mJf,0-g-HHN+@`m+n f09gHyN2X0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9-0l d @*PJg*LZ`0SR`*0Nb1 nRJfNc0R 9nB <NL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|.0+|.0+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NnXJl~0-g /-NĊXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.N4P.JgJm/NnXHx` afvJgp`p//.NP.lB -f6Hx/.N4P.Jg Jm/NnXHx/.NP.Jm.HxB/NZ `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N˜PJlB`pN^NuNVH B/.NP. g `/NnXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N¾ N^NuNV/. Hy@t/.N¾ N^NuNHx6N@eNuNHx N@eNuNVH0JO`f8 <Od#O` <O`#Od#OdOl#O`Oh .^rN.*yOhBOt g`(*(U g " Ҁe " Ҁd(M *@bOlfO`gB`ROt Oto "<N#OtBNŊX(@ 9Ot" Ҁe 9Ot/NŊX(@g yOl 9OlXg yOl  9Ot" ҀY(#Ol <O` A ` " Ҁ#OhOhc A#Op A 9Oh*A L0N^NuNVH0*n(MY#Oh (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Op L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLQX&`ghnt{Lhh$.4T.Tdd<r. <X[`!*4 ?;GP3Z hb|is z,T!x¸pŰ0Ű<Ɩ<ƼǼ (d.4~4:rC0JPuJX v`f  Dl u<}84>  H3:e a `Z f\XB|  L2u'W."P8 r A  G?R4\Fbtir*t{ m nn   [\^!TP$bF.Zex  $'.Oz6= pFNPW;n^Xg  o wyĊ}  d -0 -z^Qnfp!(.Z7h>DJ P?`V\f  .0nx4i:x[YslQ0RZZD.4Ƽ| ` [ , Z # ," 2  ;˜ A¾ Hx N7Ĵ WŊ ] d Ox iv ncrt0.oshutdown.o_sccsidOnice.octime.oOftime.ogeteuid.ogethostname.ofputc.okill.ofseek.ogetlogin.ofprintf.ofprintf.oprintf.oprintf.osetbuf.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrncat.ostrncmp.ofilbuf.operror.oerrlst.oOsignal.oexec.oexec.oexecve.ofork.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_nolog1_nolog2_nice_sint_strncmp_printf_tpath_killflg_utmp_nlflag_alarm__ctype__gethostname_hostname_lseek_fprintf_execle__flsbuflmodt_sleep_reboot_setbuf_tbuf_months_fflush_geteuid_unlink_ctime_getlogin_shutter_term_localtime_intervalldivt_fopen_strncat_nologin_stogo_strcmp_warn_kill_do_nothing_fork_nowtime_days_open_finish_perror_strcpy_signal_time_strlen_halt__iob_nolog_fseek_fclose_getsdt_log_entry_fputccerror_dysize_ftime_asctime_gmtime__filbuf_close_ttyslot__pfile__print_free_setjmp_longjmp_pause_fstat__sibuf_malloc_sys_errlist_write_errno_sys_nerr__sigfunc__sighandler_syscall_execl_execv_execve_gettimeofday_fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_rindex_ttyname_strcat_closedir_readdir_stat_opendir_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[=]lٹ X*”*•byX  8< t$G"I#HTHS/N4 /NdXNuNuNVBSX Jf Hy4HyNPHxNdX fHyK n /NXPJfNjJfHyNNXXHxNdX`pHyY . /NXPJfR/.Hy\NP/.HxUNP f( 9( @/HyvNP-|N-@fN/.NdX . X @/HxUNP f-| n /(NXXSJn/.NdXN^NuNV.*n ` .gRJfJf@B`^HH= @g` H@ H@B@ހHH0ހR`8B .S//. /.NH A *nN^NuNVH B*n JfJf4BL N^NuNV./9HxHnN Jf(p` n ` .gRJfJgA `A*HHx:HxHU/.a*@fB`Hx:HxHU ./a*@fp`~Hx:HxHU . /a*@fp`RHx:HU .$/a *@fp`*Hx HU .(/a *@fp`p*nN^NuNVJga,HyHyNP#f BB`pN^NuNVJg/9NXpN^NuNVJf aJfB`*HyD0a`X-@ g f <D0N^NuNV.aZJg$a*@JgHx/.HUN Jf `B*nN^NuNV.aJg(ap*@JgHx/.HmN Jf `B*nN^NuNVA-H#,Hn/. N P n0( gp`BN^NuNVA -H#,Hn/.N P09 gp`BN^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|0`D/.NHX+@f,mJf,0-g-HHD\+@`m+n f09gHyN2X0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9(l  @*PJg*LZ`0SR`*0Dtb1 nRJfDtc0R 9nB <DtL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N2 .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|$0+|$0+n 0-gl(m m R Э "-d f -,/HT-HH/N2 .+L`/.NHX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N2 . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N2 g m p`BL0N^NuNV.*|` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NHXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|` eB` 0,f -+fp`B, wf0Hx/.N4P.JgJm/NXHx` afvJgp`p//.NP.lB (f6Hx/.N4P.Jg Jm/NXHx/.NP.Jm.HxB/NZ `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNN@eNuNVHn/.NPJlB`pN^NuN N^NuNV/. Hy@t/.N> N^NuNBJQDX_ejPqx}T $8j|T|X.#*:.5; @?IPX_embtz>&hLhh$.4T.Tdd"<'r6.:E<IXRZc3kry8H  0<8R<,,<Hd ~4r 0'/<FjPY (`*jsX{X.H<tD+ , L2 0H2$'<.n4fp:f\CIPFHV\Zehlrx ~?`  $0y; 3Hi:x[YslQ0RZ!ZD(Z/.46<,A|HN>U[7$djBq Dv{crt0.oswapon.o_sccsidfstab.ofprintf.ofprintf.oprintf.oprintf.ostrncmp.ostrncpy.ofgets.ofilbuf.operror.oerrlst.osyscall.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_sys_errlist_getfsent_setfsent_fprintf_errno_endfsent_syscall_strcmp_perror__iob_strncmp_strncpy__ctype__fopen_getfsfile_fgets_getfsspec_fclose__pfile__print__filbuf_read_fflush_fstat__sibuf_malloc_write_sys_nerr_strlencerror_fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_creat_openptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[U^lٹ X*ž*ŸbyY  8_D D$G"I#HTHS/N4 /NXNuNuNV.BSX mD .SЮ @-P`* n rfR/.Hy4HnN0 -@Hn/.NPJl6 n /fHy`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|\ 9&аpl D @*PJg*LZ`0SR`*0fb1 nRJffc0R 9nB <fL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N. .B`T0-f(mfHn-HH/NPJmJn -|`-nDf9VHH/NXJgm+|&+|&+n 0-gl(m m R Э "-d f -,/HT-HH/N. .+L`/.NDX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N. . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N. g m p`BL0N^NuNV.*|0` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNH/.NDXN^NuNV .". nJ/H?N| n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuN8HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN8HxN@eBNuN8HxN@eNuN8HxN@eNuN8Hx&N@eNuNV/. Hyt /.N: N^NuNV/. Hy@t/.N: N^NuN8Hx6N@eNuNVH0Jg,f8 <g0#g, <g,#g0#g0g8#g,g4 .^rN>.*yg4Bg@ g`(*(U g " Ҁe " Ҁd(M *@bg8fg,gB`Rg@ g@o "<ND#g@BNX(@ 9g@" Ҁe 9g@/NX(@g yg8 9g8Xg yg8  9g@" ҀY(#g8 <g, A ` " Ҁ#g4g4c A#g< A 9g4*A L0N^NuNVH0*n(MY#g4 (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN>.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ g< L0N^NuN8HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL= 1%s changes from %d to %d rotational delay between contiguous blocks-d: missing %s%s: bad %s%s changes from %dms to %dms maximum blocks per file in a cylinder group-e: missing %s%s: %s must be >= 1%s changes from %d to %d minimum percentage of free space-m: missing %s%s: bad %s%s changes from %d%% to %d%% Usage: tunefs tuneup-options special-device where tuneup-options are: -a maximum contiguous blocks -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -m minimum percentage of free space cannot openbad super block%s: bad magic number FS SEEKFS WRITEtunefs: @(#)tunefs.c 4.1 (Berkeley) 3/22/83Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$gD. 40P&P07q?|J>Ufangzmv$D00FfJ,4&L '-?6<FCFJ<RY`RgLm(ry|,t.6>T\  <T r($+26x=C H?QjXT`vgPmzu|@Z~HdT$x.x<.R2=<A|IR3Zahov4~D,<4N<((8D~4 r0#q)*/.6~= DPMfVF0_ ejl &pT w};.0 &D &p$Tn&f FD< ^!|'-?39HC  &KyQLY`jDr3zrDi|pxT[<YJsjQRZ F8( :7 &,>3 gD8=crt0.otunefs.o_sccsidfprintf.ofprintf.oatoi.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostat.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_atoilmult_write_lseek_fatal_fprintf__flsbuf_sprintf_sbun_bread_fi_getsb_open_close_perror_bwrite_stat__iob__pfile__printulmult_sys_errlist_errno_sys_nerr_strlen__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufcerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[m_lقD Yby*¨byZ  8A\ $G"I#HTHS/N4 /NXNuNuNVSX NBHy4NVP-@HxHyX/Nf `Jf(J\f Hy>HyN PHxNXJ\gNJfHygNXHxNXaBNX`vHyr n /NPJfRXSX JnJobHyu n /NPJfHR\` . X @/aXJfRPSJn/9PNXN^NuNVN`-@gn @ < C"QaHyxHnNPJgDHyzHnNPJgHy}HnNPJfHnaXJl HnNXN^NuNVH(/.NXJl/.NX`JXg$/.HyHyN `J-fBHx//.NP*@JfgA-H&|X`Hx /.Hk N` Jfp |` <C"Q&|X` Jf@Xd@HxHyNP-@ X/HyX/.N p`,@Xeh/.HyHyN BL(N^NuNV.*n ` .gRJfJf@B`^HHe @g` H@ H@B@ހHH0ހR`8B .S//. /.N A *nN^NuNVH B*n JfJf4BL N^NuNV./9HxHnN Jf(p` n ` .gRJfJgA `A*HHx:HxHU/.a*@fB`Hx:HxHU ./a*@fp`~Hx:HxHU . /a*@fp`RHx:HU .$/a *@fp`*Hx HU .(/a *@fp`p*nN^NuNVJga,HyHyN4P#f BB`pN^NuNVJg/9N.XpN^NuNVJf aJfB`*HyHa`X-@ g f <HN^NuNV.aZJg$a*@JgHx/.HUN` Jf `B*nN^NuNV.aJg(ap*@JgHx/.HmN` Jf `B*nN^NuNVA-H#Hn/. NXP n0( gp`BN^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHx$N@eNuNVH0*n(nS o2Sm -R @` HUNXX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HHH+@`m+n f09gHyN~X0-gp` - //--HH/Nf *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9(l l @*PJg*LZ`0SR`*0Hb1 nRJfHc0R 9nB <HL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|(+|(+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXHe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NBXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N8 n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`HeB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NBXHx` afvJgp`p//.NVP.lB (f6Hx/.NP.Jg Jm/NBXHx/.NVP.Jm.HxB/N `Jgp`B//.NVP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NV N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuHxN@dNNuNVH0JIDf8 <IH#ID <ID#IH#IHIP#IDIL .^rN.*yILBIX g`(*(U g " Ҁe " Ҁd(M *@bIPfIDgB`RIX IXo "<N#IXBNX(@ 9IX" Ҁe 9IX/NX(@g yIP 9IPXg yIP  9IX" ҀY(#IP <ID A ` " Ҁ#ILILc A#IT A 9IL*A L0N^NuNVH0*n(MY#IL (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ IT L0N^NuNHxN@e#LBNu /йL/@HxN@e 9L#LNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLN@eNuNVHn/.NPJlB`pN^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN,Hx6N@eNuNVH0JBf8 <B#B <B#B#BB#BB .^rN.*yBBB g`(*(U g " Ҁe " Ҁd(M *@bBfBgB`RB Bo "<N#BBN~X(@ 9B" Ҁe 9B/N~X(@g yB 9BXg yB  9B" ҀY(#B <B A ` " Ҁ#BȹBc A#B A 9B*A L0N^NuNVH0*n(MY#B (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ B L0N^NuN,HxN@e#4BNu /й4/@HxN@e 94#4NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHxN~X-@HyMNXJg8/.HxNP/.N~XN^NuNVHxHyMNP`PJg" .c .`-n-|HzHxNP-@/.N~XN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHxhN@eNuNVH0BNXNl*@JgJ//.NPJg(m`XJg//.NPJfJ g/. /- NPJfN@ L0N^NuNVJffHypHyXNXP#f`/9fNX .jN^NuNVJfgJjf/9fNRXBfN^NuNVH0JffNHyrHyXNXP#ff2BL0N^NuNVH0*n`L(n `<f2 `>/9fHxHyNN -@g @ #gHyt/.aP*@gB#RHyw/.aP-@Jg @BR n  g  gHyz/.aVP*@gnB/.NX#R #R$#R(R(yRHy}HUa P*@f8`8R`4Jg8  g  gRd(HyHUaP*@gBfB <R`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nXf +| `D/.NX+@f,mJf,0-g-HHR+@`m+n Xf09|gHylNX0-gp` - //--HH/N^ *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9 Ȱl  @*PJgXh$:LXjy%;JViz4Kb|"2Im8M`Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNHxaN@eNuNHxN@eJgBNuNV4.-nBR`b y S m. .R @HH y "(R!AS AHH` /9 .R @HH/NPRR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N4X-@8/.N4XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.N4X".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn 0SR/94/90 .".NfrSdf`/90`SeB9S`>*LZ`0SR`*0Rb1 nRJfRc0R 9nB <RL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nlf9~HH/NXJgm+|-+|-+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|X` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N:XJl~0-g /-NXBBBB BmB- L N^NuNVN(/.NXN^NuNV .". nJ/H?N\ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|X`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N:XHx` afvJgp`p//.NNP.lB  f6Hx/.NP.Jg Jm/N:XHx/.NNP.Jm.HxB/N `Jgp`B//.NNP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NN N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JSf8 <S #S <S#S #S S(#SS$ .^rN.*yS$BS0 g`(*(U g " Ҁe " Ҁd(M *@bS(fSgB`RS0 S0o "<N#S0BNX(@ 9S0" Ҁe 9S0/NX(@g yS( 9S(Xg yS(  9S0" ҀY(#S( <S A ` " Ҁ#S$S$c A#S, A 9S$*A L0N^NuNVH0*n(MY#S$ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ S, L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL~M4*L  |L@Lls+  &.;BL$4T]ncfiov|>\z?(  -y;:3i\Px4[~ Y*sJ"(Q/R;AZH.OT[bh7qw~ S4crt0.ocomsat.o_sccsidsigset.o_cactions_setflgwait3.onostatusnoerrorsignal.osignalSIGDORTIsigoldnoerrorchdir.ofseek.orecv.ofprintf.ofprintf.oprintf.oprintf.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrncat.ostrncmp.ostrncpy.obind.ogetservbyname.ogetservent.oatoi.ofgets.ofilbuf.operror.oerrlst.orew.osocket.ofork.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_atoi_strncmp_printf_onalrm_utmp_recv_notify_sp_uf_strncpy_alarm_lseek_jkfprintf_fprintf_sigignore__flsbuf_wait_errno_sleep_nutmp_cr_chdir_mailforldivt_bind_wait3_fopen_strncat_socket_fstat_getservbyname_sin_gtty_fork_open__filbuf_perror_strcpy_stat_signal__iob_fseek_fclose_sigset_utmpmtimecactions_sighold_sigpause_sigsyssetflg__sigcatch_sigrelsecerror_fflush__pfile__print_setjmp_longjmp_pause_endservent_getservent_setservent_strcmp_fgets_rewind__sibuf_malloc_sys_errlist_write_sys_nerr_strlen__ctype__fcvt_ecvtlmodt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_ioctl_stty_realloc_sbrkuldivt_end_brkb[blٺ 4 |+*8by] # nd.local 4.4 83/05/19 # # nd.local - net disk local initialization file # # Each of the commands accepted can be given on the # command line as arguments or on standard input. # See also manual page nd(4). Syntax of each command: # # son # enables this host as a net file server. # # soff # turns off server status. # # user [ipaddr] [hisunit] [mydev] [myoff] [mysize] [mylunit] # For the client of the file server at [ipaddr], transform # incoming requests for [hisunit] into server device [mydev] # at offset [myoff] and size [mysize] sectors. /dev/ndl[mylunit] # provides a local name for this disk "subpartition". # # If [mysize] is "-1", then this user/unit is equivalent # to the entire filesystem partition [mydev] (no "subpartioning" # is done.) If [mysize] is positive, but [myoff] = "-1", then # this user/unit begins at an offset following the offset and # size of the previous command line. If [mylunit] is "-1", # then no local name is needed for this user/unit; this is usually # the case with a swap unit, or a unit represented by an entire # filesystem. # # If [ipaddr] is zero, [hisunit] refers to a public unit. # # ether [ipaddr] [hexetherhi] [hexetherlo] # Since the client doesn't know his IP address when he boots, this # entry binds a unique 6 byte ethernet address to an IP address. # # clear # Clear the kernel tables built by any previous commands. # # flush # Executed by a client, this clears the buffer cache of # any read-only public filesystem blocks (this also happens # automatically every hour and whenever the file server # broadcasts a "public flush" message.) This allows public # filesystem changes to eventually reach the clients. # # version [versionnumber] # Occasionally the need arises to reorganize or # reload the diskless partitions. Since the clients will rewrite # locally cached blocks, they must be kept from writing their # filesystems until they reboot. # # Before such a reorganization occurs, the system manager should # warn diskless users to save files and halt their machines. # Modification of the partitions should occur with the disk server # off. After modification is complete, [versionnumber] should be # incremented to force users to reboot. # # - # "/etc/nd -" tells the program to read commands # from standard input instead of parsing the command line. # clear version 1 b[clٹE9 *ˠ*ˣby_    ( 0 8 @ H P. \$G"I#HTHS/N4 /NxXNuNuNVBHy`Hy\NӨP#Jf HydHyNTPHxNxX y (3*S3HzPHx N `Hy/./. a -@Jgp//.aPJf n0( g* 98| @//. HyHx&a`HyHxaP/.NX# 98| @/HyHxa /.NX#<`^ .N^NuNV. 9 g gX gN/9HyHxa p`/.N(X. g fF n 0( f S m n (R!@S @ HH`/. Hx NpP n S m n "(R!AS AHH`/. /NpP f& n S mF n (R!@S @BHH n S m( n (R!@S @`/. BNpP` n0( f n 0( gd` n (HH-@ n(HH-@HxHn/.N -@o/Hn/.N Jl`vJmnB..N^NuNV. 9S b@0;NXpHyaX`HxHn n(HH/N -@o(/Hn n (HH/N Jlp`VJm`JHy HxazP`/.N(X. g f n 0( f n S m n (R!@S @` /.N(X. g: n S m n (R!@S @ HH`/. Hx NpPJg( n S mH n "(R!AS AHH n S m n (R!@S @` /. /NpP` n0( f n 0( fB..N^NuNV/.Hy%Hxa Hy:HxaPBNxXN^NuNV/.HybNPHyHn/. Nd HyfNXHyNFXJXgT/.HyiHyNT HyHn/. Nd HyrHyNTPHyNFXN^NuNV/.HytNPHyHn/. Nd HyxNXHyNFXJXgF/.Hy{HyNT HyHn/. Nd HyHyNTPN^NuNV/.HyNPHyNFXJXg/.HyHyNT N^NuNV/.HyHxa\ N^NuNV/.HyHxa> N^NuNVHyHxa$PN^NuNVHn/.NPJlv 98| @//.Hy`J/.NXJll 98| @//.Hy` 98| @//.HyHx&a`0p0. @g/.NXJmHyaXN^NuNV/.NXJl* 98| @//.HyHx&a$` HyaXN^NuNVHn/.NPJlp`B-@Hx/.N>PJl* 98| @//.HyHx&a`.JgHx y/(/.N Hy aXN^NuNV/.NXJl* 98| @//.HyHx&aD` HyaXN^NuNVHnNXJfHnHyHx`HnHy"Hxa N^NuNVHn/.NPJl, 98| @//.Hy=Hx&aB`HyEHx^aP .N^NuNV/. /.N΂PJl& 98| @/HymHx&a\ ` HyyaXN^NuNVBB/.NX-@J fB` n /g |f-|-n .Ю".df-A` n /g R nJf nBHy~/.NlPJfS`Hy/.NlPJgRJl-|Jg/.HyHx)ap .N^NuNV.A*H-/-/-//HyHyN <*nN^NuNVHxHx .X/Nx -@Jg @-P`-|BNtX-@HnN@X//.HyHyNTHyNFXN^NuNV.*nf`:  g  gRJf  g  fB`R  g  gfB` *nN^NuNVH HnNfXJlB`*nBA . RHUalX*@gJfA .B n rf .` .. n rf .` .,Nb*fL/NbX n rfp`B//NHP/NbXHn/.NPHxNX g2  @ /NbX/. /NPL N^NuNVH8 n(HH./NXHxHxNX0,H#,#l0,H` 9(( @  fB, <`h 9(( @  fR(#, < `8 9((*@HUNX-@Sѹ( o 9(( @  f 9(( @BHUa*X#l 9(( @ #, <` 9(( @HHQ @g 9((*@R( 9(( @HHQ @f 9(( @P 9(( @BHUN8X#l 9(( @ <` 9(( @HHR( ag4n2 FgX`H Cgo Ef <` Pgn0 Lgzn If <` Nf <` Sg^n Rfx < ` Tfd < ` pg n` fgn, cgn bf, <`p egJ` lgn igX` ng\` sgn rgb` tgh`HyvN*X`L0N^NuNV`2 nHHQ @g nHH R nJfN^NuNV/.NXR/NX-@JfHyN*X/./.NHP .N^NuNVH BB*| `*/NX-@JmfR .o.RJf P.JfHyHxNPpL"N-@Jf-| ЮS".N-@B`HyNXB` ".Nb$HBHBBBЂ $ "HAHABAЁԀ*BJmgp `p*//HyN ."HAHABAЁ$ Ԁ "HAHABAЁ dR/NX&`6Sm 9R @ HH`HyHx NpPRmRmHyNXRmHyNFXHyHyHx`/.HyHxN^ `\/.aX/.a"X*@gJmg/- /Hy"HxN^`/- //Hy0HxN^L N^NuNVHJy@oTSy@`J0H @< FfPJ8la #8lB8$|,`X Rf0*GfXJRm 0H8f<*lB`$JFf"09@H b@0;NH\\0H @0H〙*K0H @0H倗#h=F0H @<0H @0H2HЁR=@ nl*0.H8 @>0H @0D@2@g0H @0H8 @>0.HW 5b@0;N &Pz&Bfpv~ftftftnHy\N*XR<3@`n0H @0H<JFm< Fl60H8 @0H @ Pf0H8 @>`0H @<UYAԹd`J8g#8`Hyi/-NlPJgHym/-NlPJf4HywNX#g^# Hy{HxKN^P`@/-N XJg0B /-NX#/-HyHxKN^ Jf/-HyHxN^ /-N~X`/-NX`BX/-N` 9S b@0;NT\  f*HyHxN^P## ``HyHxN^P`nHy`Hy`HyHxN^P#`> $gHy1` - fHyFHx`HyQ`Hy\Hx` - gHyu`JgJg/-BNHPJf`JgJgHy/-NPJf`JgJgHy/-NPJfh`pJghHyHyNH`JgJg/-HyNHPJf `(Jg HyHy`JgJg/-HyNHPJf`JgJg /-NBXJf`Jg y/(N`JgJg /-NXJf|`Ba`x/-`/-`JgJg /-NRXJf@`HJgJg /-NXJf`$JgN2`Jg Hy`PHyHxN^PBNx`By@`-| n nm nm nm-| n nm3`#h`v#h`h#h`Z## `B## `.#`#`#`##$`##$`JgRHxHy/NP Jf8/NTX @#hJg/9Hx&N^PBh/`~#h`|JgJg//-N`HyHxN^PJg /-N~XJf`8BJgJg/-NpX-@JfJg /-N~X#h`#h`Jf\HyHxN^PBh`L#XL8N^NuNVH8(yH*n ~f, Df Hx~aXRHH/aXJfHH/a XJf -fHH/aX`Jg /f 9DR"9Hg. AB 9DR/a lXJg # 9DR/`/9/9DNHP/9Da X#H`dJfRJPfHy/9DaP`Hn/9DNPJmHy/9DaPR@`HH/aX/9HH/a4PJg&M` /gSSHb /fRRH yHB {fLBHUaP`RJPg*nN^NuNVH8BA-H n {g"nRR`HUaX#H LBL8N^NuNV./9DNX-@JgHn @/NPJmp0. @g$#8/.NX#`H/.NX*@Jg.Jg/.HmaPPJgHm/9DaLPR@`/.NX`R*n`@ }g`4 {fR`&Jg&S`HH [fRJg ]fRJfB(n&L` }g& g<`r [g\ {fR`XJg S`J ,fJf2TBHS/.NHPHmHnN PJ f-yHHnadX#H yHBaRA&HJgBL8N^NuNVH yS n .g4*yT#T/. /.a2P.#T.HH#P ` n .gBL N^NuNVH0*n(n #P`2 ?g" [gR {g6gBL0N^NuNVH0*n(n .HH-@Jg *g ?g [gZgBL0N^NuNVH0*n(n HTNX-@HUNXЮR.098Hl y4m#+`#>`y<g@HH/ n NX`Hn/. aPJg 2 f ~gHyQHTNlPJgHySHTNlPJf(]fL0N^NuNVH0*n(]ggHH/ n NX`L0N^NuNV.. /9HH/aPJg {fp`py<HH..N^NuNV. N^NuNV.. am zo Am Zo _fp`B..N^NuNV.. 0m 9np`B..N^NuNVH ..*n JgHHfp`BL N^NuNVH *nB`RJf L N^NuNVH0*n (n(f .L0N^NuNV.*n` /N~XJf/.N~X*nN^NuNVH8*n(n HTNX-@HUNXЮR/NX&@fHyVN*XHUHSNHPHTHSN P L8N^NuNVH0*nHUa XR/NX(@fHydN*XHUHTaPL0N^NuNV.*n`RJf *nN^NuNV./.NX*@fp`/-/.NHPB*nN^NuNVJ/ n/R##HyHy0NP=y-y`Hy2NX#f Hy5aXHy y/NPHyLNX09yfD 9g/9NX#,f HyOaX y, f`V/9NX#,f HyhahXHy 9,P/NP 9f09yf/9NXa^HyHyNP 9f09nfS/9NXJl HyaX 9N^NuNVJ/H~ 9,PRЇ @Jf 9ЇT n 9R,` 9І @ Їй"@PSJlJm 9Ї @/ йR# 9й @BS` 9,PЇ @ 9Ї"@`JlLN^NuNVJ//.NX//.HxN HxNxXN^NuNVJ/H0..*n Jo o#8p`  @(P  @ g0g(g g <*@`*|HU/NP*@ggf(M $ @B L0N^NuNVJ/H0..*n Jo o#8p`z  @(P  @ ggg <*@HU/NP*@ggf(M $ @ L0N^NuNVJ/...Jo o #8`Hx/NP..N^NuNVJ/...Jo n $ @Jf #8` </ /NP..N^NuNVJ/...Jo n $ @Jf#8p` <//NPB..N^NuNVJ/Hx/.NPN^Nu /"/ /<T<N@dNJg o Nu/<0N@dNNuJ/H // | pN o$Jg$/|LY/<0N@NrLNwNV#Hn /.N PN^NuNHxN@eNuNHx=N@eNuNVHB  @HHSЮ @ \"@  @HHSЮ @ x"@R mBB`r9\HH-@B ] @ \"@R mw9xHH-@B y @ x"@R mR  @HHmzB "HA00HABAЁІ @ "@HH["@ "HA00HABAЁІ @ ("@HH["@QR mR mLN^NuNVHB H @HHSЮ @ "@R @mBJ g p-@`-nB  @ "@R mB ."HA00HABAЁІ @HH" AHH AHH"D AR 0mB "HAHABAЁ. D @HH"E AHHЁ"F AHHЁ"G AHHЁ"H AHHЁ"pЁ"I AHHЁ @HH* . "$ A "% A "& A "' AR mB  @HH"p AHH# AHH" AR mB  @ "@R mR mB  @HH.  @ "@" AR mB  @HH @ .І"@R @mLN^NuNVHB t @BR BmB`6 @lHy(NP#6fB`/96HxHyN *@g# HUazX*@#HUajX*@HUN8X#HUaPX*@HUN8X#B#4 HUa&X*@#$HUaX*@#(HUaX*@#,`  gRJfB < *nN^NuNHx N@eNuNVH BJ mA . RNNR*@JgdB Э @Jg/. Э @/NlPJf^A . R f@/.Hy@HyNT Hn/.N6PJlHybNXp`R`tBL N^NuNVJxfHy|HylNP#x`/9xNhXN^NuNVJxg/9xNXBxN^NuNVH *n.. ` HHgRJfJgB L N^NuNVH0Jxf"Hy~HylNP#xfB`/9xHxHy0N *@Jg#4Hx:HUalP*@#8Hx:HUaXP*@/N8X#<#D@Hx:HUa0P*@Hx HUa"P(|D`d(Hx,HUaP*@JfB <4L0N^NuNHxN@eNu/@Hx)N@eNuNNHx*N@e o BNuNHxN@eNuNHxcN@eNuNHxbN@eNuNHxjN@eNuNHxN@eNuNVH0*n (|`4eB`^0,fBn  rg"l afHxB/.Nn `l -+f ll L0N^NuNVA-H#Hn/. N P n0( gp`BN^NuNVH *n.f `JfBL N^NuNVA -H#Hn/.N P09 gp`BN^Nu//HxYHxN@ Nu//HxYHx~N@ NuNHxPN@eNuNHxiN@eNuNVBJg>HxNX-@HyN,XJg8/.HxN

P`PJg" .c .`-n-|HzHxN/9HxHyN -@g @ #gHy/.aP*@gB#Hy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.N8X###(yHyHUa P*@f8`8R`4Jg8  g  gXd(HyHUaP*@gBfB <`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN(X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HH\+@`m+n f09gHyNFX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NPHH0`hrA`^HHQ @f fNHHQ @Dg6HH HHQ Agra"Ё.Rf .f .찎d @ XR`8JgHHQ @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 98l | @*PJg*LZ`0SR`*0tb1 nRJftc0R 9nB <tL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX4e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NbXJl~0-g /-N~XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`4eB` 0,f -+fp`B, wf0Hx/.NHP.JgJm/NbXHx` afvJgp`p//.NvP.lB 8f6Hx/.NHP.Jg Jm/NbXHx/.NvP.Jm.HxB/Nn `Jgp`B//.NvP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nv N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NvP. g `/NbXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHx N@eNuNVH0Jf8 <# <### .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<N#BN~X(@ 9" Ҁe 9/N~X(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#̹c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLw?@3i$%&'()EA<-./0:865klmnoprstu|{TSRQPON@?>e^WKJIHGF=<ED:87 6CB4321;;/.-,+*)"!~yxweIpdjonm      &.-+,123456(        )                  8888888888885%')*-./012 ,  34&"#$(+ 76!FTPD: command: %sYou could at least say goodbye.Unknown state in scanner.Ran out of memory.The following commands are recognized (* =>'s unimplemented). %s%c Direct comments to ftp-bugs@%s.Unknown command %s.Syntax: %s %s%-*s %s; unimplemented.yacc stack overflowsyntax errorftpanonymousftpGuest login ok, send ident as password.Password required for %s.User %s unknown.Type set to A.Form must be N.Type E not implemented.Type set to I.Type set to L (byte size 8).Byte size must be 8.STRU F ok.MODE S ok.Unimplemented STRU type.Unimplemented MODE type.wa/bin/ls/bin/ls %s/bin/ls -lg/bin/ls -lg %s..Goodbye.~Bad sequence of commands.Please login with USER and PASS.USER usernamePASS passwordACCT(specify account)REIN(reinitialize server state)QUIT(terminate service)PORT b0, b1, b2, b3, b4PASV(set server in passive mode)TYPE [ A | E | I | L ]STRU(specify file structure)MODE(specify transfer mode)RETR file-nameSTOR file-nameAPPE file-nameMLFL(mail file)MAIL(mail to user)MSND(mail send to terminal)MSOM(mail send to terminal or mailbox)MSAM(mail send to terminal and mailbox)MRSQ(mail recipient scheme question)MRCP(mail recipient)ALLOallocate storage (vacuously)REST(restart command)RNFR file-nameRNTO file-nameABOR(abort operation)DELE file-nameCWD[ directory-name]XCWD[ directory-name ]LIST[ path-name ]NLST[ path-name ]SITE(get site parameters)STAT(get server status)HELP[ ]NOOPXMKD path-nameXRMD path-nameXPWD(return current directory)XCUP(change to parent directory)@(#)glob.c 4.1 1/14/83t{{}Unknown user name after ~Bad directory componentsArguments too longPathname too long{{}Out of memoryOut of memory`{[*?Version 4.40 Sun May 15 03:07:19 PDT 1983/..getwd: cannot open .. ..getwd: read error in .. getwd: read error in .. .getwd: can't change back :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/passwdrrinigrp: %s is in too many groups setgrp/etc/grouprr/etc/hostsrr# /etc/servicesrr# ,/ Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$4@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83b[dlٹ߸ `*˴*˵by`   $ , 4 < HEL$G"I#HTHS/N4 /NXNuNuNV o( n /Hy\Hy N HxNX#v fF n # Hy Hy~/9 N Jf/9 N8XHxNXHyHyNP# JfHyN8XHxNXHy/9 aRPHyHyNP# JfHyN8XHxNXHy/9 aPHyHyNP# JfHyN8XHxNXHy/9 aPN/NXN^NuNV/.NXR/N`X-@/./NPHxN`X-@ @ nB .N^NuNV.*n`(HH @gHH RJf .*nN^NuNVH8 . g gZ g/.HyHy N `:HyHy NP n /Hy aTPHyHy NP(n *Lgb(mHUNX`&ng/a X/Hy/9 N (n *Lg//9 aP-|`&/aX//./9 N -|&kf y S m y (R!@S @ HH`/9 Hx NP(mHUNX`Z*n `Hy!/9 NP//9 aP n/aX/Hy&/9 N //9 aP n/aX/HyH/9 N /aHX*mgt/NX./aXJgZ`V(n `/NX }g//9 aP-|V&n`*/aTX//./9 N -|Y&kf y S m y (R!@S @ HH`/9 Hx NP(mHUNX*LfF/.aX/.aXL8N^NuNVH Hy]/. NP*@f@  |g/. N8XHxNX/. Hy_Hy N `@HUHxHxHnNX.g/./HxHnN`HUNXL N^NuNV.A *Hf /Hyu/.N `l@f,-//Hyx/.N`6-/-//Hy~/.N*nN^NuNV.A *H-/-/-//HyHnNHnHy/.N *nN^NuNVH0(n`(m/NXHUNX*LfL0N^NuNVH ..*yV` -fp` *UfBL N^NuNV.HxN`X*@f HyHy NPHxNX*V+n#V*nN^NuNV/./9 /9 HyHy NN^NuNVH @0Hf,# | # >JyoPSy`F0H @< FfRJlN4#lB$|`X Rf0*GfXJRm 0Hf<*lB`JFf"09H b@0;N0H @0H〙*K0H @0H倗A# =F0H @<0H @0H2HЁR=@ nl*0.H @>0H> @0D@2@g0H @0H @>0.HW b@0;N&>XbvXbXXXbX`HyaTXR3`n0Hz @0H<JFm< Fl60H @0H> @ Pf0H @>`B0Hz @<UYAԹd`2Jg(#`,BBB/-/-/-NN`BB/-/-/-/-`B/-/-/-/-/-`B/-/-/-/-/-`/-/-/-/-/-/-`# ` m!U# `lHxN`X# -@ @ nm nm nm y B`$B `L#  f &Uf-mJg n g $ cS y HH`: y, S m y, (R!@S @`/9,NX# fR 9 fB` 9-@ nR-Ko< .Ю&@ :b H f +H  fS nHH# gh`j#$ B`p nBSJg( T#g yJo#  @Jg y D/ T/(a$P gcY nHH#S fS y R `+H *@(`l <-@&@ ." Ҁ&A :bPH f>+H  fS nHH# g` . B @HHЮ&@ :bRH f@+H  fS nHH# g`*mg &UfS nHH# g``d nHH# # R# @B y X`: nHH# fS y R LYbJ9gp $ cS y HH`: y, S m y, (R!@S @`/9,NX# fR 9 fB` 99HH# JoX y0 S m$ y0 (R!@S @ HH`&/90/9 NP`L8N^NuNVJg nJg X @  fp`BN^NuNV $ cS y HH`: y, S m y, (R!@S @`/9,NX# fR 9 fB` 9N^NuNV y0 S m y0 (R!@S @ HH`/90/.NPN^NuNV# fS y R N^NuNVH0*n (n -+fp`B,HTNX wf0Hx/.N`P.JgJm/NXHx` afvJgp`p//.NP.lB  |f6Hx/.N`P.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JlB`*B@Jgl` rgl`l L0N^NuNV... f r` r`  g ..N^NuNVA-H#Hn/. N8P n0( gp`BN^NuNVH0*n(nBJ f<`D-n Sm ,R @` HTNX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NPSf0, fR .e .L0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n f +|`D/.N`X+@f,mJf,0-g-HHT+@`m+n  f09 gHy N^X0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *|  9 | $l  @*PJg*LZ`0SR`*0Tb1 nRJfTc0R 9nB <TL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NJ .B`T0-f(mfHn-HH/NPJmJn -|`-n f9 HH/NXJgm+|4+|4+n 0-gl(m m R Э "-d f -,/HT-HH/NJ .+L`/.N`X(@+Lfm`m+n B,`* -.,o+L/HT-HH/NJ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NJ g m p`BL0N^NuNV.*| ` HUaX te*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N`XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` teB` 0,f -+fp`B, wf0Hx/.N`P.JgJm/NXHx` afvJgp`p//.NP.lB  |f6Hx/.N`P.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNTHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N0PJlB`pN^NuNTHxN@eBNuNTHxN@eNuNTHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NV N^NuNV/. Hy@t/.NV N^NuNTHx6N@eNuNVH0JU4f8 <U8#U4 <U4#U8#U8U@#U4U< .^rNZ.*yU/9HxHyN8N -@g @ #gHy/.aP*@gB#R`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9)| l  @*PJg*LZ`0SR`*0Rb1 nRJfRc0R 9nB <RL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N6 .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|)+|)+n 0-gl(m m R Э "-d f -,/HT-HH/N6 .+L`/.NLX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N6 . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N6 g m p`BL0N^NuNV.*|` HUaX\e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NLXN^NuNV .". nJ/H?N n g B5H 4LN^NuNV .". nJ/H?N n g44l l<`<`NV .". nJ/H?//N oN> !APO`ZNN>*,N@f8Jf g,///:8/:0 "N !A :":N` !FLN^Nu?H<"Ba` H<"a&atLBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`\eB` 0,f -+fp`B, wf0Hx/.N8P.JgJm/NXHx` afvJgp`p//.NP.lB )|f6Hx/.N8P.Jg Jm/NXHx/.NP.Jm.HxB/N^ `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN@HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN@HxN@eBNuN@HxN@eNuN@HxN@eNuNV/. Hyt /.NB N^NuNV/. Hy@t/.NB N^NuN@Hx6N@eNuNVH0JS@f8 <SD#S@ <S@#SD#SDSL#S@SH .^rNF.*ySHBST g`(*(U g " Ҁe " Ҁd(M *@bSLfS@gB`RST STo "<NL#STBNX(@ 9ST" Ҁe 9ST/NX(@g ySL 9SLXg ySL  9ST" ҀY(#SL <S@ A ` " Ҁ#SHSHc A#SP A 9SH*A L0N^NuNVH0*n(MY#SH (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNF.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ SP L0N^NuN@HxN@e#`BNu /й`/@HxN@e 9`#`NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHxN&X-@HyFN@XJg8/.HxNP/.N&XN^NuNVHxHyFNRP`PJg" .c .`-n-|HzHxNP-@/.N&XN6`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH *| 9dl  @*PJgN@eNuNVHn/.NhPJlB`pN^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNVH0JGf8 <G #G <G#G #G G(#GG$ .^rN.*yG$BG0 g`(*(U g " Ҁe " Ҁd(M *@bG(fGgB`RG0 G0o "<N#G0BN:X(@ 9G0" Ҁe 9G0/N:X(@g yG( 9G(Xg yG(  9G0" ҀY(#G( <G A ` " Ҁ#G$G$c A#G, A 9G$*A L0N^NuNVH0*n(MY#G$ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ G, L0N^NuNHxN@e#TBNu /йT/@HxN@e 9T#TNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL/BNP/.NX/.NXHx/.NP n h Jf n!| /.NX n/( /NdP n/(NX n/( NdX#Hx: n/(HynN Hx9 n/( HyN Hx n/HyZN Hx/ n/( NHxNnX-@HyX,NXJg8/.HxNP/.NnXN^NuNVHxHyX,NP`PJg" .c .`-n-|HzHxNP-@/.NnXN~`N^NuNLHxN@eNuNLHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNLHxhN@eNuNVH0BNlXN*@JgJ//.NhPJg(m`XJg//.NhPJfJ g/. /- NhPJfN L0N^NuNVJbfHylHyTNP#b`/9bNpX .fN^NuNVJbgJff/9bNXBbN^NuNVH0JbfNHynHyTNP#bf2BL0N^NuNVH0*n`L(n `<f2 `>/9bHxHyX`N -@g @ #gHyp/.aP*@gB#\dHys/.aP-@Jg @BR n  g  gHyv/.aVP*@gnB/.NX#\l#\p#\t\h(y\hHyyHUa P*@f8`8R`4Jg8  g  g\d(Hy|HUaP*@gBfB <\d`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNpX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NĦPJmJn -|`-nTf +| `D/.NXX+@f,mJf,0-g-HH]+@`m+n Tf09xgHyhNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9 찹l  @*PJg*LZ`0SR`*0]b1 nRJf]c0R 9nB <]L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NB .B`T0-f(mfHn-HH/NĦPJmJn -|`-nhf9zHH/NİXJgm+|)+|)+n 0-gl(m m R Э "-d f -,/HT-HH/NB .+L`/.NXX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NB . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NB g m p`BL0N^NuNV.*|T` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N XBBBB BmB- L N^NuNVN/.NXXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|T` eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB  f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N. `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNLHxN@eNuNLHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N(PJlB`pN^NuNLHxN@eBNuNLHxN@eNuNLHxN@eNuNV/. Hyt /.NN N^NuNV/. Hy@t/.NN N^NuNLHx6N@eNuNVH0J]hf8 <]l#]h <]h#]l#]l]t#]h]p .^rNR.*y]pB]| g`(*(U g " Ҁe " Ҁd(M *@b]tf]hgB`R]| ]|o "<NX#]|BN X(@ 9]|" Ҁe 9]|/N X(@g y]t 9]tXg y]t  9]|" ҀY(#]t <]h A ` " Ҁ#]p]pc A#]x A 9]p*A L0N^NuNVH0*n(MY#]p (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNR.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ ]x L0N^NuNLHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /etc/passwdrrinigrp: %s is in too many groups setgrp/etc/grouprr/etc/servicesrr# ,/ Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ ]b[ 4hlٺ H**byd p x  8j $G"I#HTHS/N4 /N8XNuNuNVSX Jo:HyL n /NP#,Jf HxN8XB/9,NPB,BHxHnBN g BN8X.HHC bt@0;Nhhhhhzhhbhh*hh hhhJHm/9HNfXHy1laXXHy,aLXJ,g"Hy,Hy1lHyN/9,NdHy,NX/Hy1lNzP#HJlT/9,aVX`J,gHy]/9,NdPHy1laX/9HNfXJm#HJ,g/.Hyf/9,Nd /.HyrHy-lNt Hy-lNX/Hy-lHxN `NHy,a6XHy-,a*XJ,g"Hy-,Hy,Hyw/9,NdHy-,NX/Hy,NX//9HN. -@Jl"`Hy,aXHy,NX-@J,gHy,Hy/9,Nd B`Z ./ ./BN -@Jn(J,gHy/9,NdPHxN8X .Ѯ .m/.Hy/9HN -@JlN`Hy,aXJ,gHy,Hy/9,Nd Hy,NX-@ (o-|(/.Hy/9HN -@Jm~/.HyHy-lNt Hy-lNX/Hy-lHxN /.Hy`Hy\aXHy,aXJ,g"Hy,Hy\Hy/9,NdHy\NX=@Hy,NX-@HnHym/9HN Jm-n`J,gHy/9,NdPHnHy@m/9HN Jmf-|HxHnHxN `J,g .HH/Hy/9,Nd HxN8X``NV-nBHx .Ю/BN g BN8X .Ю @  gR @m .Ю @BN^NuNVJ,g* . @//.Hy/9,Nd . @//.HyHy-lNtHy-lNX/Hy-lHxN N^NuNVA-H#1Hn/. NP n0( gp`BN^NuNV.*nJg0-g /-NXms+n f mB `+m+| B*nN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^Nu*<LXjz 1EVet<[x0`w5Qi *>Q`Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVA-HA#1=|B-n-|Hn/. NPSm .R @BHH`HnBN0P .N^NuNV4.-nBq`b y1 S m. .R @HH y1"(R!AS AHH` /91 .R @HH/N0PRq nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHq @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHq @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|! PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|#`J.g-|%J.g"/.NX".-A< o-@ .Xf -|'L`-|8LA`-H-H`P .P-@@ .P-@P".DNVЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|I`-|L`Jl-| n P @-h-h/./.N*LZ`0SR`*0qb1 nRJfqc0R 9nB <qL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N2PJmJn -|`-nf9HH/NBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`TeB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NfXHx` afvJgp`p//.NzP.lB ,f6Hx/.NP.Jg Jm/NfXHx/.NzP.Jm.HxB/N. `Jgp`B//.NzP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nz N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jrf8 <r #r <r#r #r r#rr .^rN.*yrBr g`(*(U g " Ҁe " Ҁd(M *@brfrgB`Rr ro "<N#rBNX(@ 9r" Ҁe 9r/NX(@g yr 9rXg yr  9r" ҀY(#r <r A ` " Ҁ#rrc A#r A 9r*A L0N^NuNVH0*n(MY#r (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ r L0N^NuNHxN@e#XBNu /йX/@HxN@e 9X#XNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL n(/(//Hy~HyFN`H n(/(/(//HyHyFN <FN^NuNV m o n /HyNP` n -PHy8/(atPHyH n /(a`P-|83X n/(NXJgyX o n /( NXJoyX n/(a"X//.HyN -|H09XH/ n/(aX/HyN Hy4 n af <0s ` <0s //90NJ Jg/.aXN^NuNVHyNXN^NuNV f&Hy`Hy`HyHyNP`$ g 7g/.NXN^NuNV/.NX-@Jg. @ ( n 0 n/( . X//(N$ `/.N4X-@Jg0 @ ( n 0B n/( NP-@ @ . X"@"`r n 0/.NPX-@ g n !@`F/.NX-@ gB/`/.HyHyN HxNLXN^NuNVH .. ,.BNXN`*@Jg( -f - f//./-N JfN4 L N^NuNVH0*n(n .. SJg gp`BL0N^NuNVH ..,. BNXN*@Jg -f - fN L N^NuNVH8*nBNXN(@Jg,HU/N@PJg&l`XJgHU/N@PJfN L8N^NuNVJNfHyXHy@NP#N`/9NN$X .RN^NuNVJNgJRf/9NNXBNN^NuNVH0JNfNHyZHy@NP#Nf2BL0N^NuNVH0*n`8(n `(f `*/9NHxHyFN| -@Jg @ #gHy\/.aP*@gB#JHy_/.aP*@gB`R  g  gHybHUaZP-@Jg @BRHUNX#J#J#JJ(yJJg>*n`8R`4Jg8  g  gK\d(HyeHUaP*@gBfB <J`RJfRfBL0N^NuNV... f `"  f ` ..N^NuNV l .r` .r` m .က -@-@A  @"|K`" <K`N^NuNV... f r` r`  g ..N^NuNVH *nA-HB| 0f|R xg Xf|` "N HH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎ep`p n XR`4JgHH @g n XA .쐈* bBB`A  Re L N^NuNVH0B(n B`4 TJg2B,BBlB,/NX*o-E RJfHyh/.NP-@JfB`/.HxHx HnN8 g& g  g/.NXp`P  f <`p ЮЮЮЮ-@Ю-@..Jg,<l,B/./.N /.Hx/HnN8*ݮA(H mJgp,fB .Д//.N /.Hx .R/HnN8*n `f UJgdB` Ѕ @AfBR Ѕ @JfAJf,+ll;llSf/.NX`x Jf `4L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/NB "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/NB -@ nBJg n S m n (R!@S @`t/.NX`f n0(gV/NX n0(gB nh n"H#h/./. n(HH/NB -@ fp`BLN^NuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#xHn/.NP09 gp`BN^NuNVH0*n(nBJ f<`D-n Sm ,R @` HTNX.mSfR .e .L0N^NuNVH0*n(nBJ fJ`R.. SmHH",R AHH`HTHH/NDPSf0, fR .e .L0N^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNVH8*nBNXN`(@Jg,HU/N@PJg&l`XJgHU/N@PJfN4 L8N^NuNVJxfHyHylNP#x`/9xN$X .|N^NuNVJxgJ|f/9xNXBxN^NuNVH0JxfNHyHylNP#xf2BL0N^NuNVH0*n`<(n `,f" `./9xHxHyKdN| -@g @ #gHy/.aP*@gBHy/.aP*@gB#OhO/.NPX yO #O#O`R  g  g#Ox#OO|(yO|HyHUaP*@f8`8R`4Jg8  g  gPd(HyHUaP*@gBfB <Ox`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N~PJmJn -|`-ndf +|`D/.NTX+@f,mJf,0-g-HHP+@`m+n df09gHyxNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "N HH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9l 8 @*PJg HxHyHxN> HUNX/HUHxN> HxHyHxN> L N^NuPXb|*<H^p|$<I_nz (9Xo'FVm:\qError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNXBB-HH/NB B+mm0-gm*nN^NuNHHxaN@eNuNVA-HA#=|B-n-|Hn/. NPSm .R @BHH`HnBNDP .N^NuNV4.-nBP,`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NDPRP, nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNjЮLЮ@ @S"n .P".DNT-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPPJf/./.NxPJfHnHn .R l .R`p//./.NX-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr Nj0S n .Hr NT`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPPJf/./.NxPJfHnHn *LZ`0SR`*0P0b1 nRJfP0c0R 9nB <P0L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N> .B`T0-f(mfHn-HH/N~PJmJn -|`-nxf9HH/NXJgm+|&+|&+n 0-gl(m m R Э "-d f -,/HT-HH/N> .+L`/.NTX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N> . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N> g m p`BL0N^NuNV.*|d` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NTXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|d`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/NB `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N$PJlB`pN^NuNHHxN@eBNuNHHxN@eNuNHHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NJ N^NuNV/. Hy@t/.NJ N^NuNHHx6N@eNuNVH0JPf8 <P#P <P#P#PP#PP .^rNN.*yPBP g`(*(U g " Ҁe " Ҁd(M *@bPfPgB`RP Po "<NT#PBNX(@ 9P" Ҁe 9P/NX(@g yP 9PXg yP  9P" ҀY(#P <P A ` " Ҁ#PPc A#P A 9P*A L0N^NuNVH0*n(MY#P (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ P L0N^NuNHHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL*n`8R`4Jg8  g  gI`d(HyHUaP*@gBfB <H`RJfRfBL0N^NuNV l .r` .r` m .က -@-@A  @"|Id" <IdN^NuNVH *nA-HB| 0f|R xg Xf|` "N(HH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎ep`p n XR`4JgHH @g n XA .쐈* bBB`A  Re L N^NuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#Hn/.NP09  gp`BN^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNVH8*nBNXN(@Jg,HU/NPJg&l`XJgHU/NPJfN L8N^NuNVJfHyHyNP#`/9N@X .N^NuNVJgJf/9NzXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`<(n `,f" `./9HxHyIhN -@g @ #gHy/.aP*@gBHy/.aP*@gB#MlM/.NlX yM #M#M`R  g  g#M|#MM(yMHy"HUaP*@f8`8R`4Jg8  g  gNd(Hy%HUaP*@gBfB <M|`RJfRfBL0N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N.PJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HHN+@`m+n f09 gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "N(HH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|( 9*LZ`0SR`*0N4b1 nRJfN4c0R 9nB <N4L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N.PJmJn -|`-nf9"HH/N8XJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NbXJl~0-g /-NXBBBB BmB- L N^NuNVNP/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NbXHx` afvJgp`p//.NvP.lB f6Hx/.NP.Jg Jm/NbXHx/.NvP.Jm.HxB/N `Jgp`B//.NvP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nv N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JNf8 <N#N <N#N#NN#NN .^rN.*yNBN g`(*(U g " Ҁe " Ҁd(M *@bNfNgB`RN No "<N#NBNX(@ 9N" Ҁe 9N/NX(@g yN 9NXg yN  9N" ҀY(#N <N A ` " Ҁ#NNc A#N A 9N*A L0N^NuNVH0*n(MY#N (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ N L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHxNFX-@HyJN`XJg8/.HxNP/.NFXN^NuNVHxHyJNrP`PJg" .c .`-n-|HzHxNP-@/.NFXNV`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHxhN@eNuNVJfHyHyNdP#`/9NX .N^NuNVJgJf/9N^XBN^NuNVH0JfNHyHyNdP#f2BL0N^NuNVH0*n`<(n `,f" `./9HxHyK$N0 -@g @ #gHy/.aP*@gBHy/.aP*@gB#O(OH/.NX yOH #OD#O@`R  g  g#O8#OLO<(yO/9HxHyON0 -@g @ #gHy/.aP*@gB#SHy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.NX#S#S#SS(ySHyHUa P*@f8`8R`4Jg8  g  gTtd(HyHUaP*@gBfB <S`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +| `D/.NX+@f,mJf,0-g-HHTx+@`m+n f09gHyNX0-gp` - //--HH/Nj *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9xl  @*PJg*LZ`0SR`*0Tb1 nRJfTc0R 9nB <TL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NǾ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|*+|*+n 0-gl(m m R Э "-d f -,/HT-HH/NǾ .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NǾ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NǾ g m p`BL0N^NuNV.*|` HUaXle*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NFXJl~0-g /-NĆXBBBB BmB- L N^NuNVN4/.NXN^NuNV .". nJ/H?Nh n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`leB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NFXHx` afvJgp`p//.NZP.lB xf6Hx/.NP.Jg Jm/NFXHx/.NZP.Jm.HxB/N `Jgp`B//.NZP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NZ N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N¤PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JTf8 <T#T <T#T#TT#TT .^rN.*yTBT g`(*(U g " Ҁe " Ҁd(M *@bTfTgB`RT To "<N#TBNņX(@ 9T" Ҁe 9T/NņX(@g yT 9TXg yT  9T" ҀY(#T <T A ` " Ҁ#TTc A#T A 9T*A L0N^NuNVH0*n(MY#T (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ T L0N^NuNHxN@e#pBNu /йp/@HxN@e 9p#pNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLJg BNXB .హ gg /.NNXR mBHy9NbPHxBNPHxBNPHxHy;NbP-@Jm BHy tq/N /.NNXJo n /NXNpNNJlB y y| yBh y!|Hy\NXHyHxNPNp"9 -@p".㠁BBBHnHxNR.Jmp"9 g /9 aXp".g/.aX`NV-|HnHnBHxHy /.N&-@JnJlL g@HyDN̠`0 f(HxNjX/.HnNPHxNXN^NuNV-|`>JgTHyMN̠X ."HAHABAЁ/N\X .-@BB/. /.NԞ-@mJfp`fBHx/./.NJl@Jg:HyTN̠X ."HAHABAЁ/N\X .-@`Jg .N^NuNVH0*y`V -( fH -(gA` -(fA(H -(@gp`B.HU/HT nN *UfL0N^NuNVHx/./. /9 n0N @ PNJ g* n/($HxHy /. Hx @(HH/NPHx y (HH/NP# N^NuNVJ g"J g/9 NfXB B N^NuNVH0*nJg(m x"-e+UJloJg /,NXBBNPX( n )P)h)h )h Jo./.NHX)@Jg/.//.N\ `B9n9nL0N^NuNVH Jgp/. Hy/.N0 . -@ .-@ n/(4 n/( n/(Hy/.N0-| ~*|L`4 n0(,Hg$/-/./.N0 Jg -| BPJnHy/.N0P-|~*|l`4 n0(.Hg$/-/./.N0 Jg -|BPJn n S m n (R!@S @ HH`/.Hx NP n0(. fJ8g /(8/.aP/.NXL N^NuNV.*n /-PHy /.N0 Hm*n`8R`4Jg8  g  gTd(HyHUaP*@gBfB <T$`RJfRfBL0N^NuNV... f `"  f ` ..N^NuNV l .r` .r` m .က -@-@A  @"|T" <TN^NuNV... f r` r`  g ..N^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎ep`p n XR`4JgHH @g n XA .쐈* bBB`A  Re L N^Nu o"o !I""P#HNu o"P h #HNuNVH0B(n B`4 TJg2B,BBlB,/NHX*o-E RJfHy/.NlP-@JfB`/.HxHx HnN g& g  g/.NNXp`P  f <`p ЮЮЮЮ-@Ю-@..Jg,<l,B/./.N0 /.Hx/HnN*ݮA(H mJgp,fB .Д//.N0 /.Hx .R/HnN*n `f UJgdB` Ѕ @AfBR Ѕ @JfAJf,+ll;llSf/.NfX`x Jf `4L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/N "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/N -@ nBJg n S m n (R!@S @`t/.NX`f n0(gV/NX n0(gB nh n"H#h/./. n(HH/N -@ fp`BLN^Nu/@Hx)N@eNuN<NgSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9`/9\ .".N0l< 0N0///./. 9"9NN-@-A`RHH.  @f .gZ`t/9`/9\ .".N0l< 0N0///./. 9"9NN-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g( d @/(/ .".N-@-AJg R mJl/./. .".Np`/./. .".N-@-A/.//NH -@-AJl ` .".L N^NuNHxNX-@HyTN8XJg8/.HxNP/.NXN^NuNVHxHyTNJP`PJg" .c .`-n-|HzHxNP-@/.NXN.`N^NuN/9HxHyYNȌ -@g @ #gHy/.aP*@gB#]Hy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.NX#]#]#]](y]HyHUa P*@f8`8R`4Jg8  g  g^Hd(Hy HUaP*@gBfB <]`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n f +|`D/.NHX+@f,mJf,0-g-HH^L+@`m+n  f09 gHy NX0-gp` - //--HH/Nr *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|  9԰ l H @*PJg*LZ`0SR`*0^db1 nRJf^dc0R 9nB <^dL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N2 .B`T0-f(mfHn-HH/NPJmJn -|`-n f9 HH/N$XJgm+|/+|/+n 0-gl(m m R Э "-d f -,/HT-HH/N2 .+L`/.NHX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N2 . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N2 g m p`BL0N^NuNV.*| ` HUaX he*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NNXJl~0-g /-NXBBBB BmB- L N^NuNVNBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` heB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NNXHx` afvJgp`p//.NbP.lB f6Hx/.NP.Jg Jm/NNXHx/.NbP.Jm.HxB/N `Jgp`B//.NbP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nb N^NuNN@eNuNVHn/.NPJlB`pN^NuNP#f #;HnHyHaP#f #KHnHySaP#f #VHnHyeaP#f #hHnHymaP#f #pHnHy}aP#A#A*H` :g |g yRJf yBA#Hy/9NP#f #H yJgTJfLHn/NPJl/9/9Hya( `Jnf/9Hya P`/9/9HyHnNHnHnNPJm$HnNZXJg/9/9Hy`N.l/9Hy`JffB/9Hx//9N`PJg .R` 9-@//9N/9/9Hya8 HxNl` /9NXHnaXJf|L N^NuNV y(HH/NX=@/9Jng <` <//9N /././. /./9NJng@ y S m y (R!@S @ HH`/9Hx NdP y S m y (R!@S @ HH`/9Hx NdP/9NXN^NuNVHyHyHNP/. /.HyHN SHm 9LRL @ HH`HyHHx NdPHxNlXN^NuNVH0BBJ0l2BHyNP#0lHy*HyaRPB4`B/94/90Nb #D*nfFHxHn/90N ,Jn&/90NXB4B`z :gR`BAHH*R fc. -\f&S` .e Hy8aX`lB߹4(yD #gRJgLpL0N^NuNV.*nJfn :fR *nN^NuNV.*yDHUaX*@JfJB*nN^NuNVH8*n n (PHH.g :g  \gN ^g:` nfJg(f @g =fR/. HUaP`.`&|PHH.HHfHH`RJf  @g0-|HH0Sg\HH @f`@B n *P L8N^NuNVA-H#Hn/. NP n0( gp`BN^NuNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNXHx;N@eNuNXHxN@eJgBNuNVA-HA#=|B-n-|Hn/. NPSm .R @BHH`HnBNdP .N^NuNV4.-nBD`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NdPRD nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-||-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|} PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNd-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NpPJf/./.NPJfHnHn .R l .R`p//./.Nx-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9h/9d .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr Nd`S n0A .ذbJn/9p/9l .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NpPJf/./.NPJfHnHn *LZ`0SR`*0Db1 nRJfDc0R 9nB <DL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NN .B`T0-f(mfHn-HH/NPJmJn -|`-n4f9FHH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/NN .+L`/.NdX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NN . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NN g m p`BL0N^NuNV.*| ` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NdXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| `eB` 0,f -+fp`B, wf0Hx/.NN@eNuNVHn/.N$PJlB`pN^NuNXHxN@eBNuNXHxN@eNuNXHxN@eNuNXHx&N@eNuNV/. Hyt /.NJ N^NuNV/. Hy@t/.NJ N^NuNXHx6N@eNuNXHx N@eNuNVH0JEDf8 <EH#ED <ED#EH#EHEP#EDEL .^rN^.*yELBEX g`(*(U g " Ҁe " Ҁd(M *@bEPfEDgB`REX EXo "<Nd#EXBNX(@ 9EX" Ҁe 9EX/NX(@g yEP 9EPXg yEP  9EX" ҀY(#EP <ED A ` " Ҁ#ELELc A#ET A 9EL*A L0N^NuNVH0*n(MY#EL (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN^.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ ET L0N^NuNXHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHy N HxNX3LSX BBHxHxN-@JlHyNNXHxNX 9g.BBHxHy/.NJlHy[NXBBHxHy/.NJlHywNXBHxHyJ/.NjJlHyNXHxNXHzHxN8PHx /.NP` |gHyNX-|BHnHn/.N-@JmNJf(HxHxNtP/.N"XHn/.a.P/.N"`NVBHxHnN JnN^NuNVӜ.-|ӪBHxNtPBHxNtPBHxNtP n "H3h n Pf he HyHy NPHxNXHx HySHx(Hna( NlHnN0X-@JfHy[aXHxNXN n/(NXJlHymNXHnHn nJfp`B/ n/NJlHyoaTXHxNXHxHyHxNЊ JngHnNjXJlHya XHxNXN-@׼ ׼fHyaXHxNXJ׼gVBN"XHxN"XHxN"X/.N"X/.N"Xp".r$.塀-@״HnӪHyf~/.N˖ -n״׸BBBHn׸HxNbJmp".׸g@HxHnӯ/.NF Jnp".F״`.ӯHH//.׼NPp".׸gZB|HxHnӰ/.NF -@װJn Hx/.NPp".F״`/.װHnӰ/.NЊ J״f BNXNɆ/BN4P/.N"X/.N"XHx/.NLP n h Jf n!| /.N"X n/( /NP n/( NlX n/(NX#Hx: n/(HynN Hx9 n/( HyN Hx n/HyZN Hx/ n/( NʄP-@JgR` n-h BHnHy/. n/( N n/( NXHxNXHyaXHxNX$.ӜN^NuNV|/.HnNPHnNX/HnHxNЊ N^NuNVHxHnBNF g HxNX nRS f/.HyaxPHxNXJ.fN^NuD/<%N@dNДBNu/<'N@dNДNu/HxNX-@HyRXNXJg8/.HxNtP/.NXN^NuNVHxHyRXNP`PJg" .c .`-n-|HzHxNtP-@/.NXN`N^NuNДHxN@eNuNДHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNДHxhN@eNuNVH8*nBNXND(@Jg,HU/NʰPJg&l`XJgHU/NʰPJfN L8N^NuNVJfHyHyNP#`/9NX .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`<(n `,f" `./9HxHyRN -@g @ #gHy/.aP*@gBHy/.aP*@gB#VV/.NX yV #V#V`R  g  g#V#VV(yVHyHUaP*@f8`8R`4Jg8  g  gW/9HxHyW@N -@g @ #gHy/.aP*@gB#[DHy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.NhX#[L#[P#[T[H(y[HHy HUa P*@f8`8R`4Jg8  g  g[d(Hy HUaP*@gBfB <[D`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNXX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.NˠX+@f,mJf,0-g-HH[+@`m+n f09gHyNNX0-gp` - //--HH/NF *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9|$l  @*PJg*LZ`0SR`*0[b1 nRJf[c0R 9nB <[L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NЊ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9 HH/NXJgm+|(+|(+n 0-gl(m m R Э "-d f -,/HT-HH/NЊ .+L`/.NˠX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NЊ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NЊ g m p`BL0N^NuNV.*|` HUaXte*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N"XJl~0-g /-NRXBBBB BmB- L N^NuNVN/.NРXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`teB` 0,f -+fp`B, wf0Hx/.NPP.JgJm/N"XHx` afvJgp`p//.N6P.lB |f6Hx/.NPP.Jg Jm/N"XHx/.N6P.Jm.HxB/Nv `Jgp`B//.N6P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N6 N^NuNДHxN@eNuNДHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NpPJlB`pN^NuNДHxN@eBNuNДHxN@eNuNДHxN@eNuNV/. Hyt /.N˖ N^NuNV/. Hy@t/.N˖ N^NuNДHx6N@eNuNVH0J\Hf8 <\L#\H <\H#\L#\L\T#\H\P .^rNΚ.*y\PB\\ g`(*(U g " Ҁe " Ҁd(M *@b\Tf\HgB`R\\ \\o "<NΠ#\\BNRX(@ 9\\" Ҁe 9\\/NRX(@g y\T 9\TXg y\T  9\\" ҀY(#\T <\H A ` " Ҁ#\P\Pc A#\X A 9\P*A L0N^NuNVH0*n(MY#\P (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNΚ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ \X L0N^NuNДHxN@e#xBNu /йx/@HxN@e 9x#xNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL/tmp/dki; fi sed < /tmp/dki > /tmp/dko -n -e " s:\([0-9]*\) cylinders \([0-9]*\) heads \([0-9]*\) sectors/track:cy=\1;he=\2;se=\3:p s/$pa: \([0-9]*\) sectors (\([0-9]*\) cyls)/psec=\1;pcyl=\2/p" . /tmp/dko if [ `expr $he \* $se \* $pcyl` -ne $psec ] then echo bad parse of dkinfo exit fi : 6 megabytes per user swap area usecswap=`expr 6 \* 1024 \* 2` onecyl=`expr $he \* $se` if [ ! -f /dev/rndl0 ] then cd /dev MAKEDEV nd fi /etc/nd clear if [ ${op} = first ] then : pub area at least 17 megabytes pubcyl=`expr 17 \* 1024 \* 2 / $onecyl` pubsec=`expr $pubcyl \* $onecyl` ucyl=`expr \( $pcyl - $pubcyl \) / $nu` usec=`expr \( $ucyl \* $onecyl \) - $usecswap` pubsec=`expr $pubsec + \( $pcyl - $pubcyl \) % $nu \* $onecyl` echo "user 0 0 /dev/$du$pa 0 $pubsec -1" >/tmp/ndl /etc/nd - /etc/mkfspub chmod 755 /etc/mkfspub off=-1 n=0 else n=`awk '$1 == "user" && $7 > max { max = $7 } END { print max }' max { max = $7 ; sec = $6 } END { print sec }' /etc/mkfs$du chmod 755 /etc/mkfs$du : now just append the nd lines /etc/nd user localhost 0 /dev/$du$pa $off $usec $n $debug /etc/mkfs /dev/ndl$n $usec $se $he 4096 1024 /etc/nd clear while [ $n -lt $nu ] do echo "user localhost 0 /dev/$du$pa $off $usec $n" >>/tmp/ndl echo "user localhost 1 /dev/$du$pa -1 $usecswap -1" >>/tmp/ndl n=`expr $n + 1` off=-1 done if [ ${left}x != x ] then if [ $left -ne 0 ] then echo "user localhost 2 /dev/$du$pa $off $left $n" >>/tmp/ndl fi fi ed /etc/nd.local <HxNX-@HyRN,XJg8/.HxNP/.NXN^NuNVHxHyRN>P`PJg" .c .`-n-|HzHxNP-@/.NXN"`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHxhN@eNuNVH0BNXN*@JgJ//.NPJg(m`XJg//.NPJfJ g/. /- NPJfN\ L0N^NuNVJ6fHy@Hy(NpP#6`/96N\X .:N^NuNVJ6gJ:f/96NjXB6N^NuNVH0J6fNHyBHy(NpP#6f2BL0N^NuNVH0*n`L(n `<f2 `>/96HxHyS N -@g @ #gHyD/.aP*@gB#WHyG/.aP-@Jg @BR n  g  gHyJ/.aVP*@gnB/.N,X#W#W#W W(yWHyMHUa P*@f8`8R`4Jg8  g  gWd(HyPHUaP*@gBfB <W`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n(f +|`D/.NX+@f,mJf,0-g-HHW+@`m+n (f09LgHy`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|T 9hl p @*PJgM\t$C`qH_~9Qr&9HError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNHxN@eNuNHxaN@eNuNHxN@eJgBNuNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNVA-HA#=|B-n-|Hn/. NPSm .R @BHH`HnBNP .N^NuNV4.-nBW`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRW nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NLX-@8/.NLXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NLX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DN ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9p/9l .".N4gP .S-@HJlD-@HJHg6 .Hr N 0S n .Hr N`S n0A .ذbJn/9x/9t .".N4fp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Wb1 nRJfWc0R 9nB <WL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|(`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NRXHx` afvJgp`p//.NfP.lB f6Hx/.NP.Jg Jm/NRXHx/.NfP.Jm.HxB/N `Jgp`B//.NfP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nf N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JXf8 <X#X <X#X#XX #XX .^rN.*yXBX( g`(*(U g " Ҁe " Ҁd(M *@bX fXgB`RX( X(o "<N#X(BNĶX(@ 9X(" Ҁe 9X(/NĶX(@g yX 9X Xg yX  9X(" ҀY(#X <X A ` " Ҁ#XXc A#X$ A 9X*A L0N^NuNVH0*n(MY#X (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ X$ L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL.profile cp etc/rc etc/rc- echo "/etc/mount /dev/${disc}0g /pub" | cat - etc/rc- >etc/rc sync : setup sym links from root to pub, hold your breath mv bin bin- bin-/ln -s /pub/bin bin sync mv bin-/sh /tmp rm -rf bin- rm -rf lib ln -s /pub/lib lib dd if=/pub/usr/mdec/bootnd of=/dev/${disc}0g bs=1b count=15 seek=1 sync : setup private usr files cd /pub/usr tar cf - adm crash preserve spool tmp | (cd /usr; tar xfp -) mkdir /usr/local sync : symlink to pub/usr cd / for i in bin dict games hosts include lib ucb do ln -s /pub/usr/$i /usr/$i done sync : make 1st diskless user mkdir /x /etc/mount /dev/ndl0 /x cd / tar cf - [a-o]* [q-w]* | (cd /x; tar xfp -) cd /x/dev MAKEDEV std nd pty0 cg cd /x : diskless only patches : ensure that public binaries are accessable ASAP after boot mkdir pub pub/bin cp /bin/sh pub/bin echo "/etc/mount -r /dev/ndp0 /pub" | cat - /.profile- >.profile echo "/etc/mount -r /dev/ndp0 /pub" | cat - /etc/rc- >etc/rc rm /.profile- /etc/rc- cat <etc/fstab /dev/nd0:/:rw:1:1 /dev/ndp0:/pub:xx:1:1 ! rm vmunix ln -s /pub/vmunix vmunix cd / sync /etc/umount /dev/ndl0 : server only patches echo "/dev/${disc}0g:/pub:rw:1:1" >>/etc/fstab ed - /etc/fstab <HzHxNPHx /.N^P`\Hy+NXHxN`LHy;NXHxN` TgHyINXHxNXBBB/.NN-@JmN-@lHyYN`JfHxHxNP/.a.X/.N`NVBHxHnNL JnN^NuNV-||BHykNXЮ @ .u"@Hx/.NP-@JnR mHy/.aPB/.N0PHyNXЮ @tHxHyNP-@Jm BHy tq/N /.NXHx/.NP-@Jl/9T/./.az HnHy@t/.N =| HnHyt /.N HnHy@t/.N nHnHyt /.N N-@l/9THy/.a Jg/./.aP/.NX/.NXB/.N0PHx/.N0PHx/.N0P/.NXBHyHyN /9THy/.aT N^NuNV/. HyHnNl HnNX/Hn/.N HxN0XN^NuNV .< @//. HyHnNlHn/.a~PN^NuNV.-|#d# HnHyf~/.N HnHyf~/. N HxHxNPHzHxNPHxatXmBB 9txgp".㠁` p". 㠁 9hlgp". 㠁` p".㠁JXl J LmBBHnHnHxNJfJfHxNX`bp".gJHxHyl/.N #XJl #TfBX`JXo#lpp". gHxHyL/. N # LJl #TfB L`vJ Lo#Ld`X <Tt mL yd.RdS L f ytRt ytRtJ Lnp".g 9txoa2JXoa4p". g 9hloa`ar..N^NuNV.`N <dh mB yp.RpSX 9 b@0;Nh2JVr` f#`J\n yhRhJ9lf f#`Jg g yhRhB`t  b@0;N"..ftttta` yh`a\HnHy@t/9N f.`.HH`j#` `B#` f#` gp` l @Jf /aX` l @Jg/a` l @Jf/ab` l @Jg l @B/Hy^/9tNl Vt`/9HyNPHxN0XJXn..N^NuNV . bd@0;NZ"ZZZBHx `HxBa&P .l @-|L/././9tNl Vt` -|R`N^NuNV .Jg@ g0 g<-|R/././9tNl Vt`$BHx`Hx BaP .l @B`N^NuNV . b@0;N>6H-|^/././9tNl Vt`BHx`BHx aP-|X`N^NuNVaHnHy@t/9N 0. n . FnHnHyt /9N N^NuNValHnHy@t/9N 0. g yhB`2HnHy@t/9N Jlp`.HH yhRhN^NuNV 9hl-@o//9l/9N -@Jm, .ѹl 9lhf#dh#hlN^NuNV 9tx-@o//9x/9dN -@Jl #Tf.`, .ѹx 9xtf# Tt#txN^NuNVa6NHx/9dNPHx BN&PHxN0XN^NuNV.BHxHyNP.Jl`HxHyHylN Jf^J9tgVHxHx/N& HxHyHytN\ Hy|N,XHxHyl/N RHxHyl/N gf/NXJgHxHyNP.JmtHxHyHylN\ HxHyHytN\ Hy|N,XHxB/N& HxHyl/N /NXHxHy|NPBBHy|N HyNX| @pHxHy|NPBBHy|N ..N^NuNVJ/H0..*n Jo o#Tp`  @(P  @ g0g(g g <*@`*|HU/N|P*@ggf(M  @B L0N^NuNVJ/H0..*n Jo o#Tp`z  @(P  @ ggg <*@HU/N|P*@ggf(M  @ L0N^NuNVJ/...Jo o #T`Hx/N|P..N^NuNVJ/...Jo n  @Jf #T` </ /N|P..N^NuNVJ/...Jo n  @Jf#Tp` <//N|PB..N^NuNVJ/Hx/.N|PN^Nu /"/ /<T<N@dNJg o Nu/<0N@dNNuJ/H // | pN oJg$/|LY/<0N@NrLNwNHxLN@eNuNHxN@eNuNHxN@eNuNHx%N@eNu/@Hx)N@eNuNNHxcN@eNuNHxjN@eNuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#Hn/.NP09 gp`BN^NuNHx]N@eNuNHxiN@eNuNHxN@eNuNVBJg>HxNX-@HyXNXJg8/.HxNP/.NXN^NuNVHxHyXNP`PJg" .c .`-n-|HzHxNP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHxhN@eNuNVH0BN$XN*@JgJ//.N$PJg(m`XJg//.N$PJfJ g/. /- N$PJfNh L0N^NuNVJfHyHyNP#`/9N(X .N^NuNVJgJf/9NXBN^NuNVH0JfNHyHyNP#f2BL0N^NuNVH0*n`L(n `<f2 `>/9HxHyXN -@g @ #gHy/.aP*@gB#\Hy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.N8X#\#\#\\(y\HyHUa P*@f8`8R`4Jg8  g  g]\d(HyHUaP*@gBfB <\`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN(X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NbPJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HH]`+@`m+n f09gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9Tl < @*PJg`uError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNXBB-HH/N& B+mm0-gm*nN^NuNHxaN@eNuNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNHx;N@eNuNHxN@eJgBNuNVBHnNbPJlp`Jg n .N^NuNHxtN@eNuNVA-HA#=|B-n-|Hn/. NPSm .R @BHH`HnBN(P .N^NuNV4.-nB]t`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/N(PR]t nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHa @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHa @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|(LA`-H-H`P .P-@@ .P-@P".DNNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|9`-|<`Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn .R l .R`p//./.N<-@Jg -|?`J.g -|A`J.g-|CAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NxgP .S-@HJlD-@HJHg6 .Hr NN0S n .Hr N`S n0A .ذbJn/9/9 .".Nxfp+`p-S n.HHa @gpE`peS n`Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn *LZ`0SR`*0]xb1 nRJf]xc0R 9nB <]xL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NbPJmJn -|`-nf9HH/NlXJgm+|8+|8+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXDe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`DeB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB Tf6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N& `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0J]f8 <]#] <]#]#]]#]] .^rN.*y]B] g`(*(U g " Ҁe " Ҁd(M *@b]f]gB`R] ]o "<N#]BNX(@ 9]" Ҁe 9]/NX(@g y] 9]Xg y]  9]" ҀY(#] <] A ` " Ҁ#]й]c A#] A 9]*A L0N^NuNVH0*n(MY#] (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ ] L0N^NuNHxN@e#HBNu /йH/@HxN@e 9H#HNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL# @JlPHyNPX/9 @NXHxNT`HyNPX/9 @NXHxNTXBHxHy0/9 @NZJl`JlHyNPX-|HnHnBHxHyHxNX-@HyJLN0XJg8/.HxNP/.NXN^NuNVHxHyJLNBP`PJg" .c .`-n-|HzHxNP-@/.NXN&`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNHxhN@eNuNVH0BNXNP*@JgJ//.NPJg(m`XJg//.NPJfJ g/. /- NPJfN$ L0N^NuNVJfHyHyN/9HxHyJN| -@g @ #gHy/.aP*@gB#NHy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.NX#N#N#NN(yNHyHUa P*@f8`8R`4Jg8  g  gOd(HyHUaP*@gBfB <N`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +| L`D/.NX+@f,mJf,0-g-HHO +@`m+n f09gHyNX0-gp` - //--HH/NB *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 94l  @*PJg*LZ`0SR`*0O8b1 nRJfO8c0R 9nB <O8L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|*L+|*L+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX,e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN /.NXN^NuNV .". nJ/H?N@ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`,eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N2P.lB 4f6Hx/.NP.Jg Jm/NXHx/.N2P.Jm.HxB/N `Jgp`B//.N2P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N2 N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JOf8 <O#O <O#O#OO#OO .^rN.*yOBO g`(*(U g " Ҁe " Ҁd(M *@bOfOgB`RO Oo "<N#OBNX(@ 9O" Ҁe 9O/NX(@g yO 9OXg yO  9O" ҀY(#O <O A ` " Ҁ#OOc A#O A 9O*A L0N^NuNVH0*n(MY#O (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ O L0N^NuNHxN@e#0BNu /й0/@HxN@e 90#0NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLgSo,Sm ,R @` HTNX. f gJo HT/N\P nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg V @` V @R mHH. ]g*Jg V @` V @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9/9 .".Ntl< 0Nt///./. 9 "9$N(N-@-A`RHH.  @f .gZ`t/9/9 .".Ntl< 0Nt///./. 9("9,N(N-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g(  @/(/ .".N(-@-AJg R mJl/./. .".N`/./. .".N(-@-A/.//N -@-AJl ` .".L N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N^PJmJn -|`-nf +|4`D/.NX+@f,mJf,0-g-HHH<+@`m+n f09(gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH @f fNHH @Dg6HH HH Agra"Ё.Rf .f .찎d @ XR`8JgHH @g n XA .쐈*  b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|0 9(4Dl  @*PJgHxNž HUNX/HUHxNž HxHyAHxNž L N^Nu,<T^x ,>M]l}*=Nd~6PrAb{ !4VivError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV4.-nBHP`b y, S m. .R @HH y,"(R!AS AHH` /9, .R @HH/N$PRHP nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|`-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|a PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|c`J.g-|eJ.g"/.NX".-A< o-@ .Xf -|gL`-|xLA`-H-H`P .P-@@ .P-@P".DNJЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N0PJf/./.NXPJfHnHn .R l .R`p//./.N8-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9L/9H .".NtgP .S-@HJlD-@HJHg6 .Hr NJ0S n .Hr N`S n0A .ذbJn/9T/9P .".Ntfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N0PJf/./.NXPJfHnHn *LZ`0SR`*0HTb1 nRJfHTc0R 9nB <HTL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nž .B`T0-f(mfHn-HH/N^PJmJn -|`-nf9*HH/NhXJgm+|(<+|(<+n 0-gl(m m R Э "-d f -,/HT-HH/Nž .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nž . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nž g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NfXBBBB BmB- L N^NuNVN/.N´XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB (4f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N" `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN¨HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N,PJlB`pN^NuN¨HxN@eBNuN¨HxN@eNuN¨HxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.NR N^NuNV/. Hy@t/.NR N^NuN¨Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JHf8 <H#H <H#H#HH#HH .^rN.*yHBH g`(*(U g " Ҁe " Ҁd(M *@bHfHgB`RH Ho "<N#HBNfX(@ 9H" Ҁe 9H/NfX(@g yH 9HXg yH  9H" ҀY(#H <H A ` " Ҁ#HHc A#H A 9H*A L0N^NuNVH0*n(MY#H (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ H L0N^NuN¨HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL,FP,Z<_:nrV}< Xh3! L\AL <%r)4<8?˜G¨P´X,^d~4jrs0zql o^ RR:0 _ `$H $ ,+, ;!$. _&&t-@5=E ,MUx@]:f mnsf|sA\"Vtxt?(L^ 4ž (4!D+r^1f87f$@JFXMFS0Z`fp  (<xyf~3h´i[HY4QR"Z ".¨D, 7f#* H/R4crt0.ond.orhost.oprintf.oprintf.oscanf.odoscan.oatof.oatof.o_exp5_twoe56atoi.ofgets.ofilbuf.oinet_addr.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostrcat.ostrcpy.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_atoi_printf_rhost_cvec_strcat_sscanf_fdnd_ioctl_pathnd_avec_line2_err_ivec_line_fgets_strcmp_open_close_strcpy_strlen__iob_doline_inet_addr__ctype__fopen_perror_malloc_fclose__pfile__print_fscanf__doscan_scanf_atof__getcclfsinglei__instr__innum_ungetcieeeused__sctab__filbufffltifdivi_ldexpfcmpifmulifaddi_read_fflush_fstat__sibufulmultlmult_sys_errlist_write_errno_sys_nerr_fcvt_ecvt__flsbuflmodt_isnanldivt_isinfffixi_modf__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltis_lseek_creatcerrorptwoulmodt_gtty_stty_realloc_sbrkuldivt_end_brkb[ GvlJ Osbxb bys t |  0> $G"I#HTHS/N4 /NXNuNuNV`X n /a XSfN^NuNVP/.HyLHnN, Hn`HnNPJfdBHnNP-@\JlHnNX`,/.\a(X/.\aX/.\BaJPJfHyUNXX/.\N`BTBP-|aX/.X/.HymHnN,Hn`HnNPJfrBHnNP-@\Jln[B.HnNX`DJTf,/.HyxNXP/.\adX/.\aX-|T/.\/.Xa~PѮPRX hXoPJTf /.Hy}`JPf/.HyNXPN^NuNVHyHy@ d/.N JfD09H//9 ymB`09H0 @/HyNX`HyNXXN^NuNVHydHy@&d/.N Jfp09d/HyNXPJyhgp09h/HyNXPp09j/HyNXPJylgp09l/Hy NXPp09n/HyNXP`Hy(NXXN^NuNVHyHy@d/. N JfJgJg/.HyDNXP/9HyINXP09jn" 9N/HyUNXP09jn" 9Nhr29nN-@Jg/.Hy^NXPr29n 9Nh-@Jg/.HyjNXPHywNXXJgHyzNXX/9Hy~NXPJgp`HyNXXBN^NuNVA -H#Hn/.NP09 gp`BN^NuNVH *| 9 l @ @*PJg*LZ`0SR`*0Eb1 nRJfEc0R 9nB <EL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NnPJmJn -|`-nf9HH/NxXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX\e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVND/.N XN^NuNV .". nJ/H?Nx n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHx&N@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JFf8 <F#F <F#F#FF #FF .^rN.*yFBF g`(*(U g " Ҁe " Ҁd(M *@bF fFgB`RF Fo "<N #FBNX(@ 9F" Ҁe 9F/NX(@g yF 9F Xg yF  9F" ҀY(#F <F A ` " Ҁ#FFc A#F A 9F*A L0N^NuNVH0*n(MY#F (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ F L0N^NuNHxN@e#`BNu /й`/@HxN@e 9`#`NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL< $G"I#HTHS/N4 /NXNuNuNVBB l( n /HyHyN HxNX n -hB/.NP-@l/.NXHxNXSX oN n /(Hy0aP-@Jf* n /(HyHyN HxNXSX oN n /(HyhaP-@Jf* n /(HyHyN HxNXSX o@ n /(NXX-@Jlt/.HyHyN HxNX`LHyHy@d/.N Jl&/.Hy%HyN HxNX-yHyHy@&d/.N Jl&/.HyAHyN HxNX/.HyvHnN p09/HyyHnN p09/Hy|HnN B/./.HnHnHn/.HyHyNt$HyHyNPHxNXN^NuNV` n//. N8PJg P nJf n (N^NuNVA-H#Hn/. NhP n0( gp`BN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH *| 9Ȱ0l  @*PJgQ`Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuN Hx;N@eNuNVA-HA#=|B-n-|Hn/. NhPSm .R @BHH`HnBNP .N^NuNV4.-nBE`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRE nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|L-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N X-@8/.N XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|M PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|O`J.g-|QJ.g"/.N X".-A< o-@ .Xf -|SL`-|dLA`-H-H`P .P-@@ .P-@P".DNbЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|u`-|x`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|{`J.g -|}`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/98/94 .".NgP .S-@HJlD-@HJHg6 .Hr Nb0S n .Hr N`S n0A .ذbJn/9@/9< .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Eb1 nRJfEc0R 9nB <EL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NvPJmJn -|`-nf9HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?NH n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN HxN@eBNuN HxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN Hx6N@eNuNVH0JF$f8 <F(#F$ <F$#F(#F(F0#F$F, .^rN.*yF,BF8 g`(*(U g " Ҁe " Ҁd(M *@bF0fF$gB`RF8 F8o "<N#F8BNX(@ 9F8" Ҁe 9F8/NX(@g yF0 9F0Xg yF0  9F8" ҀY(#F0 <F$ A ` " Ҁ#F,F,c A#F4 A 9F,*A L0N^NuNVH0*n(MY#F, (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ F4 L0N^NuN HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL Dp  ?)60 8B?EFMT Z&aJfls{Vt0 $D.DD<Rn <8p"+33:AIRYapku<"< ~4r0qX0zt Fwh8&. %1 .4:B.H M Uh]jq x0$  fnfbF*Hf?r   y%L-v4;;EM3U>]dikHr<xx [jYs6QRvZ %\7 F< crt0.onewfs.ofprintf.ofprintf.oatoi.operror.oerrlst.oexec.oexec.oexecve.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_atoi_btable_ioctl_execl_fprintf_sprintf_ftable_strcmp_lookup_g_p_open_perror__iob_inf__pfile__print_sys_errlist_write_errno_sys_nerr_strlen_execle_execv_execvecerror__flsbuf__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_stty_realloc_sbrkuldivt_end_brkb[ rxl *U*Ubytnet 0 destination bbn-pr-gateway metric 1 passive net 0 destination bbn-pr-gateway metric 1 passive net 0 destination bragg-gwy1 metric 1 passive net 0 destination bragg-gwy1 metric 1 passive net 0 destination mit-lcs-ig metric 1 passive net 0 destination dcec-psat-ig metric 1 passive net 0 destination dcec-psat-ig metric 1 passive net 0 destination rsre-gateway metric 1 passive net 0 destination goonhilly-ig metric 1 passive b[ tyl !*t*tbyt0.0 noname myname 125.0 localnet b[ vzlr t**byusun console dialup ttyd0 dialup ttyd1 dialup ttyd2 dialup ttyd3 dialup ttyd4 dialup ttyd5 dialup ttyd6 dialup ttyd7 b[ x{lK <b.Nb.Nbyu w#!/bin/sh # # ndcopy 1.2 83/05/21 # : debug=echo from= to= awk " \$1 == \"user\" && \$2 == \"$1\" && \$3 == 0 \ {print \"from=\" \$7 \";fsz=\" \$6} \$1 == \"user\" && \$2 == \"$2\" && \$3 == 0 \ {print \"to=\" \$7 \";tsz=\" \$6 \";toff=\" \$5 \";tdev=\" \$4} " /etc/nd.local > /tmp/ndc . /tmp/ndc if [ ${from}x = x -o ${to}x = x ] then echo cant find both client names in /etc/nd.local exit fi tdu=`expr $tdev : '/dev/\(..[0-9]*\)'` set -x $debug /etc/mkfs$tdu /dev/ndl$to $tsz mkdir /yyf /yyt $debug /etc/mount -r /dev/ndl$from /yyf $debug /etc/mount /dev/ndl$to /yyt cd /yyf : this will take a while : tar cant handle dev entries, ignore these errors $debug tar cf - . | (cd /yyt; tar xfp -) cd /yyt/dev MAKEDEV std nd pty0 cg cd / /etc/umount /dev/ndl$from /etc/umount /dev/ndl$to rmdir /yyf rmdir /yyt sync : DONE b[ z|lK; bzbz-bz- #! /bin/sh # # rxtrusr 1.1 83/05/18 # use="Usage: tape=[ar|mt] disc=[ip|xy|dd] host=name /etc/rxtrusr" case ${tape} in ar|mt) ;; *) echo $use; exit ;; esac disc=${disc-$disk} case ${disc} in ip|xy|dd) ;; *) echo $use; exit ;; esac set -x cp /etc/fstab.${disc} /etc/fstab /etc/newfs /dev/r${disc}0g 4k /etc/mount /dev/${disc}0g /usr cd /usr rsh ${host} mt -f /dev/nr${tape}0 rew if [ "$tape" = "ar" ] then echo "Insert second tape on server and hit RETURN." read x else rsh ${host} mt -f /dev/nr${tape}0 fsf 5 fi rsh ${host} dd if=/dev/nr${tape}0 bs=40b < /dev/null | tar xfpB - cd / /etc/umount /dev/${disc}0g sync echo "DONE. /usr loaded." b[ |}l:;! ggbyv b[ }~l;[! ==byvb[ ~l;H-! w@byvb[ l;! byvb[ l;Y)! c7wvbywb[ l;9W! ̎Ajbywb[ ldf )ʕbywb[ l: ! bywb[ l;! bywb[ l:! bywb[ l: ! byxb[ l: ! byxb[ l: ! byxb[ l:!   byxb[ l:! !!byxb[ l:! ""byxb[ l:! ##byxb[ l:! $$byxb[ l:! %%byyb[ l:! ((byyb[ l:! ))byyb[ l:! ))byyb[ l:! **byyb[ l:! ++byzb[ l:! ,,byzb[ l:! --byzb[ l:! //byz b[ l:! //byz b[ l:! 11byz b[ l:! 22byz b[ l:! 33by{ b[ l:K! by{ b[ l:! 44by{ b[ l:! 55by{ b[ l:! 66by{ b[ l:! 77by{ b[ l:! 88by| b[ l:! 88by|b[ l:! 99by|b[ l:! ::by|b[ l:! <<by|b[ l! )l by}b[ l;! u(by~ b[ l;7]! OOby~ b[ lKс b.~b.by~ #! /bin/sh # MAKEDEV 4.5 83/05/19 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # tm* Tapemaster 1/2" tape # ar* Archive 1/4" tape # Disks: # ip* Interphase 2180 and 2181 # xy* Xylogics 440 # dd* DSD 5215 # nd* Network Disk # Terminal multiplexors: # oct* Central Data Octal card # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # vp* Versatec (Ikon interface) # Graphics/windows: # cg* Sun color graphics board # win* 32 windows umask 77 for i do case $i in std) /etc/mknod console c 0 0 ; chmod 622 console /etc/mknod kmem c 3 1 ; chmod 644 kmem /etc/mknod mem c 3 0 ; chmod 644 mem /etc/mknod null c 3 2 ; chmod 666 null /etc/mknod mbmem c 3 3 ; chmod 600 mbmem /etc/mknod mbio c 3 4 ; chmod 600 mbio /etc/mknod tty c 2 0 ; chmod 666 tty /etc/mknod ttya c 12 0 ; chmod 666 ttya /etc/mknod ttyb c 12 1 ; chmod 666 ttyb /etc/mknod gfx c 9 1 ; chmod 666 gfx /etc/mknod mouse c 13 0 ; chmod 666 mouse /etc/mknod drum c 7 0 ; chmod 644 drum ;; ar*) umask 0 ; unit=`expr $i : '..\(.*\)'` case $i in ar*) blk=2; chr=8 ;; esac case $unit in 0|1|2|3) rew=`expr $unit '*' 4` norew=`expr $rew + 16` /etc/mknod ar$unit b $blk $rew /etc/mknod nar$unit b $blk $norew /etc/mknod rar$unit c $chr $rew /etc/mknod nrar$unit c $chr $norew umask 77 ;; *) echo bad unit number in: $1; use ar0 thru ar3 ;; esac ;; mt*) umask 0 ; unit=`expr $i : '..\(.*\)'` case $i in mt*) blk=1; chr=5 ;; esac case $unit in 0|1|2|3|4|5|6|7) four=`expr $unit + 4` eight=`expr $unit + 8` twelve=`expr $unit + 12` /etc/mknod mt$unit b $blk $unit /etc/mknod mt$four b $blk $four /etc/mknod mt$eight b $blk $eight /etc/mknod mt$twelve b $blk $twelve /etc/mknod nmt$unit b $blk $four;: sanity w/std pdp11 v7 /etc/mknod nmt$eight b $blk $twelve ;: ditto /etc/mknod rmt$unit c $chr $unit /etc/mknod rmt$four c $chr $four /etc/mknod rmt$eight c $chr $eight /etc/mknod rmt$twelve c $chr $twelve /etc/mknod nrmt$unit c $chr $four;: sanity w/std pdp11 v7 /etc/mknod nrmt$eight c $chr $twelve ;: ditto umask 77 ;; *) echo bad unit for tape in: $1; use mt0 thru mt7 ;; esac ;; ip*|xy*|dd*) unit=`expr $i : '..\(.*\)'` case $i in ip*) name=ip; blk=0; chr=4;; xy*) name=xy; blk=3; chr=9;; dd*) name=dd; blk=6; chr=16;; esac /etc/mknod ${name}${unit}a b $blk `expr $unit '*' 8 + 0` /etc/mknod ${name}${unit}b b $blk `expr $unit '*' 8 + 1` /etc/mknod ${name}${unit}c b $blk `expr $unit '*' 8 + 2` /etc/mknod ${name}${unit}d b $blk `expr $unit '*' 8 + 3` /etc/mknod ${name}${unit}e b $blk `expr $unit '*' 8 + 4` /etc/mknod ${name}${unit}f b $blk `expr $unit '*' 8 + 5` /etc/mknod ${name}${unit}g b $blk `expr $unit '*' 8 + 6` /etc/mknod ${name}${unit}h b $blk `expr $unit '*' 8 + 7` /etc/mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` /etc/mknod r${name}${unit}b c $chr `expr $unit '*' 8 + 1` /etc/mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` /etc/mknod r${name}${unit}d c $chr `expr $unit '*' 8 + 3` /etc/mknod r${name}${unit}e c $chr `expr $unit '*' 8 + 4` /etc/mknod r${name}${unit}f c $chr `expr $unit '*' 8 + 5` /etc/mknod r${name}${unit}g c $chr `expr $unit '*' 8 + 6` /etc/mknod r${name}${unit}h c $chr `expr $unit '*' 8 + 7` ;; oct*) unit=`expr $i : 'oct\(.*\)'` case $unit in 0) ch=m ;; 1) ch=n ;; 2) ch=o ;; *) echo bad unit for oct in: $i ;; esac case $ch in m|n|o) eval `echo $ch $unit | awk ' { ch = $1; u = 8 * $2 } END { for (i = 0; i < 8; i++) printf("/etc/mknod tty%s%d c 1 %d; ",ch,i,u+i); }'` ;; esac ;; color|cg|cg0) /etc/mknod cg0 c 14 0 ; chmod 666 cg0 ;; vp*) unit=`expr $i : 'vp\(.*\)'` /etc/mknod vp$unit c 6 $unit ;; nd*) blk=5; chr=19 case $i in nd) /etc/mknod nd0 b $blk 0 /etc/mknod nd1 b $blk 1 /etc/mknod nd2 b $blk 2 /etc/mknod rnd0 c $chr 0 /etc/mknod rnd1 c $chr 1 /etc/mknod rnd2 c $chr 2 /etc/mknod ndp0 b $blk 64 /etc/mknod ndp1 b $blk 65 /etc/mknod ndpl0 b $blk 192 /etc/mknod rndl0 c $chr 128 /etc/mknod ndl0 b $blk 128 /etc/mknod ndl1 b $blk 129 /etc/mknod ndl2 b $blk 130 /etc/mknod ndl3 b $blk 131 /etc/mknod ndl4 b $blk 132 /etc/mknod ndl5 b $blk 133 /etc/mknod ndl6 b $blk 134 /etc/mknod ndl7 b $blk 135 /etc/mknod ndl8 b $blk 136 /etc/mknod ndl9 b $blk 137 /etc/mknod ndl10 b $blk 138 /etc/mknod ndl11 b $blk 139 /etc/mknod ndl12 b $blk 140 /etc/mknod ndl13 b $blk 141 /etc/mknod ndl14 b $blk 142 /etc/mknod ndl15 b $blk 143 ;; esac chmod 600 nd* rnd* ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; *) echo bad unit for pty in: $i;; esac case $class in 0|1|2) umask 0 eval `echo $class $name | awk ' { b=$1; n=$2 } END { for (i = 0; i < 16; i++) printf("/etc/mknod tty%s%x c 20 %d; \ /etc/mknod pty%s%x c 21 %d; ", \ n, i, b+i, n, i, b+i); }'` umask 77 ;; esac ;; gfx*|win*) /etc/mknod gfx00 c 15 0 /etc/mknod gfx01 c 15 1 /etc/mknod gfx02 c 15 2 /etc/mknod gfx03 c 15 3 /etc/mknod gfx04 c 15 4 /etc/mknod gfx05 c 15 5 /etc/mknod gfx06 c 15 6 /etc/mknod gfx07 c 15 7 /etc/mknod gfx08 c 15 8 /etc/mknod gfx09 c 15 9 /etc/mknod gfx0a c 15 10 /etc/mknod gfx0b c 15 11 /etc/mknod gfx0c c 15 12 /etc/mknod gfx0d c 15 13 /etc/mknod gfx0e c 15 14 /etc/mknod gfx0f c 15 15 /etc/mknod gfx0g c 15 16 /etc/mknod gfx0h c 15 17 /etc/mknod gfx0i c 15 18 /etc/mknod gfx0j c 15 19 /etc/mknod gfx0k c 15 20 /etc/mknod gfx0l c 15 21 /etc/mknod gfx0m c 15 22 /etc/mknod gfx0n c 15 23 /etc/mknod gfx0o c 15 24 /etc/mknod gfx0p c 15 25 /etc/mknod gfx0q c 15 26 /etc/mknod gfx0r c 15 27 /etc/mknod gfx0s c 15 28 /etc/mknod gfx0t c 15 29 /etc/mknod gfx0u c 15 30 /etc/mknod gfx0v c 15 31 chmod 666 gfx?? echo Make sure you MAKEDEV pty0 ;; local) sh MAKEDEV.local ;; *) echo "I don't know how to MAKEDEV $i." ;; esac done b[ lقW OPby*by  0= `KI&LJfmY#/ HS/N8 /N,XNuNuNVJ/H0*n m o m -fSX(UJ,f^ m .S" Ҁ A-PHy/.NPJmtp09 @f^B~`D iftR4RJgzHH ffR8`/. " Ҁ A/a^PR .Sm/N,X n/-/-aP,/N,XHyPJlHJ8f@9HH/NxXJg(/. p09/Hyav Jg /. /.N^PJlL @gHy/.a`p09N @fHyaX`Jg/. N2XJl/. Hy.`p09N fHxHn/.NN Jl /.a`p09NF/NX./. HnNPJl/. `/NX/.N2XJlV/.Hy?`p09N gp09N `f09VH/p09N//. N* Jm|-y\-ydHn`NZ-@ f HyP`Jf8B/. /.HybHyZNHyeatXHxN,XHnN2X-@g fJf-y\-ydHn/. N P`p09N gBp09N//.Hyy`:B..N^NuNVJ/H/./. /.HyNhSm 9R @`HyNX`6 g6Sm 9R @`HyNX  f yfp`BLN^NuNVJ/H0*n(M` /fJg*LJf L0N^NuNVJ/HyHyNhP/./. /.HyNhHyHyNhPN^NuNVJ//.HyHnNl HnN,XN^NuNVJ//. /.HyHnNlHnN,XN^NuNXHx*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVJ/H-n-n .,p.@.Jl n !y .". `l o n !n  9"9`H*pprSʁ N n !Apr N// NNLN^Nu"//WPOJ/Hg kkf$`d"//WPOJ/HkgVkgBkT dB&B<Ѓe rL8Nuidpr<L8Nu rL8NurJL8Nu oD&B<ЃerL8NukgvgdkN d&B꫐k|B bH@Ѐ[k rgL8NuprL8Nu ofD& <`DgjD`"//WPOJ/HgFglEDvilE]B&HC(BHD؃BDHDH@HAHAЄjg*rL8Nuiex@ЄЀdgrL8Nu <rL8NujJrL8<NuL8NVN^HJf:rJ|`rL8NuHAH@`k <rL8Nu"//WPOJ/Hg(gvEDiBH@HAAkiH@DL&:H@HA6BŐd &BЃE&HCB@HEk :څ0:r ghL8NuJ//k.gBAkjD*Nup*<Nu* <NuBkj D*DNufDJk <*<NurJ//*<_Jg8j*N@eNuNVJ/Hn/.NPJlB`pN^NuNXHxN@eBNuNXHxN@eNuNXHx&N@eNuNVJ//. Hyt /.N" N^NuNVJ//. Hy@t/.N" N^NuNXHx6N@eNuNXHx N@eNuNVJ/H0J$f8 <(#$ <$#(#(0#$, .^rNB.*y,B8 g`(*(U g " Ҁe " Ҁd(M *@b0f$gB`R8 8o "<NH#8BNX(@ 98" Ҁe 98/NX(@g y0 90Xg y0  98" ҀY(#0 <$ A ` " Ҁ#,,c A#4 A 9,*A L0N^NuNVJ/H0*n(MY#, (L0N^NuNVJ/H0*n -gHUaX --@/. aX(@gpgl-M-L . VrNB.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ 4 L0N^NuNXHxN@e#u2Flw bm^ 8Z >,$,2N<$@D=4K.Q3xY H] aM`h*ovX} Ln <NJf\nfj FH.fL%+1J7=CgLJ?QXo_fimRyx  %y; d,d"7 B Ecrt0.omv.o_sccsidOumask.oOutime.olstat.omknod.oaccess.oreadlink.orename.ofprintf.ofprintf.osymlink.ofilbuf.operror.oerrlst.oexec.oexec.oexecve.ofork.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.offmodf.offloat.oitoplsfpart1fpart2itortiitortnfpa2osfpichmfparsrfpdnovfpaeqfpirt0ffmrt0fpamssfpazroffmclnffmoufSAVEfpdqokfpiovmfpiovpfpdisnffmconfpaxqnfpirtnffmrtnfpanorfpalsfpamsfpanrmfpami1fpdov2fpimifpa2gcRTSfpatltfpddzrffmnoritolpfpdouffpdovffpdundfpzrtnfpa2ltfpdrtnfpdovfsflsbuf.oexit.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ofstat.oisatty.oclose.oread.ostat.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_lstat_Perror2_move_execl_fprintf_wait_errno_umask_symlink_error_unlink_sprintf_utime_movewithshortname_rename_fflag_fork_access_perror__filbuf_Perror_stat_readlink_strlen_iflag__iob_isatty_s1_s2_query_mknod_dnamecerror__pfile__print_read_fflush_fstat__sibuf_malloc_sys_errlist_write_sys_nerr_execle_execv_execve__flsbuf__ctype__fcvt_ecvtlmodtldivtffpusedfsubtffixtfdivt_modffmultfaddtfflttffixtsfdivtsfsubtsfflttsfaddtsfmultsfloatflavor__cleanup__sobuf_free_close__lastbuf_fclose__exitptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٹ **by    0 (mP$G"I#HTHS/ND /N-HXNuNuNV/./. /.HxwafN^NuNVB/. /.HxraJN^NuNV/. /.aP-@N .N^NuNV/. /.aP-@.HHN^NuNVJfB`JgT .r f.HxHn/. a g /.aX .`HxHn/. a g`B .w fJfHyNX/.Hn aPJgj .g 9` 9$-@Jg f/. aX-@ J. HH/ .r fA`AHP/. /.aBJl/.a X .N^NuNV .g #X` #XN^NuNV/. /.aPJfp`D rfHx/./.N8`Hx/./.N>V -@ fBN^NuNVH0*n.. g <` < (@ f(/,//aF Jg ,` , ѕp`/,/, /a Jf/aXBL0N^NuNV . e dp`BN^NuNVB/. /.N7> gp`BN^NuNV-nB mN g#B`h n HH/ .rN

P.Hx .Y/a*P-@JXg+| B#X`#X  Nf .]+@+n `..  Nfl .Y+@ `R .Y+@ .U"H` .Y+@ .U"Ё` .U+@ HHЮ+@ `B  ag  Ng  ag .U+@+| Hx/.a P.  @g  fHxT/.aP.  Pf r,JfF|`B  f Hx .T/aP` ,`  gB rNfHBlNF@.HH/NX-@Jm/9h/NNP` @gHyNXN0NF ;gJfSHJ XJgB`L#hSHp`apJf90HH "g &fT#`/9|NX#` 9|D/`NF@.HH/NX-@Jm /N`.HH/aX=@ nfHy~NX0.HD @#`6=|BNdJgSnlaD nf 9r#0.g 90HH` 90HHခ`NnHxaXHyŒNX`r#JnHyNXNn`rNnBaXSHHyŒNLX-@fHyNX n/(NXJlfHyNX#l`*nN^NuNVH0BJfJf2HyNX` /.NLX*@fHyNX# -dJf J\mHyNXN 9䰹dVHx/NDPJƜgHy yƜ/N8 HxHyd y|(HH/N8 ./ dx/Hy`4 ,SxlD "<N HxHyd y|(HH/N8 `2L0N^NuNV/.N5XR/N9PX-@/./N8P .N^NuNV`-n -yh g/./9hNDPJfp`B-@JgJg yƜ/HyNNP`JXf nP.HHQ @g`B`, ."HA HABAЁ-@.HH0Ѯ .R @P.HHQ @fS`-| nJg$/././/.a-@ nJfB 9h#|#hJXgJlBX`@/9XNXSg/9|aX#hJ@g BNXJfpN^NuNVJo-n nP#hDPR.HH ^gnr -gn< ghn gZNJfHyNNX.HH "gJ Ng ngz fHyNXJfj-yh=yjyk`/.HyNNP .`z/.aX#h` .D/` 9|D".N` g4/9hNXJlfHyNX-ylB|`-yh nJf#| ./ .r/NPJXfJHyHy'NNPJg/9|aX#hSN*` g/9hNX-yl`-yhB|Jg6 ./ .r/NX @/Hy*NN `pHy7/./.N` f$/9hN~X-@Jf#=X``-yhHyX/./.N B|` f-yh/9hN~X-@Jf``zNJfHy^NNXHx/9hNnPr/HxBNt Hx NX/9|aX#h/NX 9lg#h#|`F +gx` Ign AgH` Tg6` ign ag` tg`B|` nJg" R @HH/NX n "f nJgR`Hx NX`/./9hNRP-@=nn.HH/HycN PJf p0.-@JXfvJ@g BNX#D.HHB 6b@0;NrX$j*prB<rT`0.//.BNt Hx NX`h#|/.NXJlg4-yl ./ .r/NX @/Hyp`Hy}`#|Hy`#|p0./Hy`#|/.Hy`#|p./`<#|p./aP`(#|p./Hy`p#|p0./Hy`T#|/.Hy`<-yh#|`DJXfXHxa6X#h .Sfp./a`p./NXN*/./9hNRPr@f 9hR#|#h`#|p0./Hy`#|/.Hy`v#|/.Hy`^#|p0./Hy`B#|/.Hy`*#|p0./Hy`#|/.Hy`#|p0./Hy`#|/.Hy`#| .N.-@-A/./.Hy` #|-n/.HxaX/NRP-@/./.Hy`HyN`N^NuNV. . fHyNN`8 . l . HH@/HyNNP`. HH/NXN^NuNV 9hЮ-@ 9h".gHyNX .N^NuNV . g .; fp`BN^NuNVa" 9 0g 9 0g90HHN^NuNVJƼg B90B`JHft#HHx/9H/9N8 Jnp`B#ƼJ@g BNXJƼf 9HRH @  f yHB#Hd0gB9d` yH0gRH90HHN^NuNVa/aXJg SHB` 90HHN^NuNVa \fa` 9'0fB` 90HHN^NuNVH *nB`B`@a/avXJf$0 -"f F.Jga fSHfL N^NuNVJ g^JgD/9N8XB`. 9Ƹ @Jg 9Ƹ @/N8XSƸlBƸ` . gJg g&`Jg/9N8XB` ƸmHy4NX 9Ƹ @  9Ƹ @ hRƸ`Jg/9N8XBJƸo2SƸ 9Ƹ @# 9Ƹ @#hN^NuNV.*n `#SX ox/-HytN8 #@Hz/.N:X-@fHxNJXNHyN.XSHN^NuNV.# T#|*|`p0r2-g JUfJUg/-/. mNP`/9NNX*nN^NuNV/9T/9|NX/NnP-@ fX|` .r-@T| .N^NuNV . b@0;N*>Vn2`p/. HyNNP`Z . p @/`> . p @/Hy` . p @/Hy` . p @/Hy`HxaX/ . p @/HyNN `HxaX-@HH-@ .gpl`pw/ .r / .gpa`pd//. . p @/HyNN`R . b.@0;N4J|`,Hxa4X-@HyHx/.N`2HxaX-@Hy`HxaX-@HyHx 9|U/NXЮ/`HxaX-@HH-@ .gpl`pw/ .r / .gpa`pd//.HyNN`R fp`p/aNX-@ f/.Hy`Hy`HyNNXN^NuNV/. ./ ./a: N^NuNV...Jfp` fp` fp`p..N^NuNV... fpb` fpw` fpl`p?..N^NuNV n HH/HyNNP n bfp` n wfp`p-@/ ./ ./a^ Hx,NX/. .r / ./a( N^NuNV .-@-| o `Jf-| HxaX-@/. . @/Hy NN HyHxHxNXЮ/N N^NuNV ./ .h @//. NN HxaX-@HyHxHxNXЮ/N N^NuNV .( @/HyNNPHx ./ ./a N^NuNV . @/HyNNP .g .r /Hy"NNP`&HxaX/Hy'NNPHx,NX/.aXN^NuNVH .. .r ,Jg fp` g g fp`p-@/.aXHH//. Hy+NN m< n4/Hy2NNP/. ./ ./a|`D/. ./ ./aX / npd`pa/Hy7NN LN^NuNV . fB .r  @-P/. /.Hy=NN /.axX` . @-P/.a~X/aXHH//. /.HyDNN .r -@ .-@ .g/./.HyMNN `0Jg .`p/HyUNNP/.HyYNNPN^NuNVH *n /.aX.Jo fp`p/aX-@/aXHH/HUHy^NN /.HyeNNPHx,NX .? JgHx,NX`R / lpd`pa/HyNN R mHyNNXLN^NuNVHB*<HxaX( .8 f.~` UJn~` T m( .dgpl`pw/HyNNP .g/.aXHx,NX/a`/aXHx,NX/.aXLN^NuNV.*n HUHyNNP/.aX .r / lfpa`pd/HyNN *nN^NuNVH *n /.a|X.Jo*/aXHH/HUHyNN /.a` /9NNXL N^NuNVH *n /.aX. .r ,Jf|JoF/a6XHH/HUHyNN /HyNNPHx,NX/.a` /9NNXL N^NuNV. .. oHyNNX/HyNNP .r /HyNNP..N^NuNV.*n HUHy NNP*nN^NuNV.*n HxaX/HUNNP*nN^NuNVH/.aX.HxaXr ,/aXHH//. HyNN gB / g <` </NNP/ ./a6`@/ ./a P / g < ` <%/NNPLN^NuNV.HxaX. JgT gV gX gZ-|*p .gT/. //. g0 <.`Z-|@`-|D`-|H`-|L` <7`* //./. g <P` <Y/NN..N^NuNVJ@f@ y  fBB-|,B`x ., @P .fJgRB . fR`V #,N^NuNV 9,N^NuNV ,g Hx aXN^NuNVA -H`X.HH/abX`D .%f n -f |lR`|rHnaX-@ n .fRHnaX-@`-|A#( n-PXB nP.HHRD 4bN@0;NNBBBBBBBBTB\,BNBBbDBBBBBBBBBhjBBBBBBBRBB"zjBB Hx .HH/ ./a Jf y(BA-H/.N5X-@ .lJm-@ .ꑮ .rf .SJoxHx aX`B ./alP`Hx` ./a"X`l/9`D/9.HH//.`B/.an`Hx `B/.`Hx`/.` ./aD`-n` A-H n-h-PP-|/./.N5LPJg -|`/./.N5tPJg -|`/./.Hy/.N`-n`~ .Tf-n`YJgba".N7f`L.HH/alXY`4 .SJg .R @HH/a@X` .SJo Hx a(X`A#( .R @PfN^NuNVH HnNDX*@~` Ї @"y(R(R m~` Ї @"y(R(R mL N^NuNV/.HyaPN^NuNVHx a|XN^NuNVH *nB`. 9n6 ."HA HABAЁHHЁ0-@ R @ 0lS .L N^NuNVH A*H.HH Dg dfRJl .D-@ y(-R(,.Jf Af`B`\ ".N7` ".Ngln %gXnJg(HyNX`vJfNn fSH`VNF ` <fBHxNP`nJf N~`JNNPJXf/.HyINNPSJnJHnN`XJf*nN^NuNV n -hJl <Y` .\f 9n` 9j//.HyMNN n /Hy[NNP n /(HyfNNP n /(HyqNNPHy|NNX n /( Hy~NNP n /(HyNNP n /(HyNNPHyNNXN^NuNV.B/NX-@/. F @/HyNN Hx/.NDP-@l. yƜ/HyNNPJg/.HyNNPHyNNXR mna..N^NuNVH -yH-yHB F @*PHH".f&JgNnHHgSJf `#HR m#HpL N^NuNVHxNX#hHyHx/9hN Hx/9hNnPr/HxBNt Hx NXN^NuNV.B  @Jg$/HyNNP/a"XHyN.XR m..N^NuNVJm" l . @/N.XN^NuNVBNXXJg 9` .N^NuNV.BJgXA .eHyNNXBN-HX 9 0f nBXN0/9Hn/9jNb /9jNHXN^NuNV.*y,`Jg g *mTf *nN^NuNV.Jg4*y,`JgHxHm/N* *mTfB*nN^NuNV. g*y,`hJg^HxHm/N fHxHy/N* g$HyN.XHyHx/N *mTf#*nN^NuNV.BNHxNX` gHnN>:X.fHxNJX fB#X` . gnB4 .#0g /NX .g,Hy N.X/9\N8X#nNB#X` .#0BHxP/9HxN#4 0gN f4 90 @Jg"/90Hx/9HxN`/90NX`B0 f-|N0N0HxNX#< .ѹ HxHy/9\N8 -|/.NLXJƜgnB yƜ/(/9\N7> HxHy8/9\N8 /98/9HyNN ##a~`P/./9nHyNN HxN-HXHn/9\N8zPp0. fHxHy\/9\N8 f Dg Dg  DfHy/9nHyNN 9z\# 9@r #H 9Dr #L 9Hr #8 9D gX g  gx`JDg 9DDgB#BHy NNX` 9XйH#йL# 9HйL`8Hy/9HNPйX#йL# 9L##4##  98#JDfN#0/90N`2/9nHy(NNP##N^NuNV`H *|LJg 9r "9ܲo#<X`BHxACpHPHxrN-@lJXg#[X` .lf#lX`BHxAxCpHPHxrN.JXg #X`LJf #X` HxHn/.N8 gHyNN`/.N9PX-@Jfa x n Y/. .X//.N8 fB/./.N7> `Jfr-n Uo-|U ."HA HABAЁ/Hn/.N8 -@ ."HA HABAЁ".貀f-nA*HJg .Е* M HPaXSSJf^Hz ^Hx/9„/9ƴN $Hx/9„NP#ƨJfa PB`" йƴ @ йƨ"@"#hR„mHz Hx/9„/9ƨN $ 9Ƭ//9ƌN;,P#ƌJfa #ƬưHzLHx/9Ƭ/9ƌN $`Hy$NNXHxN-HXL N^NuNVH<*np- 0g>n g2n g&nL gn2Jg`6 .g.RJf/aX(@g HUHTaP` HUaX(@ -$f\J@gN y@JgB ( / y@/(N;,P y@!@ y@Jfa y@"H#h #@p- g* $g" &g (g 0g fd 9@r2-H)@/- 9@rr2-/aP`,/NX#@`B<` g` gn f$U` g` "gn( gn g` g` &grn $f`b (f~`T gJn dg8n Dgn* @fH(y@HlHl HlHUa`( `f(y<f/aX&@f/aX-@ 9ƠƤm.2ƤHx/9ƤNP#ƔfaBƠHyƤHyƠHyƔHUa&@ .D @'P .D @ `p g>n f\` fP` g.n, g8n g.`, f$HUa2X#<` g n gL<N^NuNV n ( g: g2 g* g" g g g" $g`0 n ( n!@` n "n" n "n#hN^NuNV n P ( n PN^NuNVH *nB`R _g`& _fJ-g H@H@B@ހHHހJf "<N7f.Jl L N^NuNVH JưfD#ưHxXN9PX#ƌJfaHxN9PX#@#DJfa 9ƬưfPư 9ư//9ƌN;,P#ƌJfanHxN9PX#@#DJfaN*y@ 9Ƭйƌ @  @RƬ n* n(+@BB B n+hB n/aX. D @+P D @ L N^NuNVH /.aDX. D @*P`zHx_/./Nz Jg^#Ɯ L N^NuNVH /.aX. D @*PgnHx_/./Nz Jg"#Ɯ `T*mf~BƜB` - g $g*m`Hx_//.Nz Jg`BƜBL N^NuNVH BƜJ f <`hB 9ƬS,`6 ІrN`NuJ/H // | pN oJg$/|LY/<0N@NrLNwNVJ/H0..*n Jo o#p`  @(P  @ g0g(g g <*@`*|HU/NP*@ggf(M  @B L0N^NuNVJ/H0..*n Jo o#p`z  @(P  @ ggg <*@HU/NP*@ggf(M  @ L0N^NuNVJ/...Jo o #`Hx/NP..N^NuNVJ/...Jo n  @Jf #` </ /NP..N^NuNVJ/...Jo n  @Jf#p` <//NPB..N^NuNVJ/Hx/.NPN^NuBHxN@eNuN>`NVH0 .". N-@/N9PX*@fB`(M .VrN`Hx#N@eNuN>`Hx)N@eNuNVH8*n(yJg/HUa"P&@Jg ` =f `0BL8N^NuNVH0*n(n gJf ,=gBL0N^NuNVH *n.f `JfBL N^NuNV## . ".NЮ//.aPN^NuNVH0.9 . -@찇cH" .N`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9l  @*PJgV HxHyHxN>V HUN5X/HUHxN>V HxHyHxN>V L N^Nu4D\f(4FUet&2EVl'>Xz%Ij)<^q~Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededHxN@NV/9Hn /.Nb N^NuNV/9/. /.Nb N^NuNVA -H .X @Jf n/Hn /.Nb N^NuN>`Hx;N@eNuN>`HxN@eJgBNuNVA-HA#L=|B-n-|Hn/. NPSm .R @BHH`HnBN*@P .N^NuNV4.-nB`b yL S m. .R @HH yL"(R!AS AHH` /9L .R @HH/N*@PR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHQ @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHQ @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N5X-@8/.N5XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.N5X".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DN7fЮLЮ@ @S"n .P".DN*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N>V .B`T0-f(mfHn-HH/N8zPJmJn -|`-nf9HH/N8XJgm+|T+|T+n 0-gl(m m R Э "-d f -,/HT-HH/N>V .+L`/.N9PX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N>V . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N>V g m p`BL0N^NuNV.*|` HUaX4e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N8XJl~0-g /-N;XBBBB BmB- L N^NuNVN,/.NXN^NuNV .". nJ/H?N. n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`4eB` 0,f -+fp`B, wf0Hx/.N7P.JgJm/N8XHx` afvJgp`p//.N8P.lB f6Hx/.N7P.Jg Jm/N8XHx/.N8P.Jm.HxB/N7> `Jgp`B//.N8P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N8 N^NuN>`HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@L`Hx>N@eNuNVHn/.N9 PJlB`pN^NuN>`HxN@eBNuN>`HxN@eNuN>`HxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N9F N^NuNV/. Hy@t/.N9F N^NuN>`Hx6N@eNuNVH0J8f8 <<#8 <8#<#<D#8@ .^rN`HxN@e#8BNu /й8/@HxN@e 98#8NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL`HxTN@eJg o NuN>`HxN@eNu#pNu@(#)crt0.s 1.2 (crt0.s) (SUN) 1/26/834@(#)access.68 1.6 2/7/83 SUN not in write modedata address not foundtext address not foundpage not valid/reclaimablepage table botchillegal page spaceaddress out of segment@(#)access.c 1.2 82/12/10@(#)command.c 1.1 82/10/17zX"= "^i=mLlWwunexpected '='unexpected '@'cannot locate value:%16t=%8tbad file index"%s"+%d:%16t:%16tbad variableadb bad command@(#)expr.c 1.3 83/02/07unexpected ')'address for line not foundsource line for address not foundsymbol not foundaddress expectedbad variablefile name unknownsymbol not foundline for function unknownno previous framesymbol not foundstartroutine not on our call pathlocal variable not found%s:0x%X unknown local symbol type spurious '.'unknown fieldmissing '"'syntax errorrcan't open file%d %s %s has %ld lines line number out of range@(#)fio.c 1.2 83/02/07 %s:%16t%16mformat not supported with @%Tsource line not found%s"%s"+%R:%16t:%16tpc for source line unknown:%16t%16mpPU4WXYQODfF"%s"+%R:%16t%16t%16t%-8u%-16U%-8o%-8r%-16R%-8x%-16X%-24Y%-8q%-16Q%-8o%-16O%-8d%-16D%-16.9f%-32.18Fbad modifier^?^%caddress wrap around@(#)format.c 1.3 83/02/07L $<< nesting too deep@(#)input.c 1.1 82/10/17-w-k-D%s adb newline expectedSHELL/bin/shsh-ctry again!@(#)main.c 1.4 83/04/12/usr/lib/adbd   %*/r4 r60r8`&:&=&A&E &I &M Qrr@ŐV@pdBŐiBprDŐvDpFŐFpHŐH@H@ŐHHHFJŐJpN@`NP$NzHHNXN`NhNp NqNrNsNt!Nu)Nv-Nw3NŐ7NŐ movem%c %s ,%c%D %s%c %s%c #%R moveq #%R,d%D %s %s%c a%D,d%D,,a%D,d%D???%sa%D,%s%sd%D,%ssfcdfcuspvbr%s%s,a%D%s%s,d%D @(#)opset.68 1.4 83/04/12 ???rasrhilscccsneeqvcvsplmigeltgtlerafhilscccsneeqvcvsplmigeltgtletrahilscccsneeqvcvsplmigeltgtleaslsroxrobtstbchgbclrbsetblworandsubaddeorcmpmovsmove_from_sr negxmovw cc,clrmove_to_ccr negmove_to_sr notnbcd swap d%Dpea extw d%D extl d%Dtas tst movc extw d%D extl d%D unlk a%D move a%D,usp move usp,a%Dresetnop stop %Rrte rts %Rrtstrapvrtrjsr jmp chklea db%s d%D,addqsubqdivudivssbcdorsubsubxsubcmpcmpmcmpeormulumulsexgexgexgabcdandaddaddxaddrl,0123456789abcdefInfinityNaN%.16e%s @(#)output.c 1.3 83/04/12bad modifierbreakpoint%16tdon't know pc for that source lineno breakpoint setdon't know pc for that source linebkpt: no memorybkpt command too longwhich signal?signal number out of rangeno process%d: killedno processstopped at%16t@(#)pcs.c 1.2 83/02/07@(#)print.c 1.6 83/02/07P %/37JQ[hx+:DNXblbad modifierfilename too long%s/%scannot openmust have 2 <= radix <= 16radix=%d base tenvariables = %Q ? map/ mappcs id = %d no process %s:%12t%R No algol 68 herebreakpoints count%8tbkpt%24tcommand %-8.8d%24t%s?start?%s[%X](%R,) at %X ) + %X ? reg location !known%8t%s:%10t%R %s%12t`%s' -b1 = %-16Re1 = %-16Rf1 = %-16R b2 = %-16Re2 = %-16Rf2 = %-16R %s%6t%R %16t%s+%R :%16t%R d0d1d2d3d4d5d6d7a0a1a2a3a4a5a6sppcpshangupinterruptquitillegal instructiontrace/BPTIOTEMTfloating exceptionkilledbus errormemory faultbad system callbroken pipealarm callterminatedsignal 16stop (signal)stop (tty)continue (signal)child terminationstop (tty input)stop (tty output)input available (signal)cpu timelimitfile sizelimitsignal 26signal 27signal 28signal 29signal 30signal 31@(#)runpcs.c 1.4 83/04/12NO%s: cannot open %s: cannot create too many arguments cannot set breakpoint: wait error: process disappeared - core dumped coreprocess terminatedtry again%s: cannot execute @(#)setup.68 1.4 83/04/12_Sysmap_ESysmapsbr %X slr %X _u_physmem_physmbmemphysmem %X physmbmem %X Cannot adb -k: %s missing symbol %s core file = %s -- program ``%s'' - warning: bad magic numbernot core file = %s address beyond physical memorycannot find procprocess not in corecannot find procumap troublecannot read umap-warning: `%s' read-only cannot open `%s' a.outcore@(#)sym.c 1.2 83/02/07old format a.out - no string table error reading symbol|string table %R%s+%R %s ran out of memory /dev/tty %M% (SUN) %G%M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$4Pb[ lٹQN **by   $ , 4 < D L T \ d. L$G"I#HTHS/ND /N |XNuNuNVH0Hx HxNP#LJf Hz0NhX(yL*|`:)M(/N&X.T @)P T @ JfL0N^NuNVH0(|`/NX*@+lBm;|#PJfL0N^Nu:2222PP2PP2PP::@:р222@ @d!d&|@+|0e4e9g=gBlFlKnOnTbXb]oaofcjcomsmxk|kffjj``|aa|hhiirABB@B2 2 2 $$H$TUWQQ \^R_!S&]+[0V5Z:P>XCYHrMrR2 W2 \2 aĠeHjHoaNtzdxze|zgzlznzbzozczmzkNzfzj`NNzhzi\AƼNPHH0 vNz@H HH!HyTNP#fHyTHy@NhP/9(N|XHy^/9(NP#gHy`/9(NP#f/9(HybNhP##6 9:й>йB####FBBB/9NL /9HxHx HyNB  f <`p //9NL B  f <`p й6//9NL B/9/9NL B  f <`p й6й://9NL B  f <`p й6й:й>//9NL BBN^NuNVH0-y .lHyNhX 9r N#JTg0 9r NѹB 9ѹB` 9r N#/9N X/9N XHy/9(NP*@Jf/9(HyNhP(yB  f <`p йй/HTNL N/9HTHUa B/.HUNL /9HTHUa HTN:X#HTNX-@B  f <`p ййййй/HTNL HTHxHxHnNBBHTNL HTHxHx HyNHUN X/9(NXL0N^NuNV...`d /.HxHx HnN. f n (ሁ/. HxHxHnNJf..N^NuNVH0*n9HH.(mg$/.9HHй//. HUa-mJg9HHй葮 . Jg~ g0 f .r"ҹ, A0RT9 nn0.H l 2f HxNܪX й, @0T9`J .n .l 2f HxNܪX-y,9HHЮ @R9L0N^NuNV . g/. HyNhP/. /.aPN^NuNV.*n 2fX09HS bF@0;N "`2/9`/9`/9`/9Hx/. HUN*nN^NuNVJTgB` 96-@ nJgz09HS bh@0;N 222`T/./9/./. /.Hna<ѹ`,/./9 .//. /.HnaѹN^NuNVH0*n n (h 2fz |,*+h+h0,f^0,gR+L* .-눁- .--/.HxHx HUNp `v0,HJg\ g g8JTgp``pሁ`h`THx NܪX`DL0N^NuNVH0 n(gB`Hx&HxNP*@JfHyNhX+y;y n+h n+h+n +n .D+@+n" n+h(|` T -m(HJf*( -L0N^NuNVH0HxHxNP*@JfHyNhX+n+n +n A` T .o(HJf*( L0N^NuNVH0*y`$(m 0-lf0,g ,ѭ*Ufa|B*y`6HUaBX.o/HUa8P-|`JlHy7NhX*UfJfL0N^NuNVH .. nߨ n/(0(H/a@P nШ-@*y`pgh n"m 0(ifVJl -Эn .l`$Jm -n -Э".l߭ -o߭*Uf*y`(g n"m 0(if -o߭*UfL N^NuNVH0*n m 0(gD0-hgJTg2 hg*(m"` ,n - n ,`(Tf -L0N^NuNVH >. *yB` mf . o m" -܀*Uf*y`mf . o -U܀*Uf L N^NuNVH0*y`(U/-"aJXHUN>X*Lf*y`(UHUN>X*LfBBL0N^NuNVH0*n`(UHUN>X*LfL0N^NuNVH0 n(gB`Hx&HxNP*@JfHyINhX+|+y;y n+h n+h+n  . D+@+|+n"(|` T -m(HJf*(pL0N^NuNVH<(|` m hgd0+gXJ"fRBHxHxHxa+@"$|` R -m$HJf(*$`P&m 0-kgJTf0+g Jkf +Э. m o HxHUa*P(M*TfL y (V#B y (V#FNN Na L N^NuNV.#t B$BPR2 2fBl~  @BR` yB y!y6 96й: y!@ 96й:й> y!@ 96й:й>йB y!@Hy|aHX..N^NuNV 9gRB9HxHyN@PN^NuNVH ..B*| (l  g&B B 2f0Hx NܪX`"Jg 9й //HUN Jgt gH g R` -r y,0 y,1m Hx/9,NPX ` y,0 Hx/9,NPT `m HxHnN@PR `~L N^NuNVH (f 9  g 2fHx NܪX`*y`HxHnN@PR`vR ] .\fTU.HH "g \gBB. 0m, 7n&.HHHHЁ0@R mHxHnN@PJfJgHxHUN@PR L N^NuNVH0*n#3# yt1y/NX(@lC9yBL0N^NuNVH 2fHB`<  @*Pf 2fHxNܪX` BmmR(mL N^NuNV. 2f:*yf 2f Hx NܪX`Bmm+y$*nN^NuNV..9`R B9HxHyN@P SJf..N^NuNVH0(y*yf 2fdHx NܪX`V 2fm ;|+l` mf -g HxNܪX 9$Ѭ ,o)@L0N^NuNVH *n 2fB  @BR m -JgZ g 2f HxNܪXJ9g9HH/HyNP9HH# `l 9g 2f Hx+NܪXp0-/p0-/p0-/p0- / mN`vp0-  b@0;N$$Jdrz 9g 2f Hx+NܪXp0-/NXB9`/9N&`/9`/9`/9`/9`N~`N`N`p0-/N.`p0- /N`N8`Nt` 2ftHxNܪ`dL N^NuNVH0*| (|-m-l (g 2fHx` f/.a"XJgHTa#XJgHTa#>XJg y,0@`0/.a"XJglHTa"XJg`HTa# XJgT y,0BHxHxHT`,/.a"hXJg6HUa"XJg* y,0DBHxHUaz ` g g f&/.a"XJgHUa"\XJg y,0F` fF/.a!XJg6 f/.a!RXJf 2f HxNܪX .Nh`/.a!XXJg f/.a!XJf 2f HxNܪX .N``HTa!XJgHTa!XJg y,BPB/. HUab y,0H-@BPHx/. HTa@ y,0@0H@.HHr 㠀.HH큀 y,0` g/. HUa"PJfD fT/.a XJgFJ g@ .r  f"<0`"< @ y,0B/. ` y,BP 2f Hx NܪXL0N^NuNVH0 gp`B-@*| (|-m-l .퀀 y,0 (g 2f HxNܪX  f4 .퀀 y,0Jg nJn 2f HxNܪX fB .r y,PHTaXJg&/.HTa PJg/./.HTaN `H 2g.`6 . g g f/.aXJg0 .r ". y,P` g 2f Hx NܪXL0N^NuNVH0*| (| y,0 (g 2fHx` f/-aXJgxHTaXJglHTaXJg` -r  y,P`4HTaXJgBHTaXJg6 y,PBHxHUN HxHxHTa > `  g 2f Hx NܪXL0N^NuNVH0*| (| y,0 -l (g 2f HxNܪXHUaXJg< f6/.aXJg( .r y,PBHxHUa ` 2f Hx NܪXL0N^NuNVH0*| (|-m-l y,0 (g 2fjHx`\ fF/.aFXJg8 f2/.a2XJg$ .r ". y,P` 2f Hx NܪXL0N^NuNVH0B*| (|-m y,0 (g 2f|HxNܪX`n fh/.aXJgZ0. y,P 9T",-A rr⠰g 2f HxNܪX y,1nL0N^NuNVH0*| (|-m-l y,0 (g 2fHx` f f/.aXJg\/.aXJgN .r @`./.aXJg: .r H". y,P`/.aRXJf/.aDXJg"/.aXXJg .r ".`/.a6XJg /.aXJg .r `~ 2fHx` 2f Hx NܪXL0N^NuNV.*| -m (g 2f HxNܪX g 2f Hx NܪX  f/.a vXJgJ f&/.a @XJf 2f HxNܪX . y,0*nN^NuNVH0*| (| (g 2f HxNܪX f  g 2f Hx NܪX-m/.a XJf 2f HxNܪX . y,0BHxHTN L0N^NuNVH0*| (| y,0  (g 2fHx` f6/-a XJg( f".,/a XJf /a XJg,-`^ f@/,a XXJg2 f,.-/a XJf /a XJg y,P,,` 2f Hx NܪX  g& g& g",<` y,h`2,<`B`| r 㠀 y,1@/a XJfL0N^NuNVH0*| (| y,0  (g 2fHx` f.-/a XJf /a XJgt gnHTa XJgb y,1|Hx/. HT`@.,/a \XJf /a rXJg4 g.HUa DXJg" y,BhB/. HUa ` g 2f Hx NܪX r y,h/a XJg y,hL0N^NuNVH0*| (| y,0 (g 2f HxNܪX  fpHTa XJf f^BHxHUN HxHxHT`6HUa XJf f4 y,PBHxHTN BHxHUa `  g 2f Hx NܪXL0N^NuNVH0*| (|-m-l y,0 (g 2f HxNܪX f/.aXJg f,HH/alXJf 2f Hx NܪX .r , y,PBHxHT`j/.a 96Ѭ`D9| `Z 96й:` 96й:й>` 96й:й>йB`tg0,pf9n R(lf6X4e$L0N^NuNVH0B*|4`8(Uf$`* l gHTaXJg )nR(lfX4eL0N^NuNVH0B-|*|4`.(Uf` l gHTaXJg0,fvB. T Lf Hx,NX0,g.-lBn0.@-n/NXRѮ /.HxHx HnN`r0,HJg& g g JTg"p` |`t|`j|``p@`V0,f 2f Hx,NܪX(lfX4e-y0`f nhh=h-hJh g-n0( HRѮ`B /.HxHx HnN n-hJf .L0N^NuNVH0B-|/.HxHxHnN*|4`V(UfB`HHTaXJg0 l g(/NXR.Ѯ/.Hx//N(lfX4e-y0`8 nJh g$0( HR.Ѯ/.Hx//N n-hJf .L0N^NuNVJ9Ngp` n P Lf n0(gBN^NuNVH0*|4`(U` l(lfX4eL0N^NuNV/9xHyTHyN$ /. /.HyN$ NN^NuNV... 2f6RP  @//9$/9xHykHyN$..N^NuNV 2f2 . @//9$/9xHyHyN$N^NuNVB4#40/. /.N4Pa*N a"N JPgp`B/N |XN^NuNVH `R$ 9$f 92faJ9+g 2fHx`*|,` f 2f|Hx`lB B9-M`RHH @0g`RHH @ PgHH @0H.JfR/.aX`R f/.RHUaP*@HH @ Pg 2f HxNܪX ;fRHH @ PgHH @0H. g f ;g`j/.aX-@f 2fLHx`< fZB(/.N X 9 ѹ yt!y"y#h y 9谨o!@ ;g4`#( 9(S /HUaP*@Jg 9(S /a \X`RHH @ PgHH @0H. fRHH @ Pf` g 2f2Hx `$R( (oD 2f HxNܪXB9+HyHxHy,N ,gL N^NuNVH0*n-M`RHH @0fUB/.a8XT @(P`/./N@PJg (lffB` ,L0N^NuNVH0*n(M`RHH @0fTBHUNX-@ 2fJ @0((g 2f HxNܪX nh  n1y n!y`4 n0(yf (g 2f HxNܪXHH @0f# L0N^NuNVH<(n*n &M`RHH @0fSBHUNX$@HnHTaP(@tfJg( n0(yg 2f Hx NܪX .-@`HxHy@N@P nJo/.Hy@N@P# yt!y"y#h y 9谨o!@`%nJg n0(H`B5@0*g 2fRHxNܪX`D .f0*#`&0*Jg n2(H`r5@Jg$0*H//.HUHyHyN$`RHH @ Pg L<N^NuNVH *nB`$ "HA HABAЁHHЁ .Jf "<N>.Jl ` L N^NuNV.*n |"n "#h#h#h HH @ Pf@/. RHUaP*@ n f 2f HxNܪX n  `/. HUa`P*@`RHH @ Pg`T@0;NtRHH LgB Wg lg2 wf n RHH @0H c`^ n ` n fH` n f6` n f$`/. HUaP*@`*nN^NuNVH0(n*n g 2f Hx NܪXm HURHTa4P(@`RHH @ PgHH @0H g g `R`+m HURHTaP(@ fHH @JPg 2fHx NܪX`RHH Lg8 Wg lg( wf(-HH @ PfR`-` 2g`LHH @ P g 2gp`$`&L0N^NuNVH0*n(n `RHH @ PgHH @0H. g f BB`HTHUaP*@ |@-P-h-h-h `RHH @ PgHH @0HW bt@0;N8hhhhhhhhh 2fBHx NܪX`2HnRHUa2P*@ g .gJgJfJg)n .Ѭ.,`HnRHUaP*@ g| .grJfjJfb ,".N)@`HnRHUaP*@ g6 .g,Jf$Jf ,".N`HnRHUaZP*@ g .gJg&Jg n"l0(ifB, .`: L0N^NuNVH<*n(n ~ `RHH @ PgHH @0H* g$MB 0fR xg XfR`& AlN amb fn\ HHЁW,HH @0g HHЁ0` Fn HHЁ7` $f*JA$H`HH @0g 8g 9f 2f HxNܪX HHЁ0,`HH @0g~ "HA HABAЁHHЁ0,`)FB`tHH @0fBHnNX&@0+g)k`B0+ g`0+g JkfB` )@ `~ f fnHTRHUaP*@Jg 2f Hx NܪX ,D`2HTRHUaP*@Jg 2f Hx NܪX ,F)@` g fnA)HRHH* \fRHH* "g> g "f f 2f HxNܪXBB `z\` f\HTRHUaP*@`RHH @ PgHH @0H* fR`* 2fHx` 2f Hx NܪX LXN^NuNVH0*n (n -+fp`B,HTN X wf0Hx/.NLP.JgJm/NXHx` afvJgp`p//.NP.lB 8f6Hx/.NLP.Jg Jm/NXHx/.NP.Jm.HxB/Nr `Jgp`B//.NP.JlB`*B@Jgl` rgl`l L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/Nr "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/Nr -@ nBJg n S m n (R!@S @`t/.N4X`f n0(gV/N JX n0(gB nh n"H#h/./. n(HH/Nr -@ fp`BLN^NuNVA-H#`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBd`b y< S m. .R @HH y<"(R!AS AHH` /9< .R @HH/N tPRd nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH] @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH] @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|$LA`-H-H`P .P-@@ .P-@P".DN>ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|5`-|8`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|;`J.g -|=`J.g-|?AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N>0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH] @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0hb1 nRJfhc0R 9nB <hL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nv .B`T0-f(mfHn-HH/N~PJmJn -|`-nf9HH/NXJgm+|D+|D+n 0-gl(m m R Э "-d f -,/HT-HH/Nv .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nv . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nv g m p`BL0N^NuNV.*|` HUaX@e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-N>XBBBB BmB- L N^NuNVN /.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`@eB` 0,f -+fp`B, wf0Hx/.NLP.JgJm/NXHx` afvJgp`p//.NP.lB 8f6Hx/.NLP.Jg Jm/NXHx/.NP.Jm.HxB/Nr `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuNVH N.*nJfS` r N80 r N.S XgR|a` zf <D` RB/.NP f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NLPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.Nr N^NuNV/. Hy@t/.Nr N^NuNHx6N@eNuNHx N@eNuNVH0Jܸf8 <ܼ#ܸ <ܸ#ܼ#ܼ#ܸ .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfܸgB`R o "<N#BN>X(@ 9" Ҁe 9/N>X(@g y 9Xg y  9" ҀY(# <ܸ A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#HBNu /йH/@HxN@e 9H#HNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLMissing .end statementInvalid characterMultiply defined symbolSymbol storage exceededOffset too largeSymbol too longUndefined symbolInvalid constantInvalid termInvalid operatorNon-relocatable expressionWrong type for instructionInvalid operandInvalid symbolInvalid assignmentToo many labelsInvalid op-codeInvalid entry pointInvalid stringBad filename or too many levelsWarning--attribute ignored.Error statementToo many levels: statement ignoredInvalid conditionWrong number of operandsLine too longInvalid register expressionInvalid machine addressUnimplemented directiveCannot open inserted fileMissing close-paren `)'Too many macro argumentsInvalid macro argumentInvalid formal argumentInappropriate .endc statement; ignoredWarning--relative address may be out of rangeWarning--invalid argument; ignoredInvalid instruction vector indexInvalid instruction vectorInvalid macro nameUnable to expand time macroBad csectOdd addressUndefined L-symbol    HJNT\ciotysassign(%s) = %ld, %ld operand %d: type=%s csect=%s .text.data.data1.data2.bsssym=%s value=%ld reg=%d displ=%ld ?regdeferpostincpredecdisplindexabssabslimmednormalstringStab storage exceeded Out of string space Stabs choke Stabs data in first pass!!!!! -+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$@/b[ 4lفՁ  by1*by ( 0 8 @ H P X ` h p x l0 Xnx$G"I#HTHS/N /N%XNuNuNVHJyoPSy`F0H @< FfRJlN#lB$|0`X Rf0*GfXJRm 0Hf<*lB`JFf"09H b@0;Nj0H @0H〙*K0H @0H倗#`=F0H @<0H @0H2HЁR=@ nl*0.H< @>0H @0D@2@g0H @0H< @>0.HS xb@0;N&2&2Bp~.8B`p(6JZd|(4J`fj(x"2:@HPp`HyNXR3`n0H @0H<JFm< Fl60H< @0H @ Pf0H< @>`v0H @<UYAԹd`jJg`#`bJ*f4//-/-Hx*N.#4`#HyNX`#``#h``//-Hx.N\ #``//-Hx/`/Hx0NP`BBHypHyN /NXP//Hx `Hx/NX`/HxL`#``R/NX//-/-`jB`Hx`/-/-Hx3`PBHx8`lHxBHypHyN /NXP//Hx4`HxBHypHyN /NXP//-`/-/-`//-`/-/-/-Hx5N`/9h/-/-`/-/-/-Hx `/9h/-/-`/-/-Hx7`r//-Hx `d//-Hx`V//-Hx`H//-Hx`://-Hx`,/Hx`H#``/HxF`4/HxH`*/-HxE`/-HxG`//-HxA`//-/-N`N//Hx+`/-/-`N///-N~`/-/-/-`/-/9h`/-/-N`//-`/NX/HxBHypHyN /NXP/Hx `(HxBHypHyN /`j/`N`/BHx@`BBHx=`/N:X/BHx>`/N:X/BHx?`Hx`B`//-Hx;`B/-HxB`B/-HxC`B/-HxD`r/`//-/-/-N.`/9h/9h//-`/N$X`<#Hy`/9h//-Hx!`//-/-`//-Hx#` BHx&N`BHx'`/-`BHx(`BHx)`//-/-/-Hx$N&`//-/9h/-`//-/-Hx%`$L`~ <?`vHy `T 9@֘ @@R@ @m:Hy֘Hy'`Z .R Zc&/.Hy7/9N a-@lBN^NuNV. pcS yHH`XJf y֐HH.R֐`< y S m y (R!@S @`/9NlX. fR` fB ..N^NuNV#N^NuNVH8Jf -|@`B 90@-@(|H*y#4 f &Uf-mJgj n g\a-@ nR-Ko` .Ю&@bv "HA HABAЁ8fV +"HA HABAЁ8 8fS nHH#< g8n ;gvn gJ n/(HyLHxN4 ` n!y 9 @ R` n/( arX n h !n` n/( aRX n/(aDX n h !n n h` =gz`V @glnH ?g^`: Cgzn Bgn` Dg``N^NuNV n ( Agn >gg8n ;gn g/-HyHxN4 `B~`  @BRoHUa6XHn - S/Hya Jg /9abX"-  A ` . @ - "@"`h/- aX`\/- aX/-` =gT`4 @gFn& ?g8` Cgn Bg` Dg`L N^NuNVH *n - Agn >g8n ;gn gl/-HyHxN4 p` -  @ g -  @ R >f mJfB`p`/- aNXJf`/- a>X`/- a2XJf/-a$XJf`/-aX./- aXJgJf` =gP`. @gBn ?g4` Cgtn Bgx` Dgj`L N^NuNV n g-h n ( g\ ;g, Ag. Bg Cg Dg `f/.aDX/.aX`R n . f/(a"XJf6` 9 @ g 9 @ RN^NuNVH . *n Jgfp`BL N^NuNVHB`R Ю @-P n f4B`X n  @ fRm n B` R opLN^NuNV. .R/N5X-@-@fa n ~`  @ f X n Ro ...N^NuNV,H B`"  @B ACRoBABBCR mBB>#*y-UBlxX-UA  A . @-P n (= b@@0;N<x n,(A gAAB>R>R`l| l g&A gAAB>R>R` n-h nJg gR>R`| lZ g: n/(/aDPJf&A gAAB>R>R`-n>:BB`BBB . @ ". A P"Ё @ fJ-| .R/N5X-@faA . Jg n `-n-n:> . @*P-UBlX-UA g.A g AA . R . @-P n (= bH@0;ND n,(AJf$ABJfABAB>R>R`B| l g.AJf$ABJfABAB>R>R` n-h nJg gNA"nHHJf:AB"nHHJf&AB"nHH nCB>R>R`| l@ gB n/(/aPJf.AJf$ABJfABAB>R>R`B .>lABPAB.HHBBB`  @BRoB`A  AЈ @BA   @-P n,( g @f.HHgP =gH >f n/(.HH/aPJf$ ?f~ n/(.HH/aPJfbA   @*P-UB`B/./.a *@Jg& H gJ g/. N7bXB `|HxN5X*@f/.HyHxN4 /.aX*+n  .".N'j+@+n /.a*X. Ю @+P Ю @ L N^NuNVH *nB`pހJf r2N0L N^NuNVH0*nHUaXЮ @(P`(/HUN2PJfJg . f `(lfBL0N^NuNV.*nHUaXDfHyHxN4P  - g JfBL . ".N'j+@N'J*nN^NuNV.*nHUaXDfHyHxN4P  - g JfBL - f$Jg Hg /-N7bX+|H /. aX+@*nN^NuNV.*n XfJLfNHUa\X - fD/-NXJg,/-NXN'j+@ - f `+y$ -N'J*nN^NuNVH *n XfJLfNHUaX - f - f$Jg Hg /-N7bX+|H -N'JN'^$ -N'JN'^f -N'J//Hy` -N'J// yP/HnN0HnaX+@  -L N^NuNV.*n - g/HyHxN4 - f./- -N'J///-/HUHyHxN4 *nN^NuNVH0*nf0HxN5X(@fHUHyHxN4 B`BHUN.TXR/N5X(@fHUHy"HxN4 HUHTN4P L0N^NuNVH Bx#LB9X`\ y$/afXX$S@`>JDf| y$/Hx=NPJf y$#p y0 p yp -f #`D`4Hy8/9pN.xP#Df/9pHy:Hxa yl PHH,f| *|X yD S m yD (R!@S @`/9DNlX.g f" yl PHHfXcHyXHyHHxaJ BJ8ga f Xc yD yD y\ 9N'J// (N'JN*N'j!@ y\ y\ p` gJ yD S m yD (R!@S @`/9DNlX. g g ` `Dg/9DN%rXBDS@X$J@nBL N^NuNV-n`R n =fBRHypHx/9&/9"/.NX//.N-@/./NpPN^NuNVH0*|X(|xB y, P  fB`JR`DR dmHyXHycHxaN ."HAHABAЁV @ f ."HAHABAЁN @JgN ."HAHABAЁN @ Hg( ."HAHABAЁN @/N7bX ."HAHABAЁN @ H ."HAHABAЁN @ ."HAHABAЁV @   g  g  gJfB  g  g  gJf`Z ."HAHABAЁV @ f ."HAHABAЁN @JgN ."HAHABAЁN @ Hg( ."HAHABAЁN @/N7bX ."HAHABAЁN @ H ."HAHABAЁV @  ."HAHABAЁN @ HS`VJgFR dmHyXHyʼnHxa ."HAHABAЁV @ f ."HAHABAЁN @JgN ."HAHABAЁN @ Hg( ."HAHABAЁN @/N7bX ."HAHABAЁN @ H ."HAHABAЁN @ ."HAHABAЁV @ `  g JgfBJfB-|c .n##x-|` ."HAHABAЁN @/a XJgt ."HAHABAЁN @/NXN'j$ ."HAHABAЁR @ ."HAHABAЁV @R .oR 9N(N'J//BHypHyůN /N JgJB`8 ."HAHABAЁN @//.HyŲN R .oL0N^NuNVH0Jxg Lg*|X-|`< ."HAHABAЁJ/NX(@f yH PPR yX N'JN'^".oB- yD!| XcHyXHyHxa L0N^NuNV dm/.HyHxaV ."HAHABAЁJN^NuNV/9 /.HyHyшN#*N^NuNVHyHyшNP/.(/.$/. /././././. HyшN$HyHyшNP/92/9. y` N'JN* -@ @-P=h/.?.a\A  @"|Dr"2 <DrN^NuNV/.NX-@-n n ( fNJg Hg /(N7bX n!|H n n N n!@ n/(Hx/9\/9XHyNX//.N-@B.|A  @"|Dx"2 <DxN^NuNV n/aX-@ @-P=h n ( g-h`/.NX-@/.?.aj\/. n/(NbP-@  f g  f Jf <L @"|D~"2 <D~` <R`N^NuNV n/aX-@ @-P=h .f .fp`B-@/.?.a\ . .g, /g 0g/. HyHxN4 Jg <L @"|D"2 <D` n/(afX-@ @-P=h .f .fp`B-@/.?.a \Jf <R`Jg n/(a X-@ @-P=h .f .fp`B-@/.?.a\Jg`/aX-@ @-P=h/.NXN'^-@/.?.an\` .S-@JlB` .".貀o .-@a~-@ @-P=h .ЮSЮ @P .ЮSЮ @B .ЮS//.NpP .ЮSЮ @A  @"|D"2 <DN^NuNV n/aX-@ @-P=h/.NX-@/.?.az\ n/(azX-@ @-P=h/.NX-@/.?.a>\a-@ @-P=h-n`|-n-n` n nfRR nJf nJfB .RN(N'J///.N A  @"|D"2 <D`R nJf|/9t/9p`N^NuNVB-n(HxN5X-@-@` n"nRR` n%RT`x n %f (%gA0-H,` n am zn lfR n .,R,"@f n,BA .,e/.(Hy]HxN4 nHHc b@0;Nd,,,-|`Hn0Hy{/.N0 /.N.TXѮ`~-| n (lgN n,|l n,dR, n,B`0 n (lfp`p-@`-|`-|` BJglJ f/.(Hy~HxN4 /. aX-@ @-P"=h& n -h g/.$NXN'j-@ f" .N'J//Hn0/.N0`b f .N'JN'^`2 g f2 n$Jf <ǡ` /.$NX/Hn0/.N0 /.$?."a\/.N.TXѮR nJf nB .N^NuNV n P-h n/aX-@ @-P=h/./.NX/aP-@/.?.aV\a-@ @-P=h n!n n!| A  @"|D"2 <DN^NuNV n/aX-@ @-P=h/.NXN'j-@/.?.a\  gB n/(aX-@ @-P=h/.NXN'j-@/.?.a\a-@ @-P=h .  b@0;N$/. HyǢHxN4 .N'J// .N'JN*N'j-@N'J///.N A  @"|D"2 <D` .N'J// .N'JN*` .N'J// .N'JN,`/9|/9x .N'JN* n/(Hy$NP/.?.a\ <L @"|D"2 <D`$ n/(/( n/(a A `N^NuNVH n/adX-@ @-P=h/.NX*@/.?.a*\ n (hf y, PHH.`B n/(aX-@ @-P=h/.NX @HH./.?.a\ n-h/.NX n n N n!@B fB`> n/(Hx/9Ɯ/9Ƙ/.NX/HnNJgR  g  g  gJg"R-MR  g  g  gJfUB/.Hy'HnN0 /.NXJg\ n/(Hx/.NX//`TJgR-M`  gJg RHHfUB/.Hy*HnN0 /.NXJg n/(Hx/.NX//` n/(Hx/9Ƥ/9Ơ/.NX/HnNJfXaD-@ @-P=h n!| .N( n!@A  @"|D"2 <DL N^NuNV n/aX-@ @-P=h .f .f/.?.an\ n/(`& n (hg,/.?.aF\ n/(aFX-@ @-P=hA  @"|D"2 <DN^NuNV n/a X-@ @-P=h .f .gA  @"|D"2 <D`/.?.a\ n/(aX-@ @-P=h .f .f |L-P=h` .f .g .f .gv/.?.aB\`8N^NuNV n/a8X @/(?a\ n (hgR/aX-@ @-P=h .f .gA  @"|D"2 <D`/.?.a\ n/( aX-@ @-P=h .f .f |L-P=h` .f .g .f .gv/.?.aJ\ n/(`N^NuNV n-P-h n ( f n/Hy-HxN4 n-hB 2lj .Ю @-P` n//.NpP n/(aX-@ @-P=h .f2 .f* |L-P=hA  @"|D"2 <D`H .f .g .f .g/.?.a:\ n-hJfXR`2N^NuNV| . & b@0;Nz:/. Hy@HxN4 A  @"|D"2 <D`X nJg0/aߺX-@ @-P=h/.NXN'^#*|`|`|`|`N^NuNV n-P/(aXX-@ @-P=h fD/.NX/N.TXN(`/.NX//NgSo,Sm ,R @` HTNlX. f gJo HT/N5XP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg β @` β @R mHH. ]g*Jg β @` β @RJfS L N^NuNVH *nBB-yl-yp-yt-yx-|-|HH. g -f -|`f +g^S`Z/98/94 .".N**LZ`0SR`*0Eb1 nRJfEc0R 9nB <EL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N: .B`T0-f(mfHn-HH/N3vPJmJn -|`-ntf9цHH/N3XJgm+|$`+|$`+n 0-gl(m m R Э "-d f -,/HT-HH/N: .+L`/.N5X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N: . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N: g m p`BL0N^NuNV.*|`` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N3XJl~0-g /-N7bXBBBB BmB- L N^NuNVN%H/.NXN^NuNV .". nJ/H?N'| n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|``eB` 0,f -+fp`B, wf0Hx/.N/P.JgJm/N3XHx` afvJgp`p//.N4P.lB f6Hx/.N/P.Jg Jm/N3XHx/.N4P.Jm.HxB/N/ `Jgp`B//.N4P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N4 N^NuN:HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N5(PJlB`pN^NuNVH B/.N4P. g `/N3XB`Hx N5X*@Jg*B L N^NuN:HxN@eBNuN:HxN@eNuNVH0*nJf HxHm /N4 +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuN:HxN@eNuN:Hx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N5N N^NuNV/. Hy@t/.N5N N^NuN:Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JF`f8 <Fd#F` <F`#Fd#FdFl#F`Fh .^rN8.*yFhBFt g`(*(U g " Ҁe " Ҁd(M *@bFlfF`gB`RFt Fto "<N8#FtBN8bX(@ 9Ft" Ҁe 9Ft/N8bX(@g yFl 9FlXg yFl  9Ft" ҀY(#Fl <F` A ` " Ҁ#FhFhc A#Fp A 9Fh*A L0N^NuNVH0*n(MY#Fh (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN8.d-G` n"n"Xb[ elف  by1*by ( 0 8 @ H P X ` h p x lX .SJfd& " Ҁe " Ҁ Ё @ Fp L0N^NuN:HxN@e#\BNu /й\/@HxN@e 9\#\NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL'?A B@;1Az^qx<=7wl/tMLfKFighYjX2 W$^87^7-.Vb^_`cdeZ[\]7*b!#r^"ks-. %&_`cdeZ[\] nopmb!#"7" %&q %&_`cdeZ[\]b!#7" %&_`cdeZ[\]^Tb!#7y" %&_`cdeZ[\]7^!# "bU %&!#"_` %&!#7"b %&nopm_`cdeZ[\]7b!#7" %&_`cdeZ[\]7!#"+ %&b7y!#53"_` %&!"7 %&!#" %&7!#" %&77!#53"!#" %&*7 %&7!#" %&7!#" %&7y7!#!#"" %& %&77!#r"!#s" %& %&J!#!#"qr"s %& %&!#"!#" %&q %&!#" %&!#!#"" %& %&!#!#"" %& %&nopm!#"6 %&66PQ6nopm666666664NO66S666666646{|}~4a6664:H666644644u4v444466444HH44444444$IHFE 9/z)JJMCA#h85""rt5OC(MJ34/z)'! JJJ~B//sF9(}|{8C6z-4&y1xv      {{/(0845 7-+IJ1<2KL;{./{,:9(+-*/%IJ-((((([}&'(){!#$}@=>?^$())))),,(((}}{/;BCD)),,,]"}9|(02)2./));%},),)));2;)))))BuC<uDEFGP7 !"JgA`auug8 GFE56%HI1234tggmuJJfhg g>@RSTUVW^+_,-./09#ijlnoqrgceg=uQYZ[\$KLMg;psNOgX]k:bd; ;?')*  vgg;&(;g;gygxwyacc stack overflowsyntax errorbailing out$zero&null$record$record$record$recordillegal statement`t>># >:>;>>>>>>>>>>>>>>9>9>9>9>9>>9>9>9>9>9>9>9>9>9>9>9>>!> >>#;>UPOUUYXYWYNMINFNGNCNBNENLNAN?NNHNDN=<  "99999999999&92999999999 QTRSV@KK999999979%9996995999999999999'9)9999(99998999J99*999199,9/999$999949-99099939.9+9=9 O=>a9: O P'k4}4~6SS;V4}6=;69SS OXZ !QU"#=W$9] O[Yb c#g%$h&\\\\\\\\\\%i'&j?@g<()h*+,,q-67.</)m0?@1!d!e(l2+p/v0w2{3453|R*n8K-r.t*o-s Aj.u??\`lm A B !1x1yn#p1z$?qot8u?s%o&v88 Cw\`< D E F G's H I Ay()x*+,z-x{./ J0 AS128 C345 D E F G H IS8 K L M< JTTTTTTTTTT<L< NLLk K L^ M__________TTTTTTTTTTTTTTTTTTTT` NL"f"f"f"f"f"f"f"f"f"fL`"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f^^^^^^^^^^^^^^^^^^^^``^```````````^`\`t@`(,4@HT`Hlx0`XH0hpX8 P8$,8D@P\h t8xX (0<DLXdp|H (08|@HPX``hpxPpH  `$x,04<DLT\dlt| h0(0088@HP@X`8`hhpxx`  (04H<HT\dppx(D  0000000000AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAp $record%onewline in regular expressionnewline in stringstring too longnewline in character classstring too longbad switch yylook %dunknown type %d in penter unknown type %d in freetrregular expression too long unknown type %d in cfollunknown type %d in first Usage: awk [-f source | 'cmds'] [files]a.outrcan't open %sawk.outnot saved -d-S-Rnot restored /crp/pjw/awkhist/awkhista%-8s %s'%s'-fr"%(+. 1 7 @ G KQV]ahou{ !"#$%&'()*+,- . /012 3&4+526:7@8H9N:V;Y<`=d>h?m@rAvB{CDEFGHIJKLMlex: %c lex:? %o lex: %s lex:? %o FIRSTTOKENFINALFATALLTLEGTGEEQNEMATCHNOTMATCHAPPENDADDMINUSMULTDIVIDEMODUMINUSASSIGNADDEQSUBEQMULTEQDIVEQMODEQJUMPXBEGINXENDNLPRINTPRINTFSPRINTFSPLITIFELSEWHILEFORINNEXTEXITBREAKCONTINUEPROGRAMPASTATPASTAT2ASGNOPBORANDNOTNUMBERVARARRAYFNCNSUBSTRLSUBSTRINDEXGETLINERELOPMATCHOPORSTRINGDOTCCLNCCLCHARCATSTARPLUSQUESTPOSTINCRPREINCRPOSTDECRPREDECRINCRDECRFIELDINDIRECTLASTTOKEN00$zero&null$recordFS RS OFS ORS OFMT%.6gFILENAMENFNRout of space in makesymtabsymbol table overflow at %scan't set $0can't set $0%.20gillegal reference to array %sfunny variable %o: %s %s %g %oout of space in tostring on %sout of space in tostring on %s,XHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH?rcan't open %srecord `%.20s...' too longrecord `%.20s...' has too many fieldsrecord `%.20s...' has too many fieldsNFfield %d: |%s| built giant record `%.20s...'trying to access field %dawk: %s near line %d awk: record number %g $recordHHillegal statement %ounexpected break, continue or nextunexpected break, continue or nextunknown boolean operator %dunknown relational operator %dout of temporaries in gettempformat item %.20s... too long%snot enough arguments in printf(%s)illegal arithmetic operator %ddivision by zerodivision by zerodivision by zerodivision by zeroillegal assignment operator %d%s%d%d%s is not an arrayillegal jump type %dillegal function type %dstring %.20s ... too long to print%stoo many output files %dwawcan't open file %s%sout of space in ALLOC$record&&&&&&FFFFFF(j(ߚ0>tltLMNOSX\afkotuy}ˁ˅ˉˌː˕˚˟ˤ˩˪˫ˬ˭˳˺   "*+,-./0124567:=@CDEF < <= > >= == != ~ !~ + - * / % - = += -= *= /= %= printprintfsprintf splitif(while(for(instatnextexitbreakcontinue || && !fncnsubstrsindexgetline ++++----$(empty restore file ?.B9@kU?栞f;8 @>$q3%#FmH?r ( @3{ !|D@?@???@?@??AA?A?XA@ݓ0Ju@NNPAV'-As@U&8?Ge+?f;@È????M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shsh-c/etc/utmp@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$/etc/ttys/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83Fxb[ ~lٸ @**by 0 0N$G"I#HTHS/N4 /NXNuNuNVHB nJg ` <p/N1 X"$ ԁ B RJgA-H:R` " Ҁ ABHy8HTHyq~N4( L0N^NuNVH /. /.N P*@HxBHUNP/N JP.HUN0XBHx/a L N^NuNVDH..-|90HH-@-y -yh-y L-yl-y -y lynyhy2JmhJ9 hgN J.gJ.gJ4f <qY# `J4fHyrNX/94`J.fHyqN3X(@f(|BaX-@ :fBarX-@# gfBaRX-@#' Hys/.NvPJfHys NX qf0#' `"/.N>XJg `AeHyrNXBaX-@/N>XJfB/.aXHnN3X(@J.g&f6HnNXJf$ <r`f.HnNX*@g HUN`FHnNXBa4X-@/N X-@J.fJf [fA*H`& g gAdHxaX-@ ]fBA*HJ fJ fJgHH/NXJgB`$ "HA HABAЁHHЁ0.HH/NXJfJmo0HyrHH/NvPJf# HyrNX-GJf -G*|r *fR` -f ..RHH/NXJgJB`$ "HA HABAЁHHЁ0.HH/NXJfJmjnbl .S-@`-GJfJf>-|Jg8`rJo$ .మo-|B` -n-n/.a XJ.g .ؐR/N1nX-@/NX/.N0`/.aX .SД# .ؐR# {fa-@ }fL0N^NuNVH0*nJ9 gJ f# `N9 HH/HUNP(@gS HTNXHTN0`HUNX#r5 L0N^NuNV# N^NuNV..9 g B `RJ g" 9 R @HH.g `( y Jf B p` y # X p ..N^NuNV...Hys/NvPJg3 R..N^NuNV...Hys/NvPJg3 R..N^NuNVH8Hx/9 N8PJl/9 NXBNrXHx/9 NPJl,-y/9 NX#/9 NX/9 NX-nBBy RHy~HnNPHz(HnNPy S-|A(HA*H-|`*g"Sl#s: Hys=NXHxNX.Jl# Hys"NX fB/.HnN|PJf0 </HnBNN BBBN^ `J.fJ9pgF BA*HHH.g,SfHxHnBNN A(H-|`A# A# A&H-|`hg` \f6Ba.X.HysK/NvPJf # ~\`Sf#s: Hys=NXHxaX. fBA&HHSHx`NvPJgHxHnNvP-@`-KBA-H`p n&P`4Sf"HxHnBNN A(H-|RJf Sf"HxHnBNN A(H-|X nJfJ g/9 N XB `L8N^NuNVH0NT B9`*y gB HUN X*y gB HUN XJg/. /.NjPHyr`NjXB9 h(y gJ9 gB9 HTN0XB9 NJ9 fJ9 g HxNXHy8HyHyqRN4 JoHyHytvHxN HyNXL0N^NuNV.J9 hf".9Hx09dH/N P#/.NXBaX..N^NuNVNT /9 HyshNjP/.abXN^NuNVJ f# B9 N^NuNVJ f/. /.N P# R9 N^NuNVnB.Hn/.aPN^NuNVH<*n m /Hx/NvP@ m /NX(@ m -PB #/.N0XHyq~N3X-@Jf y /ga9 S.By R - X$@Hy:HRNPJy Rg"HRNpX$@fHysNX m -PBHRHnN P$@#(Hy~HRNPHRaBXN HxHxNPJg n PJgJ.g&|` n&P/HysN P-@#\Jg/aX @HH-@BRJ.f& S /fJg .rNr®g\ SJgHyq/N|PJf HR/aP`0/./N P(@#DHRHTaPBDHTN0XRXRJfnSB\B(/.N0XHRN0Xa L<N^NuNV# Jg/9NXHysNXN^NuNVH8*n HU/.NP 9 g g: gJf @#/.N1 X#`HyPHyqN3~P(@f~B/.NP.&|HyqN3XJgHyqN2X` <q& g*HxHn/N f .#g&s/NrX`&T*HUHSN P*@-UHU/.NPHUN0X/.NXL8N^NuNV.*n R9 N/9 HxNxP/9 HxNxP/9 HxNxPHx/- N xPR9 HUaX*nN^NuNVHyqN3XJg.NT /.N rXHyrNjXB9 N^NuNVH BHyq~N3X-@#B  @BR mJg n-P` n P /f~ n/NX-@JghHn @/NPJmHp0. @g"`2JgHmaX @p".㠁/.NX*@Jf/.NXX .RrN-@ nJfXL N^NuNVBN^NuNV 9йgH 9"HAddHABAЁ"9ҹNd//9/9HysNjN^NuNVH *nB` HH"ҀށJfJl D. "<N-@L N^NuNV.*nBHUa P*nN^NuNVH *n.HH/HUa\P. UJgFHys/N|PJf2X.fJgp`B/HUaP,JfJgp`B` L N^NuNVH *n/. HUa\P. UJgFHys/N|PJf2X . fJfp`B/HUaP,JgJgp`B` L N^NuNVH *n.HH/HUaDP. UJg.Hys/N|PJfX.HH/HUaP, ` L N^NuNVH *n.HH/HUaDP. UJg.Hys/N|PJfX.HH/HUaP, ` L N^NuNVH *n.HH/HUaDP. UJg.Hys/N|PJfX.HH/HUaP, ` L N^NuNVH8*n.HH/HUaP(@Hx U/a `P.gX g f..HH/HUaP&@.f> S b2@0;N((((6HVHSHTN|PJfp`B.HTN0XHS`>HSHTN|PJg`HSHTN߶P`HSHTN߶PJf`HTa X.HTN0X L8N^NuNVH8*n.HH/HUaP(@Hx U/aVP.gX UJgHys/N|PJfX.HH/HUaP&@.f@ U b4@0;NJfHSa hX-@HTa \Xop`B.HTN0XHSN0X/N1nX`VHSa &X-@HTa Xm`HSa X-@HTaXl`HSaX-@HTaXn` L8N^NuNVH<*n.HH/HUaP(@ U$PgHysHH/NvPJgz*frX.HH/HUaP&@ fp`BL N^NuNV.*nJg( -g"HH/NXJfHytNXHUN2$X*nN^NuNVH<*n m (PHTN BX :f# <`n %f.0-gm# <`H# <`:$|f`&fHTHSN|PJf `n &RfBL<N^NuNVH0*n(n /- NX# /- N XS-@0,H".lHytNX0, H".oHytNXHU/- lNPL0N^NuNVN^NuNVH0 n(h  gJ9 gJ90gHytNX*yhBhHUN0Xf,J9 gHxNX`BHxNBHx aP`0Jg, n / n /( N xP/. aXN L N^NuNV.*nm8mJo 9`p/HUNP*nN^NuNVBHxaPN^NuNV.*y `,JfBBadPN+@` /-NX*mf n/(NX-@/BHx a /.N0Xa *nN^NuNVH8*nXJg2 MX P (f& U )f <r5` (@ MX P )gYJgHyuENXHTNX&@/BHxa HSN0XL8N^NuNVJ ga`HyuRNXN^NuNVJ9f BNO8XX nJgrr0rrrrrZ"rrr>`PHyuNXHyuNXHyuNXHyuNX# HyuNXL N^NuNV y JfBBaPNS y !@` y /(NXaN^NuNVH0N-@`> .mTJ g /- N XJg /-N0XHUN0X# J g*y (m .mJfL0N^NuNV/.Hx aPN^NuNV/.Ba PNTN^NuNVH0*n BJ9 g HxNXXJgBy RHy:HUNPJy Rg$HUNpX*@f HysNX`Hy~HUNP . fXJgTHyu/N|PJf@RX`8 /NXHH.fJg. HH/NX(]fJ. gJfHx NX`NTJ9 g HxNXJ g/9 N XB L0N^NuNV.*n/-NX-@//-a^PHyqy/-N|PJf/.NXN/.NpX-@-@B JfHysNX/.NX-@`Hy~/.NPHx4HyHnN P BHyNXR f# BlBNZX# #lB9HJg /.N XHx4HnHyN P m BNXN^NuNVT.*nA##(B 9# HnXaXB HywN3XJgp`B&HywN3XJgp`B$9&HH9$HH# `/a|XJfJ f&09 Rg/9 N XB B`/9 NX# *nTN^NuNV nB# #By p3' N^NuNVH *nHUHx`NvPJgrBHUa PB`:J9&gHyr5 й @/aP` й @/aXR09HmJ g^/9 N XB `HJ9&f(HytHUN|PJgHyw&HUN|PJfHyr5HUabPav`HUa XL N^NuNVH *n09 pH.#( y(BBHUaX09 pHfJ9$gHyr5HUaPa L N^NuNVH809 pHй -@*y`$(M`//N|PJo&U*(XeX .Ye#L8N^NuNVH8(y(*n ~fH fgn. ;go ` tg4n sg` xg`L N^NuNVH0B.A-H.9d*H`^Hx HxNP(@)M)n+L*L n -h J.fJ.fHn/. n /aT ` n /N1 X*SlJ.fHyxcNFX n!MBHnHxN6 L0N^NuNVH8 . hg qg rg tg xf(/. /.a,P*@g n `A*H.<(n`Hy@HTa2PJg&n`Se&|h`\ \f +&fRSmj`@HH &fHy@NXJmDBHy@HUN0PHUNNX*@RJfHy@NXHTNXJlHyxsNFX <r5`0BHTHUN0P nHn` RJf/.N1 XL8N^NuNVH0 . eg hgj qg rg tgP xgB`/.N1 X*@(M` g f q fRHH.f `/.Hx/NvPJg/.NNX*@S /f h f>/.N1 X(@ " Ҁ AB `\ <r5`J /g6 .f( e fHmN1 X(@`/.NNX*@Sd e g ./N1 XL0N^NuNVH0*n(n `JgfRRJfJfp`BL0N^NuNVH0*n(n BajX.Jlp`B@  $g %gj *g -g ^g/NXJgB/NXJg "HA HABAЁЇ0,BaX.` 8gJl*8(8`BaX./aXHyx/NvPJg`JlB .S(/arX`Jl*(`^Jl*(`PJl*( l 9  m 9 "<Nd. 9 "<N, </ й & @ І/09 H/N *Jl gJo\۹ 9 "<Nd.09 $HmZHx09 $HT/NP*@J &g/9 &HUN P/9 &N0X# &HxHxNP29 $Hҹ & A Ry $`l 9 "<N"ҹ & AА @HH*R  L N^NuNVHJ92f|J ft 9 S"<Nd.JoZB` й & @/N0XRm й &//9 &N P r 㠑  r 㠑 0y $LN^NuNV.# J92f&J g*y `*mJf o-@*nN^NuNV 9 N^NuNVHxB09 H/N^ #  NaN^NuNVB92J LfJ lfJ90fHxB09 H/N^ Jmn gbHxHxNP# &3 $HxHxNP y & 09 H/N|X# # # 2N^NuNV.. am zo Am Zo _fp`B..N^NuNV.. 0m 9np`B..N^NuNV.. HH/aXJfHH/aXJgp`B..N^NuNVH ..*n JgHHfp`BL N^NuNVH0.. ". Nh./Nb8X*@fXR9 HyNeX/. ". N^/Hyy=Nj HyyJNjXHyyYNXN(MJgBSf L0N^NuNV/.NdXN^NuNV.*n`XJf *nN^NuNV.*n`&/Hyw7NjPJgHyyHNjXXJf*nN^NuNVH *nB`RJf L N^NuNVH0*n (n(f .L0N^NuNV/. /.aTX/aP .N^NuNV.*n` /N0XJf/.N0X*nN^NuNVH0*nHUa^XR.Hx/aBP(@-L` /N1 X(Jf .L0N^NuNVH8*n(n HTNX-@HUNXЮR/HxaP&@HUHSNXPHTHSN0P L8N^NuNVH8*n(n HTaX-@HxHUaXЮR/aP&@HUHSaPHTHSaPL8N^NuNV.*nJfB`J-gR`HH*nN^NuNV.B09 Hg609 Hg*09dHg09 *Hg g /NrXR m..N^NuNV.J9 f< By 3 3dBy *~` /NrXR m..N^NuNVBNrXHxNrXHxNrXB9 hN^NuNVH..,. gJl `,Jm//NP`//aP,g /NrX LN^NuNVH..,. gJm Jl o `&Jm//NP `/NrX//a PLN^NuNVH..,. /NX*Jlp`. f ng//aP,/NrX ` LN^NuNVH0*n(n ..JgSfL0N^NuNVH0*n.. (M`Sm/N0XJfHTHUa.PL0N^NuNV n -fg4 |fN`d &g\ (fR`8SJl2HyyNX`" ,gHyt @/N|PJf(l(lg* THH fJfHT/.a&PHU/,a` Jf HU/.a PL0N^NuNVH0*n .g @ P (f2*m U )f ngrHU/(aP`bf`XHyP n/N3~P(@g8 n# # # HnNlXB #  B J gHnNX/9 NX n PJgD n/ n/N|PJf, n-P/.HyyN P n /.N0XJg ` n (//.a|P-@A .gR n"n"i#h n"n"i#h n!n n!n n/N0X/.N0XHyNXL0N^NuNVH8*n(n &m`/N0X*m/-N0Xf'L)K L8N^NuNVH0*n(n `*mg,Hyy UHH/NvPJf/.HTHUa `BL0N^NuNVH8B*n`t )g >g< |g*`V (fR`HSJl>HyyNFX`. U (|g$ - gHyt @/N|PJf*m*m g UHH &fJf (&g/.HU/.a &@ Sf$HxHxNP(@89|!)K&L`k!HxHxNP(@8Bl)K/./. HUa )@ `*Jf/./. /.a `HyyNFXBL8N^NuNVH0B*n`( )g ;f`, (fR`S*m gj UHH fJfHxHxNP(@8/.HU/.aN )@/./. /-a )@Jf )lB `/./. /.a L0N^NuNVH0B*n` )g& |g"*m gp UHH (fR`S` U (|fJfHxHxNP(@8/.HU/.aD )@/./. /-ax )@Bl `/./. /.a L0N^NuNVH0BB*n` )g` (fR`S*m gf UHH &f (&fJfHxHxNP(@8/.HU/.aD )@/./. /-ax )@Bl `/./. /.a L0N^NuNVH8B*n` )g( |g$*m g UHH (fR`S`JfHxHxNP&@ .-@(m g T &fk6/.HU/.aX '@ g T &f*L .//. /-a: '@ `/./. /.a L8N^NuNVH0B. . gP*@/N2XY b:@0;N000**0*0***00**m g`|BB*n`b )g: g8J.fgbJgJ.f` UHH-@ (fJf JgJ.fHyyNFX-mRJ.f`SJf-M`Jf U (>fl - g.Hyt @/N|PJfl*m . f - g Hyt @/N|PJf l*m - fHyyNFX`*m/9 UHH/NvPJf .g .gJgHyy`/N1 X)@`Jf U (<fl - gv*@/9 UHH/NvPJfV .g0,g Hyz `: .fJg Hyz!`/N1 X)@`$J f/N1 X".Ү A R*m fJg8J.f2JgHyz:NFX8Hx/./.a )@`JfHyzLNFX8 L0N^NuNVH0*ng0HS bX@0;N .ZZZZ(m ` /N0XXJf/- N0`/-aX/-N0X/-N0XHUN0X`/-arX/-ah`L0N^NuNV. ."<Nd.Jg4/Hyz}NjP ."<N. rXJf .gf [fR.HnHTaP(@TgBJf4Jg0 U (g&`&Jg"Hyt`/N|PJf|=XJg(]J.g .=gHyuENXHyyHTN|PJfV&MJ.g`XJfHy{ NX S )f(HBHUN BX-@Hy8//.a &A*H`6J.gHTajX//./.a `HTaNX//.aPHyq~/.N|PJf Hyq~aX @/a XN<`Hy{/.N|PJfHy{aX&@hj`Hyqj/.N|PJf/.adX/Hyqe`RHyqt/.N|PJf/.a:X/Hyqo`(Hyq`/.N|PJf/.aX/Hyq[N͆P(]fL8N^NuNVH0*n(n BB`8HH/NXJg( "HA HABAЁHHЁ0(Jf ]gHy{NX L0N^NuNV./. /.a:P*@ . SЕ @/a|X/.NX". Sҕ A *nN^NuNV./.alX*@f /.NX  m/N X". oHyrNX *nN^NuNV.X n*PXf N`B.-M`RHH/NXJf .g [fR.HnHUaP*@Jf nJg*PXUgB/.aX-@ .=f|=`v]HytI.HH/NvPJg..f6Jf2*|`NHys.HH/NvPJg..f]HyuENX .=fHnHUaP*@ .=fZJ.gPHU`:/./.adP-@HU @ ".SЁ @/.HH/a //./.a `6HU`(J.fHU/.a:X/.HH/a //.a$PHyq~/.N|PJfN fA**BHnNX. nJgHytNX/aXL N^NuNV Vdp`BN^NuNV VeA .d /N BXN^NuNVH0*nf*|yHUHUNXR/HxNP(@/NXP L0N^NuNV...#QQJl D. yQ-RQ f yQ2RQ.<l/aX yQBHyQaPX..N^NuNV... o r Nd/aX r N0 yQRQ..N^NuNVH *nB +fJ-gR -fRRHH/NXJgPB`$ "HA HABAЁHHЁ0.HH/NXJfJfJg D` `Hy{-NXBL N^NuNVHy8/.aPN^NuNV./. /.aP*@g UJf <y` U *nN^NuNVHy8/.aTPN^NuNV.# Q yQ*h`"/./-N߶PJg `#Q*mfB*nN^NuNV.# Q yQ*h`,/./-N|P-@Jf `Jn#Q*mfB*nN^NuNV.HxHxNP*@/. aXJg /. aX` . *Hy8HU/.a *nN^NuNV.*n By RHy:HUNPJy RgHxNXm HxHUaP-@fHUaJhgHytJ/9hN|PJg .fHUa0HS b2@0;NRHy{aX/-aXHy{aX0-fJg0-gl <{`j-m nJg/aX nJg Hy{aXX`/-aJXHy{aX/-a4`~/-a*XHy{` <{/alX/-adX0-fNJgH0-g <|` <|/a2X0-g HytaXHy{aX/-a X*nN^NuNV./.NX. PlT 9Ї Pm&Hy|/9NXP#PX`/./9NXP߹߹..N^NuNV#PBN^NuNV#PBPN^NuNVH0Jgf y0( fT*H`*m -f-HH/Hy| NjP(M/-Hy|NjP*mfHy{NjXB#PL0N^NuNVH *n`*m -ffp0- @g m m@ -M|.Bp0- p0-  -@ .g g . ft .f -HHg . fRHy{NjX . gJ/-xHyw7NjPp0- gHy|]NjXp0- gHytNjX . gp0- gHy|`NjX .f . gHytNjX . @gb y/( n h/( N|PJg@Hy|oNjX n h/( Hyq`N2X/NUPHy|mNjXp0- @g@ f6 gHy|vNjXHmHm Hm(HyQN^ .f gHy{NjX .  g` y/( n h/( N|PJg>Hy|yNjX y/( Hyq`N2X/NUPHy|NjX*mf .@g0 .f$ .gHy| NjX/.aX .` .g gHy{NjX . gdfPfp+`fp-`p / - l <|` <y/-HH/Hy|Nj`Hy| NjX . g/-Hy|(NjP . g . g -||-`-|w7 .fX-HHfPHyy`4 g g gH g@/Hy|L` Hy|3/.NjP`..-HH,  g f . f f gF-HHi @/` . g"J-g-HH/Hy|<`zHy|G`lL N^NuNVH0*n(M |Q <C"Q |Q-P-hHl(HnN^PHlHl HnNa .nf .oA-P-h(lfHyQHnHnHyQN^L0N^NuNVH ~J9gX nJg.JfHy|/N|PJgHy|NXP-|`. -fPm /HUaPfHUaXR09H".n *yXg-HHg*U`L N^NuNV.a X n/aDX*@HxHUaPJ9 g HxNXHUaX nJg X nJf*nN^NuNV.a n/aX*@HxHUaPJ9 g HxNXHUa>X*nN^NuNV.a hX n/aX*@BHUatP nJg X nJf*nN^NuNV. n/abX*@BHUa:P*nN^NuNVHxX/.aNPN^NuNVH X nJg P -f n P (lf\~`> i @*PgHUHy|NjP fHy|NjXR oHy|NjX` n P(HH/NXJg, n R/N X. m o`Hy|`P n R*@~`. i @Jg i @/HUN|PJgR o# Hy|NXX`~//.a PL N^NuNVH0BBJ9 g HxNXHxNX`Z n P %f n/aX*@(Mp0, (lf .  b@0;NDD DD/. /-NP  g  fHx/-N` f n/Hy|NjPR` n PHH/NXJfHy|NX`v n/N X-@/. /NPJl./.HyyENjP 9 @/Hy}`v  g  fHx/.NPX nJfHxNXJ9 g HxNXJg BNXL0N^NuNVH0*nBHxNX(Mp0, p0, g l l J gl `l (lfJ fHUa^XJ gpB`p /HUaPJ gHmHytvHxN .gHx/-NPHxNXL0N^NuNV.*yX`$p0- g <}/NX*Uf*nN^NuNVH8Jg4 nJ(g*Hy}2/N|PJgHy}5/.N|PJf JfHy}8NX 9`pHy}G/.N|PJgHy}J/.N|PJf JfHy}MNX 9`$ n(HH/NXJgR .R/N X-@*yX` -HHf -f `*UfHy}]NX*yX`v -fj n (?f.&mxJgV n(fHS T/NPJfR`/-x .R/NPJggHyrNX(M*Ufg `" n (?fHy}i`Hy}]NXL8N^NuNVH8*n(yX`:g0g,Jg& ,fp0, g `f&L(Tf L8N^NuNV.X n/aX*@m *nN^NuNV.B.J9 gF f n0( f JhgHy}H/9hN|PJfp`B@HxN`8Hx N `,J9 gHxNXHxNXHyzNXNj.mJfN]TJg y (`N~-@aBB9R9 J9 gB9 HxNXJ.gp`B/HxNxPJ.gp`B/HxNxPJ m*BHxNxPBHxNxPBHxNxP/9 Hx`4 f0 n0( g HxHxNxPHxHxNxPJ oHnHytvHxN J mJm/.BNPJoB n0(gHxHxNxP n0(g(0(H/N2`/./aZPHxNX ..N^NuNV fHy}NXJfHy}NXN^NuNVH0J9 g Jg*n`BHnNX*@f,HnNX/HnHxNN HxNXHxHxNP(@HUN1 X)@ B#T#P)|P(BLHTaXL0N^NuNV.Hyq`N2X-@ @JfBX nJg8Hy|/N|PJfX nJf|`Hy}NX`B.*yPg8J.fJg /- /.aD`/- Hyw7NjPHy|NjX*mfHy}NjX*nN^NuNVH0*n(n HysHUN|PJg(HTHUNPJgHUNX" Ҁ/Hy}`HTHy}NjPL0N^NuNVH0BLX nJfLHyq`N2X*@JgJfHy}NXHUNXJlHy~NXHUN1 `` n/aX(@JgF#L/, NXJl /, NX y"H"i" y"H"Q#h`F n/a\X*@HxHxNP(@)M B y( y)h l T!L/9axXHTaXL0N^NuNVH0*nHUNX*@HUNXJg, /gHUHy~NPJfHUHy~"NPJfHy~&N3X-@gn @(P`d/HnNXPHy~$HnN0PHUHnN0PHnNXJm$#LHUN0XHnN1 X*@`zXJfHUN3XJgRHUN2X-@ @ /g @ .f4/.NXJm$HUN0X/.N1 X*@#L`HUN0XHUNX /gz y/( NX-@HxHUNXЮT/NP-@ y/( /NXPHy~$/.N0PHU/.N0PHUN0X*nHUaX L0N^NuNVH0#LX nJf~ y*hPf*yTfHy~-NX/- NXJl /- NX m U!m y*+y y P!M y `t n/a~X*@Jg/- NXJlT/- NX`F n/aHX(@HxHxNP*@+L B+y y* y U!MHUaXL0N^NuNVH8*n +gB`d&M`RHH/NXJfJfHUN2$X.Jo(y`((lPf(lfHy~@NXSJf L8N^NuNVH0#LX nJf*y` n/aNX*@JfHy~^NX Pf PfHy~lNXf.(mPf(yT/, NXJl /, NX m U!mfHTaD` HyaXXHUa XL0N^NuNV.*nJg B*`/- N0XHUN0X*nN^NuNVH0 n /gN*n`(MR /gRg HUHTNXP*LBRJg /f~BJfXSfL`JgRHUHTNXPS*L`dSf(`ZSgS /fJgRHUR` .fRB`0HTHy| N|PJgHTHy| N|PJgJg/Jf@L0N^NuNV.*n# M/( N1 X/Hy~N3PJLg HyaX*nN^NuNVBHy 0NPHy BNPHnHxNPHnHy aPN^NuNVhHnBNPHnhHxNPHnhHnaPBHnNPHy 0HnHnHy aN^NuNVH0*nX(]fHxN2XHxN2XHx`BJfFHytIHH/NvPJg,HxN2XHxN2XHTN2$X/N2XL0N^NuNVH<*n(n HTHUaPHlHmaP ,o+@ADC  @R.A&HA$H ћSnLaNXaJf Hy a:XY#R< (RDivide by 0Mod by 0!~(Expression syntax{{ ... }Missing }erwxfdzoMissing file name+-*/%()!~^|&>>==!==~!~@(#)sh.func.c 4.9 83/03/30%job%job &Too few argumentsToo many argumentsCan't from terminalaliasunaliasToo dangerous to alias that/bin/login/bin/newgrp/usr/bin/newgrpNot login shellEmpty ifthenImproper thenSyntax errorNot in while/foreachInvalid variableWords not ()'eddefault'"then/endif not foundendsw not foundend not foundlabel not found-n%o Improper maskcputimesecondsfilesizekbytesdatasizestacksizecoredumpsizememoryuseNo such limithoursminutesmegabytesunlimitedImproper or unknown scale factorBad scaling; did you mean ``%s''?%s %d %sCan't suspend a login shell (yet)Switching to new tty driver... @(#)sh.glob.c 4.5 4/11/83`{[*?noglobnonomatch{}Unknown user: %sMissing ]Arguments too longPathname too longUnmatched `` ... `Too many words from ``@(#)sh.hist.c 4.4 12/30/8210-r%6d @(#)sh.lex.c 4.3 4/2/83# '`" ;&<>()| Unmatched "'` Expansion buf ovflo:^$*-%Bad ! formNo prev sub Bad substituteNo prev lhsRhs too longBad ! modifier: Modifier failedSubst buf ovflo-$*Bad ! arg selector(=~: \ }No prev search: Event not foundReset tty pgrp from %d to %d ignoreeof Use "logout" to logout. Use "exit" to leave csh. @(#)sh.misc.c 4.1 10/9/80i=%d, j=%d: Out of memory /usr/bill/cshcoreUndefined variable@(#)sh.parse.c 4.1 10/9/80Alias loop;& Too many )'sToo many ('s<>()Badly placed (Missing name for redirectAmbiguous output redirectCan't << within ()'sAmbiguous input redirectBadly placed ()'sInvalid null command@(#)sh.print.c 4.2 12/30/82%d:%d%d@(#)sh.sem.c 4.1 10/9/80nicenohupNo more processes/dev/nullnoclobberCan't make pipe%s: File exists@(#)sh.set.c 4.1 10/9/80Missing )histcharsSubscript errorBadly formed numberNo more wordsWarning: ridiculously long PATH truncated @(#)sh.proc.c 4.8 (Berkeley) 83/02/23childnotify BUG: waiting for background job! BUG: process flushed twice( | ; << < >> > ...[%d] %d[%d]%s %c %5d %-21sRunning Exit %-16dDoneBUG: status=%-9o | (core dumped) (wd: (wd now: ) -lUsage: jobs [ -l ]%s Bad signal numberUnknown signal; kill -l lists signals%s: Already stopped Arguments should be jobs or process id's%s There are stopped jobs%%%+No current job%-%#No previous jobNo such jobNo job matches patternNo job control in this shellNo job control in subshells@(#)sh.dir.c 4.2 2/23/83dirsUsage: dirs [ -l ]~%sNo home directoryCan't change to home directory./../cdpathNo other directoryDirectory stack not that deepBad directoryDirectory stack emptycwd%Uu %Ss %E %P %X+%Dk %I+%Oio %Fpf+%Ww%d%%%d.%01d@(#)alloc.c 4.2 2/23/83assertion botched: %s allocp>=allocs && allocp<=alloctallock()q>p&&qalloctp>clearbusy(allocs[1].ptr)&&p<=alloctp->ptr > allocp && p->ptr <= alloct%6o %5d %s BUSYFREE%d used, %d free, %ld end @(#)sh.init.c 4.2 8/20/81@allocbgbreakbreakswcasecdchdircontinueelseendendifendswevalexecexitfggotohashstatkillonintrpopdpushdrehashrepeatsetsetenvshiftstopsuspendswitchumaskunhashunlimitunsetunsetenvwaitwhilelabelHUPHangupINTInterruptQUITQuitILLIllegal instructionTRAPTrace/BPT trapIOTIOT trapEMTEMT trapFPEFloating exceptionKILLKilledBUSBus errorSEGVSegmentation faultSYSBad system callPIPEBroken pipeALRMAlarm clockTerminatedSignal 16STOPStopped (signal)TSTPStoppedCONTContinuedCHLDChild exitedTTINStopped (tty input)TTOUStopped (tty output)TINTTty input interruptXCPUCputime limit exceededXFSZFilesize limit exceededSignal 26Signal 27Signal 28Signal 29Signal 30Signal 31Signal 32%Z%%M% %I% %G%0123456789ABCDEF0123456789abcdef0x0X(null)NVJ/ n/R##HyHyXN&P=y-y`HyZNX#f Hy]aXHy y/NPHytNX09ܰyfD 9ްg/9NX#Tf HywaX yT f`V/9NX#Tf HyahXHy 9TP/N&P 9f09yf/9NXa^HyHyN&P 9ްf09ܰnfS/9NXJl HyaX 9N^NuNVJ/H~ 9TPRЇ @Jf 9ЇT n 9R,` 9І @ Їй"@PSJlJm 9Ї @/ йR# 9й @BS` 9TPЇ @ 9Ї"@`JlLN^NuNVJ//.NX//.HxNN HxNXN^NuD/<%N@dNXBNu/<'N@dNXNu/HxNX-@HyVtNXJg8/.HxNxP/.NXN^NuNVHxHyVtNP`PJg" .c .`-n-|HzHxNxP-@/.NXN`N^NuNXHxN@eNuNXHxN@eNu o HBNu o /L.NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.Nb8X+@f,mJf,0-g-HHV+@`m+n f09 gHyNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9l  @*PJgBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVH *nB`RJf L N^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.N8P.JgJm/NrXHx` afvJgp`p//.NP.lB f6Hx/.N8P.Jg Jm/NrXHx/.NP.Jm.HxB/N^ `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNXHxN@eNuNXHx!N@eNuNXHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NrXB`Hx Nb8X*@Jg*B L N^NuNXHxN@eBNuNXHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNXHxN@eNuNXHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNXHx6N@eNuNXHxN@eNuNXHxN@eNuNXHx N@eNuNXHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHy*D/9*NPJl&HyHy,NTP/9*NXa4Hy/9* NHy*/9* NPJl&HyHy,NTP/9* NXap09*J @f$p09* @f/. NX`Na*nN^NuNVH0*nHUNXR/NX(@fHy"Hy,NTPaDHUHTNP L0N^NuNV . m . N^NuNV . n . N^NuNV/9*8NX/9 NxXN^NuNV./.NX*@g `a`*nN^NuNV./.NNX/9 NNXHxNX# /. /.NxP*@fa *nN^NuNVHy;Hy,NTPa@N^NuNVH0 *$fHytHy,NTPNL *$f$J*4fJ gHyHy,NTPB9*HyHy*NP~`RHy й*( @/NR`J*4g\J g*`L/9* /9*Hy`d .İgf/.aXJg/.aXJfLJ g/.N2X/.`\J*$g *$f/9* /9*Hy1`/.N2X/.N2X# J g Hy*an`` *$f/-HyPNP`"/9* /9*Hy*HyhNBa&X *$fHyqNXL hN^NuNV#dHyNFXJg/9* /9*Hy/9*NǴHnN>XNV-@ fHyHy,NTPNLJfjBN2X/.NjX/.N2X/.N2XHy\HyfNPHy\HybNPHybNXNLNV-@ fHyHy,NTPNLJfrJg0HxN2X/.NjX/.N2X/.N2X/9*(HyLNP/9*(HyHNPHyHNXNL/.N2X/.N2XHnNXfHnNX fN^NuNVH BB/.Nn HxHn/.N . mBA <C"Q g g  g `g B` A*HSlpL N^NuNV.*n .fp`J*3n `" 9342o й3834`B"ҹ3 A R34o ."HA HABAЁй3*@`$ -й3"ҹ3ҹ3 A -`JfL N^NuNVHHy/9*NP#3 f/9*NXNLHy/9* NP#3f/9* NXNL| y2B"y30"BB-n~34nn й3 @Jf BaXѮ й30 @ ` й3 @lHxaXѮ й2 @ R`/93 NX@ y3 S m y3 (R!@S @`/93NX@RRJ*0g.HH @g.HH @g . g\R y3 S m y3 (R!@S @`/93 NX@.HH @f . g\R y3 S m y3 (R!@S @`/93NX@.HH @f..gdR й3 @B . g Ba"XѮ . gHxa XѮ й30 @ й2 @ RR` . g y3 S m y3 (R!@S @`38n"HxaXѮ й2 @ R`/93 NX/93NXLN^NuNVH ~` S, H@H@B@ހ o rN,` . -@~`p Ю-@`V Ю*@eP n -nBf n6 n-h!m+n n-P * 瀑 .bRo`jJftL N^NuNVH . R/NpX*@~`$ Ю @ Ю"@ " Ҁ"A"R o~` " Ҁ A Ю"@"R oHUNNXL N^NuNV.~ .3 @ P S m( .3 @ P (R!@S @` .3 @/NX@ g J.mR` ..N^NuNVHHy/9*NP#3 Hy/9* NP#3-y34 y3B 938R".Rҹ3 A *$g~o*`h й3 @ Sй3"@ R"fRo Sй3 @ R-@ S,` Rй3 @JfRm Rй3 @ S* й3 @ //.//a| R.`V..` й3 @ Rй3"@ S"f й3 @Jg S l Rй3 @ S-@ R,` Sй3 @Jf S n Sй3 @ R* й3 @ /.///a S. l|Jf/938HxBHxa *$ft y3 S m y3 (R!@S @`/93 NX.Jm4Sm"9R AHH`Hy/NpP`LN^NuNV *$g . o .nJ f# *$fx/9*HyNPHn/9*NP/9* HnN,X/HyN Hn/9* NPHnN,X/HyNP . n .n|c` . npd`pa@ *$fP .*/HxN6P-@ . й*//934N P-@ .*/HxN6P-@ .й*//938N P-@HyNXHy/./.aN HyNX .afHy/93 /./.`rHy/93 .S//./930aJ .cf < ` <//93 /. /./930aHy/93 /. . R//930aSm 9R @ HH`HyHx NpPHyNXHy/./.aJ HyNX .df&Hy#/93/././92a``Hy&/93 .S//./92a6 .cf <)` <,//93/././92aHy//93/. .R/`z 9*$ gJg g\J*$g *$fVHxHy2/93 /. /./930a . n& .nJ*$fHyHy5NPBJ*$fv <:`rHy>/. /.a Sm6 . opa` .opd`pc"9R AHH`.Hy . opa` .opd`pc/NpPJ*$fHy@/./.aX Sm 9R @ HH`HyHx NpP`Sm6 . opa` .opd`pc"9R AHH`.Hy . opa` .opd`pc/NpPHyB/. /.a Sm``@ <=//93/././92a *$g *$f .nHyHyDNPJ g"/9*HyGHyNT B N^NuNV . o . ` ./HyRNP . l/. /.HyUN N^NuNVH y Jgp`B y Jgr`Bgp`B-@ *$fJg/.NtX-@ . o .` . SЮ @ *B`SmL n S m n (R!@S @` /.NX"9R AHH`DHy n S m n (R!@S @` /.NX/NpPRmb . n *$fJ g>/9 Jg f <f` <h/HyZHyNT`hJg,# *Jg/9*Hyi`4/9*Hyu`&Jg 9 ` 9 #*/9*HyHyNT .R# .. `B SЮ @//.N` Ю @ "SҮ A* *$gHy/.NPB`SmL n S m n (R!@S @` /.NX"9R AHH`DHy n S m n (R!@S @` /.NX/NpPRmbRoJ g*J f"/9*HyHyNT B LN^NuNVH-|BJ*0fhB n S m n (R!@S @` /.NX* g fB` rN4."Ӯ^`B n S m n (R!@S @` /.NX* g g0 g, g Jg^B rN4."Ӯ^`R` .r".Ё-@rH".HЁLN^NuNVH BB/.N` /.HxHxHnN. mBA <C"Q g g  g `g B` A*HSlpL N^NuNV/.aX/aXN^NuNVH HnNZX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN:" L N^NuNVH n "<QN:-@ n "<QN-@Jl QS*|S .r`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *|0 9SLDl L @*PJgHxN HUNX/HUHxN HxHyAHxN L N^Nudlv.>P\r )8P]s‚Ž¡²<MlÃÚô$;Zjāĥ-NpŅŘź$Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#SLp`T .ST @(P .ST @ gf ` <h//.Hx0Nǔ `NqL0N^NuNV/9Hn /.NF N^NuNV/9/. /.NF N^NuNVA -H .X @Jf n/Hn /.NF N^NuNHx;N@eNuNHxN@eJgBNuH // |ST pNLNw //W.BN@d W/N WNNVA-HA#3D=|B-n-|Hn/. N PSm .R @BHH`HnBNpP .N^NuNV4.-nBT0`b y3D S m. .R @HH y3D"(R!AS AHH` /93D .R @HH/NpPRT0 nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|`-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|a PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|c`J.g-|eJ.g"/.NX".-A< o-@ .Xf -|gL`-|xLA`-H-H`P .P-@@ .P-@P".DN:ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N|PJf/./.NPJfHnHn .R l .R`p//./.NԄ-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9L/9H .".NgP .S-@HJlD-@HJHg6 .Hr N:0S n .Hr N`S n0A .ذbJn/9T/9P .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N|PJf/./.NPJfHnHn *LZ`0SR`*0T4b1 nRJfT4c0R 9nB <T4L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9*HH/NXJgm+| +| +n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N2XJl~0-g /-NNXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|` eB` 0,f -+fp`B, wf0Hx/.NHP.JgJm/N2XHx` afvJgp`p//.NFP.lB SLf6Hx/.NHP.Jg Jm/N2XHx/.NFP.Jm.HxB/Nn `Jgp`B//.NFP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NF N^NuNHxN@eNuNVH N.*nJfS` r N40 r N.S XgR|a` zf < ` RB/.NP f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N\PJlB`pN^NuNVH B/.NFP. g `/N2XB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHx N@eNuNVH0JTf8 <T#T <T#T#TT#TT .^rN.*yTBT g`(*(U g " Ҁe " Ҁd(M *@bTfTgB`RT To "<N#TBNNX(@ 9T" Ҁe 9T/NNX(@g yT 9TXg yT  9T" ҀY(#T <T A ` " Ҁ#TTc A#T A 9T*A L0N^NuNVH0*n(MY#T (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ T L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL ,, . #endif %s %d%s%d#else %s%s !#ifndef %s #ifdef %s #ifdef %s #endif %s M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ /@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83Tb[ lٹ **by  $," hp$G"I#HTHS/N4 /NXNuNuNV.-|HyNXB8-|$` nHH8 @R nJf-|9` nHH8 @R nJf#-|`P .Ю @Jg< .Ю @ P -g( .Ю @/NXJg .Ю @BR .mHyDHyBN>PB-|` .Ю @Jg .Ю @ P -f-| .Ю @ Ю @Pg~ nR.HHS !b:@0;Nz................D...n....Vb#R`b#`#`#`B`#`#`#`#`#`S .S".mHyFNX .RЮ @/aXJg .RЮ @/HylNP .RЮ @BR`"HyHy{NP` .Ю @BR .m nBRHyHyN(PJfB9HyHyN>PJfHyaXJg HyaXJgBaXHyN>XJgRHyN>XJg #HyN>X*@Jg#JfHyHyTNPHxHxNtP#HxHxNtP#HzaXB-|`^ .Ю @-PgH/.N>X*@Jf/.N\X*@RHnBHUN Jg HxaXR .mJf>JfHyN`&HnB/9N Jg Hxa.XBNX*nN^NuNVJgJfzJfrHyN~X @-hgZHn/.NPJmFp0. f2/.afXJf&/.HyHyTN /.N2XJ9gHyN2XHyHyTNPHxNXN^NuNVH8HyN>X&@Jg<*k`.(m` l/(/.N(PJfp`(Tf*UfBL8N^NuNVJf/.HxNtPJf/.HxNtPN^NuNV 9 R JfJfBaFXHy/.N(PJfHy,`/a"X`Hy/.N݌P-@fpN^NuNV#0BB,NJgHyNXJ0g/90NԆXBN^NuNVJgDHy6NdX-y`& n/( h/HyINd n-PJfJgHyRNdX-y`$ n/(/(Hy[Nd n-PJf-y`$ n/(HyeNdP nJgHyjNdXJg np( /HylNdP .fHyvNdX n-h` n-hgBHyNdX`, nJg n h/(HyNdP n-PJf n-hg4HyNdX` n/(HyNdP n-PJf n-PJfd n-PJfHyNdXHy@NXN^NuNVdH8*nf nBB`,Jg&/. /-HyNd Hy@NX- g n -  `fp`BBBB/-NP/.pNX/HyN>PBpJf/+alXѮBHyN>P#N-@-|`X-@gHnX/.tHnNl /N>X-@gHn . R//.a Ѯ .䰮l n/(/.pN|P-@pJg/. n/(HyNd .o-@HnHy(N>PHnXNX/Hy*N>P n-h` n-PJg n-hgJf .䰮mJfJfJob .`b n-PJf n-PJfHx/HnNPAЈ/Hy,N>P n-PJf&S`N-@/-Hy.N>P/.pNX/Hy0N>PJg/.`/.avXѮ`Jf- fzHy2N>X-@g4/-Hy;N>P n-hJgD n-hf-P`Jg/-Hy=NdPR`/-HyXNPBHysN>PJf/-NJgJ f /-Hyu`JfJ fJf/-HyNdPJgJ fJop`B/NXJgp`p- 눁- .మo-@+n n .L8dN^NuNVHRJgB`JgHyN~X @-hJf/.HyNdPJf/.HxN\P` n -f -|`-|R n -g @g/././ab JgJfJgp`DBNX n-PJg8HnH n/(N-M`0-M nBHn|Hy?/.Nl -@ .R-@BB-yJg6 n/(/.N(PJfJ n-hJgB/.NPJft/.NX-@ m-|`N n-P`RHx NX-@ @ # n!n/.NX n!@JfT/.HyAHyTN HyPNXJg n/Jg/.N`XB .`/.NX-@ fHnNX/N\X-@ J g\HxNX-@ @  n!n -n`2B`6 .np`B n (HH.nr`B-GfRR n HH.g4  -g ]fJg`R /. /.a`Jfp`BLN^NuNV n Jg nJg/. R/a@PJgp`BN^NuNVJgJ8g|N/NX-@HnNXHy\/.N݌P-@gDHnNX-@ @B( .X/ n/Hy^/.N/.NԆXN^NuNV-n`R n (fB/.arX n(R n (f-|-|R` B-|A-HA-H` nJg* )g$"nRR .d ` nBR .e`JgaX 9qr N6-@B .l/9HxHx HyqNp9qgfR, <` y, ;f /aX`*y,A<(H`HH8 @g,g6BHnX#fHn/9 y,HH/HH/Hy lHyTNBNXBL04N^NuNV. .R*@`R  g  gHxNX-@ @BJ0f ` HUNX n!@#B, <*nN^NuNVH0B.B,J0fR 9X @-Pg6R`V y0 S m y0 (R!@S @`/90N0X-@* g g g6 #g" ;g-`λyf-|.`J.fB*`Ryg -\gB`| y0 S m y0 (R!@S @`/90N0X-@* g *g *f *fR` *fBBB`:-|y*n \eHy NX n  f /aX`HH @f$HH @f  g .f. .R*@Jg" :g =f/.NX <`(|y` ;gRJf-L2T7BHn8HyyNJy hoNSy h`D0H : @< FfPJ `la# `lB `$| ``X Rf0*GfXJRm 0H `f<*lB`JFf"09 hH b@0;N0H @0H〙*K0H @0H倗A#=F0H @<0H @0H2HЁR=@ nl*0.H l @>0H  @0D@2@g0H @0H l @>0.H[ b@0;N(v`Hy NNXR d3 h`n0H @0H<JFm< Fl60H l @0H  @ Pf0H l @>`J0H @<UYAԹd`>J `g4# ``8 yp( yg$ y/(Hy HyTN ` yf y h .gJg y#8 y8JgJg y/(Hy HyTN y8#8` yJf!y8Sym@ 9yq @# y( f 9y( 刁( Hx NX#8 @B y8!m y8!UHy y/(N(PJfZJfR yB`Z y#` y# yJf yf y h .f yB y 8`#q#y`2 9yq @ Ry ym Hy NX`/9HyHnND HnHyNP`ByB`HxNX# @B y!UJyf #` yy #y`l#y`^#y`P#`F##q`6# yq `LHxNX-@HyNXJg8/.HxNtP/.NXN^NuNVHxHyNP`PJg" .c .`-n-|HzHxNtP-@/.NXN`N^NuNLHxN@eNuNLHxN@eNu o HBNu o /L.NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN0X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n,f +|H`D/.N`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNVH0*n Jm m#*LZ`0SR`*0Lb1 nRJfLc0R 9nB <LL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NB .B`T0-f(mfHn-HH/NPJmJn -|`-n@f9RHH/NXJgm+|6+|6+n 0-gl(m m R Э "-d f -,/HT-HH/NB .+L`/.NBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|,`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N2P.lB N@eNuNVHn/.NPJlB`pN^NuNVH B/.N2P. g `/NXB`Hx N*?[]:$`'"\ :;&>|$$No description argument after -f flagCannot open %sUnknown flag argument %s-MFLAGSmakefileMakefile.IGNORE.SILENT.SUFFIXESNo suffix list. No arguments or description file@ *** %s removed. .PRECIOUS-rDescription file errorOpen directories: %d: %s Macros: %s = %s %s: done=%d (MAIN NAME) depends on: %s commands: %s @(#)main.c 4.5 (Berkeley) 83/03/18doname(%s,%d) TIME(%s)=%ld @?@Too many command lines for `%s' *TIME(%s)=%ld *<*@?.DEFAULT<Don't know how to make %s Don't know how to make %s@`%s' not remade because of errors `%s' is up to date. @touch(%s) %s%s *** Error code %d*** Termination code %d (ignored) @(#)doname.c 4.2 (Berkeley) 83/03/26Hash table overflowout of memoryout of memoryinfinitely recursive macro?@*<?Warning: %s changed after being used Make: %s. Stop. Stop. line %d: %s$? list too long @(#)misc.c 4.2 (Berkeley) 82/10/19,:BJRX^dlt{29IPf  - 9 H O d            # + B Q h       : F O d q./Directory %s: Cannot openaUser %s, %s rcannot open %s! %s is not an archive%s is not an object module@(#)files.c 4.6 (Berkeley) 82/11/26.SUFFIXES : .out .o .c .f .e .r .y .yr .ye .l .s .cl .pYACC=yaccYACCR=yacc -rYACCE=yacc -eYFLAGS=LEX=lexLFLAGS=CC=ccAS=asPC=pcPFLAGS=CFLAGS=RC=f77RFLAGS=FC=f77EFLAGS=FFLAGS=LOADLIBES=.c.o : $(CC) $(CFLAGS) -c $<.p.o : $(PC) $(PFLAGS) -c $<.cl.o : class -c $<.e.o .r.o .f.o : $(FC) $(RFLAGS) $(EFLAGS) $(FFLAGS) -c $<.s.o : $(AS) -o $@ $<.y.o : $(YACC) $(YFLAGS) $< $(CC) $(CFLAGS) -c y.tab.c rm y.tab.c mv y.tab.o $@.yr.o: $(YACCR) $(YFLAGS) $< $(RC) $(RFLAGS) -c y.tab.r rm y.tab.r mv y.tab.o $@.ye.o : $(YACCE) $(YFLAGS) $< $(EC) $(RFLAGS) -c y.tab.e rm y.tab.e mv y.tab.o $@.l.o : $(LEX) $(LFLAGS) $< $(CC) $(CFLAGS) -c lex.yy.c rm lex.yy.c mv lex.yy.o $@.y.c : $(YACC) $(YFLAGS) $< mv y.tab.c $@.l.c : $(LEX) $(LFLAGS) $< mv lex.yy.c $@.yr.r: $(YACCR) $(YFLAGS) $< mv y.tab.r $@.ye.e : $(YACCE) $(YFLAGS) $< mv y.tab.e $@.s.out .c.out .o.out : $(CC) $(CFLAGS) $< $(LOADLIBES) -o $@.f.out .r.out .e.out : $(FC) $(EFLAGS) $(RFLAGS) $(FFLAGS) $< $(LOADLIBES) -o $@ -rm $*.o.y.out : $(YACC) $(YFLAGS) $< $(CC) $(CFLAGS) y.tab.c $(LOADLIBES) -ly -o $@ rm y.tab.c.l.out : $(LEX) $(LFLAGS) $< $(CC) $(CFLAGS) lex.yy.c $(LOADLIBES) -ll -o $@ rm lex.yy.c 4/bin/shsh-c-ceCouldn't load Shellbad wait code%s: Too many arguments.Cannot load %stouch: file %s does not exist. Cannot touch %s @(#)dosys.c 4.5 (Berkeley) 82/10/19D        Bad character %c (octal %o), line %dline too longyacc stack overflowsyntax errorInconsistent rules lines for `%s' Multiple rules lines for `%s' .SUFFIXESToo many lefts%dMust be a separator on rules line %s@(#)gram.y 4.1 (Berkeley) 81/02/28M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shPATH:/bin:/usr/binsh/etc/passwdrr@(#)seekdir.c 4.8 4/13/83@(#)telldir.c 4.4 4/13/83-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83b[ lٶ h,[,[by(08@HP. Xh$G"I#HTHS/N4 /NèXNuNuNV#aP# q#aX4\#Iq 90#a8#44` y4` l#4#pM#QI#Ia<#.|I 90#IBq BB#q$I#a\q#Id#q aPf0BNèX`"@0;N"`R4h` 9aPSaPJn HxNèXHyXq yq/NP#a@f* yq/HyHyN( HxNèXaL/9a@N&`RRaLa2BaL`dRq`\Xq yq P -fP yq P(HHe c yq P(HH/HyHyN( SaPnJ9aHf(YqRaPRaLaXqSaPBaLJg HyHyN(PHxNèX y0!y4`aJaPn$BNXHyN&XBNèX`"SaPm 9qXq @/NX`N^NuNVH8aH(yqHyq$aXJm 9#q$f8 9nq%f #4hHyq$aXJl y4`B(#q`#q$a0`Ra0`HyHyN(PHxNèX`f y4`*PB` y4`(P ya0 ,g ;fRa0 y4`!M Ic(Hyq$HyJHyN( HxNèX y4`/(a X*@4\gf(Hyq$Hy4HyN( HxNèX y4`f!L` y4`(h` y4`BIc0Hyq$Hy HyN( HxNèX`Ra0 ya0  g  g ya0HHRa0 lgn x Pgn  Dghn :gn !g(Hyq$Hy HyN( HxNèX y4`|`x y4`| y4`J(fp`B y4`@ 94`P"94l A R4` 94`a f&,fHTHUa2PJg #Ip`Jg`HTHUaPJfJfBL0N^NuNVH8*n(n HHS bv@0;N(x4pL:j:@jjjjj`gB`\Jg`Jf`#Ip`D@.HH" Ҁ AHH. AHHg`RHHI @ `<HHI`HHI @-PHHI @ -@/HU/.a Jg2`HHI @-PHHI @ -@&M`/.HU/.a Jf`HTHUazPJfd`&MJf`R&MgR`F&M@.HH" Ҁ AHH. AHHfSg f*l.fHTHUaPJfR MSb`. f<,HHI @ PP.fHTHUaPJf MSb`aDgHTHUaPJf MSb`SHH/HyHyN( `XL8N^NuNVB n/(a|PJfB`P#a, n/( a@X nJ(f$`,Hx n/(a@PJg n/( aX yIJfpN^NuNVH8*|q$(|Q&n`ݻIe`4 .fX .a,eHyHyN(PHH-@gn &f/9I/9IHTa (@` 1m :l .1I @/ .1I @/`*yI Qq$#I`a,eHyHyN(Pf*|q$(|QfA#IL8N^NuNVH8*n(n &n`ܻa,eHy+HyN(Pe L8N^NuNVH8 n(HHS bP@0;N6zX\L>DDD"D"^| yq Xq Idqe/9q HyBHyN( yqB`#I nJ(g Ja4g n*h`<HH"9R AHH`SlHyHH/NPJfSmX 9R @ HH`>(|q$*L  gJfRI`"RfA#IR`/9q HycHyN( `*|q$(|a\fA#I` yI RI*yI(|a\gһ4e`*|a\(|q$fA#q` yq Rq*yq(|q$gһMe` n*h`<HH"9R AHH`SlHyHH/NPJfSlHyHx NP`*|q$(|QB9Q`&|`.Ie&\HyQHyhHyN( (|Qf` gݹIez\HyQHylHyN( (|Q`R  lHHS\ @&P`.Ie&\HyQHypHyN( (|QfSRJfBHyQHyt`J4hf*|q$`>SmHH"9R AHH`HyHH/NPRIeSm 9R @ HH`HyHx NP IqcaHyq$a^X-@4\f##I`0#I`$ Iqca@ yI RI/9IaX-@4\f`*|q$`>SmHH"9R AHH`HyHH/NPRIeSm`6*|q$`@HH"9R AHH`"Jg$SlHyHH/NP  fSm4`J4hf*|q$`>SmHH"9R AHH`HyHH/NPRIeSm 9R @ HH`HyHx NP IqcaHyN&XBNèX yq Xq Idqe/9q Hyx`j/.aX. nJ(g|Jgx (f*|q$`>SmHH"9R AHH`HyHH/NPRIeSmB 9R @ HHJg nJgHyq$Hy n/(`HyHx NP`Ja,gvBa,#`d*|q$(|Qf*|a\(|q$fA#I*|Q(|a\fA`*|q$ n(h`RHH" Ҁ AfL8N^NuNVH0*n(y4de8HxHyM/9q N~ .n 94\`(|M Ќ#HH. fheNHxHyM/9q N~ .n /9q NZXJaPf #a4(|M Ќ#Rq B#4d `JgD4d:`2L0N^NuNV .SJg .R @". R AgB`pN^NuNV.#Iq`T yq P*h`<HH"9R AHH`SlHyHH/NPJfSm 9R @ HH`HyHx NP` yq P (ghHy yq P/(NP-@g n S m n (R!@S @` /.NhX-@ gJnSm .HH"9R AHH`Hy.HH/NP`x/.N&XXq yqJf&#Iq yqB*nN^NuNVA-H#Hn/. NPP n0( gp`BN^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N&PJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HH+@`m+n f09gHyNvX0-gp` - //--HH/N~ *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|`deB` 0,f -+fp`B, wf0Hx/.N P.JgJm/NZXHx` afvJgp`p//.NnP.lB f6Hx/.N P.Jg Jm/NZXHx/.NnP.Jm.HxB/NF `Jgp`B//.NnP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nn N^NuNHxN@eNuNV(.-nB`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N&PJmJn -|`-nf9HH/N0XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXde*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NZXJl~0-g /-NϊXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N0 n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NͨPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JPf8 <T#P <P#T#T\#PX .^rN.*yXBd g`(*(U g " Ҁe " Ҁd(M *@b\fPgB`Rd do "<N#dBNЊX(@ 9d" Ҁe 9d/NЊX(@g y\ 9\Xg y\  9d" ҀY(#\ <P A ` " Ҁ#XXc A#` A 9X*A L0N^NuNVH0*n(MY#X (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ ` L0N^NuNHxN@e#hBNu /йh/@HxN@e 9h#hNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL- \13\14\15\16\17\20\21\22\23\24\25\26\27\30\31\32\33\34\35\36\37-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$dhb[ 1lق pby*.by4<DLT\d X;$G"I#HTHS/N /NXNuNuNVH8(n o l -f*H $`x&|0`gRJff 0< @  $`B cf& oJ f# )TXS`Hy n /(NPRJf)TS&|0-| 4`( 0< @  $g nRRJf nBR .L8N^NuNVH *nB`RJf/9KTa6X//.axP#KT S# d/Hy N|PL N^NuNVH8&ng*(SSf"A*H` /NXXJfHSNX L8N^NuNVH8 .  /NX*@(n&M+|A*H# ` /NX* . S JfB L8N^NuNV/9 \aFX# \fNJfN^NuNVJKTg( yKTR yKT  \#KT \ 9 \`BN^NuNVH0 .^.B*y h g&(M *@b .RJg/aNX`*(U g e Ї# h hc @ 9 h*A L0N^NuNVH0 9 L dgJ y dBR d 9 dV*@ 9 LY(@( (# (  yl #l 9hѮSF#l h 9lЮ yl #l @ K 9lP*@HU/9NP# d## LL0N^NuNV.*ngldY*nN^NuNVBN^NuNV.Hx NhX*@ . *+n B *nN^NuNV.J gJfa`Hx NhX*@*+n +n *nN^NuNVH0../. aX*@  f$ . g0#; Hx NX`f . far 9 &g ;g gJg/a X L0N^NuNVH /.aX*@f. L N^NuNV.R9 .ga6` & f`p`^gHUHxpaP*@`a . //aP(@JgfHTHUHxa *@`P gF`6B.f | fTHxaXX/HUJgp`p /a@ `$NHxa(X*@Jg` ^ g | fHHxaX/HxaP/HUHxaP/Hxa `B`BaBX(@` *nN^NuNVH ..a 9 gHx NhX*@B`N y D * DJ fN )g | gab | gHxBa|P+@ ; f/anX+@` /aXB L N^NuNVHaBa4X+@  g ; ga$/9 NXaVHxaXHx  f <!` <(/aP+@`Hx NhX*@  fp`p*HxHxaP+@HxHx!aP+@`XHxHx(aP*@`DHxNhX&@HxHx)aP'@&HSBa `B-|HxNhX*@+LA$H`J&y DJ gJg &-K`$$K 9 $ -@NJ. g /-aHX+@J gB+n B Lg g .L N^NuNVNJga@N^NuNV. . . g `aHxNhX*@ 9 DX+@* g+y  # N/.a6X+@ `hJ Xf > f@`BNX &f `n >f `^HH# `H . gaH..N^NuNV. .g*|` -gPJf/NX*nN^NuNVNrHyNX 9 $ f HytNX y/(NXHyVNXHx`NXJ gZ/9 aP`^ f Hy\`j .g /.NX f Hyp`>/.N`6 9 DX/NXHx'NXHyhNXNPHxN XN^NuNV/9 Hy N|PN^NuNV9 0gHxa`XN^NuNVNr/.NXJ gHyVNX/. NXNPHxaXN^NuNVB/.aPN^NuNV# 9 $p ga`NBHxHy $NPN^NuNV.*y gB BHUNPBaX/9 NX*nN^NuNV` y /(NX y #  9 bN^NuNVH$y # Jg"B`HxHjajPѮ$Rf n/*n`gHH`p/f .Lf 'f"`$ 'g&HHHH/NXaf"BaXXfHHx @>gHUNX*@-f-HH @@fB HH# J-f-fHH @g >g N@eNu@(#)crt0.s 1.2 (crt0.s) (SUN) 1/26/83xnvtsierku Knewline @ "2@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@//tmp/sh- t VERSION sys137 DATE 1978 Nov 6 14:29:22 bad option(s)you have mail no spacesyntax errorbad numberparameter not setbad substitutioncannot createillegal iorestrictedcannot make pipecannot open - core dumpedarg list too longtext busytoo bigcannot executenot foundbad file numbercannot shiftbad directorybad trapis read onlyis not an identifierPATHHOMEMAILFILEMATCHIFSPS1PS2 :/bin:/usr/bin: -end of file unexpected at line /dev/null+ > $ # .profile " %)!.17:$?DILRT(V]bvexportreadonly   n f# ) 28=BHinesaccasefordoneifwhiledothenelseeliffiuntil{}HangupQuitIllegal instructionTrace/BPT trapIOT trapEMT trapFloating exceptionKilledBus errorMemory faultBad system callAlarm callTerminatedSignal 16cdreadset:traploginwaiteval.chdirbreakcontinueshiftexitexectimesumask<*4P8h$=/bin/csh/bin/cshptrace: @@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83K b[ Nlٺy *7*7by ?#!/bin/sh exit 1 b[ Plٺ *@*@by #!/bin/sh exit 0 b[ Rlٹ `*I*IbyX`hpx# X?$$G"I#HTHS/N4 /NDXNuNuNVH B`>Hx N @/NP gHz N @/NPR N @Jf la n *hJgHHa b~@0;N000Ptttt0tt0h0tbnDt\00tVHH @RR`HzaLX`HzX`Hz`Hz`Hz`Hz`Hz2`HH/Hy8HyN Hxa`J9Kg#M^#Tb#\fJ9HgR9AJ9@fJ9Ag4#d n /(aX# X S la n #  # 0 .W# J (f6J9Tf&/9FHydHyN HxaXHzba X y (Na/aXL N^NuNVJ (g&/9FHyHyN HxaX# (N^NuNV.aad`J g/9 HyHyN HxcarXHx/9 /9 8a < `hajJ ga Jga .JmJ9Tg 9  pn /NX`HxraXHxHx/9 8a /a Xa Jga..N^NuNVaaJgFaN`@HxdaXHxHx/9 8a `a gSo,Sm ,R @` HTNX. f gJo HT/ǸP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9/9 .".NŌl< 0NŒ///./. 9"9N@N-@-A`RHH. q @f .gZ`t/9/9 .".NŌl< 0NŒ///./. 9"9N@N-@-ASHH. q @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH. q @fJl D*܅-FJl D,B g(  @/(/ .".N@-@-AJg R mJl/./. .".N`/./. .".N@-@-A/.//N -@-AJl ` .".L N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|p`D/.NX+@f,mJf,0-g-HHO8+@`m+n f09gHyNX0-gp` - //--HH/N& *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9.pl  @*PJg*LZ`0SR`*0OPb1 nRJfOPc0R 9nB <OPL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|.+|.+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX Te*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NΚXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.N N^NuNHxN@eNuNVH Nʒ.*nJfS` r Nʴ0 r N.S XgR|a` zf < X` RB/.NʂP f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.Nv N^NuNV/. Hy@t/.Nv N^NuNHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNHx N@eNuNVH0JOf8 <O#O <O#O#OO#OO .^rN.*yOBO g`(*(U g " Ҁe " Ҁd(M *@bOfOgB`RO Oo "<N#OBNϚX(@ 9O" Ҁe 9O/NϚX(@g yO 9OXg yO  9O" ҀY(#O <O A ` " Ҁ#OOc A#O A 9O*A L0N^NuNVH0*n(MY#O (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ O L0N^NuNHxN@e# \BNu /й \/@HxN@e 9 \# \NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL ar: cannot create third temp %s ar: abi not allowed with q ar: %s cannot open ar: cannot create temp file ! ! ar: %s not in archive format ar: creating %s ar: cannot create %s ! ! ar: %s not in archive format usage: ar [%s][%s] archive files ... ar: %s does not exist ar: %s not found ar: %s cannot open ar: creating %s ar: cannot create %s %-16s%-12ld%-6u%-6u%-8o%-10ld%-2s` ` ar: malformed archive (at %ld) %ld%hd%hd%ho%ldar: cannot create second temp ar: phase error on %s %c - %s %3d/%1d%7ld %-12.12s %-4.4s ar write errormrxtdpquvnbail/tmp/vXXXXX/tmp/v1XXXXX/tmp/v2XXXXXM:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ T/O. 40 ) 3 =`F`O.W(`:xgxnt|$h.$4`FOLP PP<(D/`7`?|E"LQ„U^vaJdhmtz?Œ$âǜx0|~4džǎŤì!l&-J4\:4A\IƌOUƤZc8jxqx ?Ǻ¤ƠBƐƪnHƘ Ŵ,#H+H3ɤ<$DK.S\x|eʌnʜv ʜ<ʪf<ː3 0p̀A π@$.8<=LЦP[<_fnwD~4r0  `&<rF  $`,b +  L `#   c  ,  J"h+39  AfJS  Za  gn  tNZ|  R (C  ,bf<  0  4J  8Ox  @LWu4FFT^N%,ː4j8S? @DzHLP.W]aei \nhvz `dox+*jz;a^ d.D&x5  Oʺ?#F)0 92AH hPXx`:(ipnxvpsºÀ:ŒyŌ?@ p .p $ɤ .x(45`>rvDfPJpQHX®^dn  .vyΚ| T3i[`YšLQR:Z$ʴʂ pʒ  P v 0 #7 ,Ϛ 2 O 7φ *LZ`0SR`*0HXb1 nRJfHXc0R 9nB <HXL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nz .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|(<+|(<+n 0-gl(m m R Э "-d f -,/HT-HH/Nz .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nz . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nz g m p`BL0N^NuNV.*|t` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NBXBBBB BmB- L N^NuNVN8/.NXN^NuNV .". nJ/H?Nl n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|t`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N&P.lB HN@eNuNVHn/.N`PJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JHf8 <H#H <H#H#HH#HH .^rN.*yHBH g`(*(U g " Ҁe " Ҁd(M *@bHfHgB`RH Ho "<N#HBNBX(@ 9H" Ҁe 9H/NBX(@g yH 9HXg yH  9H" ҀY(#H <H A ` " Ҁ#HHc A#H A 9H*A L0N^NuNVH0*n(MY#H (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ H L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLCdKS[dm&ty.DL ,tDbh ?ZDf%@+j3:0@JGnLRYazhou8|TD$h..R< < 3 ( /06@=EN(Uh]ghqx{<N<tt~4r0 Q   D 9 f #.0,th3:  ? $E (M ,S \ B4d.tjbr 4z 8yB6L < nfF,$DNl? 8z#  (<+;2<3DKiRlY`_xDf[ls,yY:sZQRZ H<.&t`@7lB H .crt0.ocat.o_Sccsidfprintf.ofprintf.oprintf.oprintf.osetbuf.ofilbuf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_eflg_lno_nflg_fprintf_bflg__flsbuf_setbuf_vflg_copyopt_fopen_fstat_col_tflg_spaced_sflg__filbuf_stdbuf__iob_fclose_inline__pfile__print_free_read_fflush__sibuf_malloc__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_errno_creat_opencerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٹ ]6*Y*Zby 8?\ ,$G"I#HTHS/N4 /NXNuNuNVHx . /NP#Hx/.NP#(Hx/.NP#Hx/.NP#-| .lЮ @ P -f .Ю @ P(HHB 5bv@0;NXlXllllll llllllllllllll&l&lllllll.lllll .Ю @-P/.a X-@ cg sgJg, 9Tй( @ RTHxo/.a P-@/./9a PJg2 9Xй @ RX/.a bX ofRR`R R$`R .lЮ @#L/9La X cg of/9LHyda ^PHxNX`R`R`R4#zZ .Ю @ P (gf\#Z`N .Ю @ P(HH Ig mf#^`#^` #^`R` HfHyHyPNTP`#H` HfHyHyPNTP#H`RD`RR .Ю @ P (PfHyHyPNTP .Ю @ 9\й"@"R\`: .Ю @ 9\й"@"R\`J0gBHya P .Ю @ T#0 @Jf#0`JP#-@ y  y!yJg 9 ` 9 y!@#PJ4g 9Pй @ RPJHg2 Hf <` <"9Pҹ A RPJDg 9Pй @ RPJg 9Pй @ RPJ^g 9Pй @ ^RP 9Pй @B/9/9Ja8PJf|Jgv y  y!y  y!y yB /9/9NaPJg /9NNX-y #`/9 NNXJ f`J$fJXgB y  y!| y!yZ#PJLg` 9Pй @ RP 9Pй @ LRP`& .й @ 9Pй"@"R` .XmJHg 9Pй @ RP|-|l-|J^g y^hRAcRJ4g A_RApRABA 9Pй"@"RP 9Pй @BRP/9/9VaP8 Tf0 f$J8fHxo y(/aP/NNXaN^NuNV#d8aN^NuNVJfvJg/9NNXJg/9NNXJ fJg/9NNXJg/9NNXJ g/9 NNX/98NXN^NuNVJg <P` <<-@Hy/.NTP/. /./.NT n S m n (R!@S @ HH`/.Hx NPRR$R8N^NuNVH *nB` /gRHH,fW n o .fHH`BL N^NuNVH0/.a`X(@*L` /f(MJfn L0N^NuNVN-@ fHyNXpd`Jf`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH0*n Jm m#p`T .h @(P .h @ gf ` <//.Hx0N `NqL0N^NuHxN@NV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNhHx;N@eNuNhHxN@eJgBNuH // |h pNLNw //W.BN@d W/Nh WNNhHxN@eNuNVA-HA#`=|B-n-|Hn/. NPSm .R @BHH`HnBNP .N^NuNV(.-nBF`b y` S m. .R @HH y`"(R!AS AHH` /9` .R @HH/NPRF nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@*LZ`0SR`*0Fb1 nRJfFc0R 9nB <FL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N^ .B`T0-f(mfHn-HH/NjPJmJn -|`-nBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNhHxN@eBNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N> N^NuNV/. Hy@t/.N> N^NuNhHx6N@eNuNhHx N@eNuNVH0JGDf8 <GH#GD <GD#GH#GHGP#GDGL .^rNR.*yGLBGX g`(*(U g " Ҁe " Ҁd(M *@bGPfGDgB`RGX GXo "<NX#GXBN X(@ 9GX" Ҁe 9GX/N X(@g yGP 9GPXg yGP  9GX" ҀY(#GP <GD A ` " Ҁ#GLGLc A#GT A 9GL*A L0N^NuNVH0*n(MY#GL (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNR.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ GT L0N^NuNhHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLG.QYtd6o^{fr$,,((FF%B*3:A.IQ$W^c,gpsvzD?>4JD t$l&.6!L)-T38?FLS[4a|gLlju| p ?bLnHr8Rv @%\,5=ELMWLa<fZuyv<@$dt3!8HX00@ <H"b-<1<8<?XGhPV\~4brk0r ]yTJZ AJ tNT        L f   B% - 6$=D KROLWuN_ c  j $q 2(xF( ,T 0k 4 8 < ^ @F3*X D HD gL!V#X+$@3.(9 P= TApI XM \QXy ^Re@l `t|" h hz,lnfjFX4V t?#@-^4  <jC;JT4t\jd &listzhxL[4YBsbQRZ<d>74  G\ crt0.occ.o_sccsidcalloc.ofprintf.ofprintf.oprintf.oprintf.ostrncpy.olmult.oneg_resultpos_resultzero_resulta_negb_negOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.ogetpid.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ofstat.oisatty.oclose.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_Kflag_strspl_crt0_nodup_printf_setsuf_llist_strncpy_ccom_strcat_oflag_c2_fprintf_nxo_exflag_pflag_tmp0_tmp1_plist_tmp2_tmp3_execv__flsbuf_tmp4_tmp5_wait_exfail_savetab__exit_error_Rflag_as_fflush_unlink_av_sflag_cflag_clist_sprintf_dflag_getsuf_chpass_calloc_proflag_eflag_npassname_fflag_saveleft_cpp_dexit_idexit_callsys_fork_wflag_gflag_savestr_outfile_strcpy_signal_ld_malloc_strlen__iob_na_nc_getpid_nl_npulmult_freeuldivt_cfree__pfile__printlmult__sigfunc__sighandler_errno_syscallcerror_execl_execle_execve__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_fstat_close__lastbuf_isatty_fclose__sibufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrk_end_brkb[ lѹN Zu*b*bby 8G8 d$G"I#HTHS/N4 /NXNuNuNVHSX Jo&Hy4 n /NPJfRX S lHy7N@XHxNXN~# n /aPXJgR n /NX#/NDX#JglJfh n /HyWN@PHxNX`F n /N|X#Jf n /HyjN@PHxNX y#/9NX#Jf Hy}HyNPHxNXJg y ( g~B`* y ( "Ё @/ y/NPJgRR y ( "Ё @JfJg BNX n /HyHyN HxNX~`Hy Ю @/NPJfJgH09H"9̲g6Jft Ю @/HyHyN #`F/909H/ Ю @/N: JgJf Ю @/NHXRmB/9NXLN^NuNV. .R @HH.g  @fB`p..N^NuNHxN@eNuNVH ..NN*@Jg -fN L N^NuNVH0*nNN(@JgHU/NPJfN L0N^NuNVH ..NNz*@Jg -fN. L N^NuNVJfHyHyNP#`/9NXN^NuNVJg/9NXBN^NuNV.*n` :gRJfJgB *nN^NuNV.Jf"HyHyNP#fB`/9HxHyDN *@g#HHUazX*@#HHUajX*@HUNX#HHUaPX*@HUNX#HBI#IHUa&X*@#IHUaX*@#I HUaX*@#I`  gRJfB <H*nN^NuNHxN@eNuNVJfHyHyNP#`/9NXN^NuNVJg/9NXBN^NuNVH *n.. ` HHgRJfJgB L N^NuNVH0Jf"HyHyNP#fB`/9HxHyIN *@Jg#MHx:HUalP*@#MHx:HUaXP*@/NX#M #M(M$Hx:HUa0P*@Hx HUa"P(|M(`Nd(Hx,HUaP*@JfB <ML0N^NuNVA-H#Hn/. N@P n0( gp`BN^NuNVA -H#Hn/.N@P09 gp`BN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNpX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NNPJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HHN+@`m+n f09gHyNfX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|`|eB` 0,f -+fp`B, wf0Hx/.N(P.JgJm/NXHx` afvJgp`p//.NP.lB $f6Hx/.N(P.Jg Jm/NXHx/.NP.Jm.HxB/N6 `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNVH *| 9$䰹,l  @*PJgXz%Ij)<^q~Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNfXBB-HH/N6 B+mm0-gm*nN^NuNHxN@eNuNV(.-nBN`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRN nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@ -@-A (|O /9/9 .".Ng(|O `rHn/9/9 .".N //N> -@-A/9/9/9/9 .".NJNN0SR/9/9 .".NfrO df`/9/9 .". NoF/9/9/9/9 .". N-@-ANl-n-n S` .N(@Jf n Nd B9N`b\O dT/9/9 .". N-@-A Hn//N> -@-A .".N0`O eB9O`>*LZ`0SR`*0Nb1 nRJfNc0R 9nB <NL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NNPJmJn -|`-nf9HH/NXXJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX|e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JO f8 <O$#O <O #O$#O$O,#O O( .^rN .*yO(BO4 g`(*(U g " Ҁe " Ҁd(M *@bO,fO gB`RO4 O4o "<N#O4BNX(@ 9O4" Ҁe 9O4/NX(@g yO, 9O,Xg yO,  9O4" ҀY(#O, <O  A ` " Ҁ#O(O(c A#O0 A 9O(*A L0N^NuNVH0*n(MY#O( (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN .d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ O0 L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL9??JEO  $Wy]3Xelins zx[BYsQdRNZx7  O8 crt0.ochgrp.o_sccsidchown.ogetgrgid.ogetgrnam.ogetpwuid.ogetpwent.ogetuid.ogetgrent.ofprintf.ofprintf.oprintf.oprintf.oatoi.ofgets.ofilbuf.ofopen.ocreat.operror.oerrlst.orew.olseek.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_pwd_atoi_printf_stbuf__ctype__status_fprintf_getgrnam_chown_getpwuid_uid_strcmp_fflag_gr_perror_stat_getgrgid_getuid__iob_isnumber_gidcerror_getgrent_setgrent_endgrent_getpwent_setpwent_endpwent_fopen_fgets_fclose_rewind__pfile__print__filbuf_read_fflush_fstat__sibuf_malloc_lseek_errno_creat_open_close__lastbuf_sys_errlist_write_sys_nerr_strlen_fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٺ G*j*kby (< l$G"I#HTHS/N4 /NXNuNuNVH B l Hy4HyNPHxNX n #`BNX#\BaX~`tHUHyaHyN R`T Ю @*PHy HUN^PJm n #`p09&/a:X/HUNPJl HUHyy`Rm/.NXL N^NuNVHa, y`Jf `a,`D/.aX*  +g& -g =g` F` F a*.f 9`R` @ ,gS` y`Jg HyHyNPHxNX .LN^NuNVHB` 7n. "0Ё, 9`R` @HH. 0lS` LN^NuNV.B`. og uf@ ` gf8` y`HHR` af`S`Jf 9\F. ..N^NuNV y`HH +g -g =gB` y`HHR`N^NuNVH..B y`HH gg8 og< ug`|@0;NLdlT\`b  ` 8` , "큀R``N$``I` ` y`HHR`r cdS` LN^NuNHx -@-A (|D/9D/9@ .".Ng(|D`rHn/9L/9H .".N //N> -@-A/9\/9X/9T/9P .".NJNN0SR/9d/9` .".NfrDdf`/9l/9h .". NoF/9|/9x/9t/9p .". N-@-ANl-n-n S` .Dp(@Jf n Dpd B9Dp`b\DdT/9/9 .". N-@-A Hn//N> -@-A .".N0`DeB9D`>*LZ`0SR`*0Dpb1 nRJfDpc0R 9nB <DpL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/N XJgm+|h+|h+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NJXJl~0-g /-NjXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHx&N@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDf8 <D#D <D#D#DD#DD .^rN.*yDBD g`(*(U g " Ҁe " Ҁd(M *@bDfDgB`RD Do "<N#DBNjX(@ 9D" Ҁe 9D/NjX(@g yD 9DXg yD  9D" ҀY(#D <D A ` " Ҁ#DȹDc A#D A 9D*A L0N^NuNVH0*n(MY#D (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ D L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLEFKQZ$bio u>{?J  hyjLf;J3 in x[B Ys%+Qd2R>NDZxK $hSX4_elhr7{j DV Dhcrt0.ochmod.o_sccsidOumask.ochmod.ofprintf.ofprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostat.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_newmode_st_who_um_chmod_fprintf_abs_umask_where_what_stat__iob_mscerror__pfile__print__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[ lٹl P1*s*sby  0< $G"I#HTHS/N4 /N`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuN`HxN@eNuNV(.-nBDX`b y8 S m. .R @HH y8"(R!AS AHH` /98 .R @HH/N4PRDX nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH9 @gT nHH0-@*LZ`0SR`*0D\b1 nRJfD\c0R 9nB <D\L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NV .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|$D+|$D+n 0-gl(m m R Э "-d f -,/HT-HH/NV .+L`/.NlX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NV . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NV g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NlXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N?GNV]ck:rxf@$@@ < f<($093AH OV\^lgnDvDT<\*v<PP`l<~4r0b8 Q$8 (! ,( 0/ 46<;4AtH8NTx].c 8ksyL  <l $<.0;P`nnfHf4hFl2 $@$*?806@VG  $DOyU3]elliszx[XYsDQR2ZP<b7Hf D  crt0.ocmp.o_sccsidprintf.oprintf.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_neglseek.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcountlmult_printf_eflg__ctype__skip1_skip2_file1_file2_chr_lflg_fopen_line_otoi__filbuf__iob__pfile__print_read_fflush_fstat__sibuf_malloc_lseek_errno_creat_open_close__lastbufulmultcerror_fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٹ? YB*{*|by  8> $G"I#HTHS/N4 /N@XNuNuNV.BHyHyNP o(Hy n /(NPJfSX R o n #aJg/9dNXHxN@XJf> 9"HA<*LZ`0SR`*0F$b1 nRJfF$c0R 9nB <F$L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n f92HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| ` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N:XJl~0-g /-NZXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NxPJlB`pN^NuNHxN@eBNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JFtf8 <Fx#Ft <Ft#Fx#FxF#FtF| .^rN.*yF|BF g`(*(U g " Ҁe " Ҁd(M *@bFfFtgB`RF Fo "<N#FBNZX(@ 9F" Ҁe 9F/NZX(@g yF 9FXg yF  9F" ҀY(#F <Ft A ` " Ҁ#F|F|c A#F A 9F|*A L0N^NuNVH0*n(MY#F| (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ F L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLjD(DD$. B)<.=AL<PYaj34rHyX@<f<@ ~4r 0'/ 3: > BIOQ[ _?j n u}Q tN;:$hWpF .   !+$3F|<f8ENnrTfLZlag6pDw}?<  yZL3ix[\ Ys%H+Q 2R6>DZ K %SX_xelXr7{Z FFcrt0.odate.o_sccsid_usage_dmsizectime.oOftime.oprintf.oprintf.osettimeofday.operror.oerrlst.otime.ogettimeofday.otimezone.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_sp_write_tv_tz_lseek_dysize_timezone_ap_localtime_ep_uflag_strcmp_gp_settimeofday_gettimeofday_asctime_gtime_open_close_perror_gmtime_time_wtmplmodt_ctimeldivt_ftimecerror__pfile__print__iob_sys_errlist_errno_sys_nerr_strlen_sprintf__flsbuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lق klby9*by ( @9\ $$G"I#HTHS/N4 /N@XNuNuNVH -|@~` Ю @# Hy@aXJgHyaNX#8`HyEaXJgHya(X#<`HyJaXJgHyaX#`lHyOaXJgHyaX#<`FHySaXJg# `(HyWafXJg# 4` Hy[aHXJgHyazX#L`Hyaa"XJgHyaTX# `HygaXJgHya.X#T`HynaXJgHyaX#4`rHyuaXJg:Hy{aXJf y JgDHy}aXJg -|`HyahXJg -|t`HyaNXJg -|z`Hya4XJg -|T`|HyaXJg -| ``HyaXJg8`BHyaXJg8`$HyaXJg8`HyaXJg8`HyaXJg8`/9 HyHyN BN@XRm @f 98g-|JgB/9N6P` BNX#(Jl&/9HyHyN BN@XJ4gHx/94NP` HxNX#\Jl&/94HyHyN BN@XJX`\ fR,`"J,oHx azXS,`/a XR 9mHx aLXBB,..N^NuNV. ..Jf /aX`\ fR,`"J,oHx aXS,`/aXR 9mHx aXBB,..N^NuNV... 98g am zn 98g Am Zn @ @.Jgb g`.9`HH/a$XR 9mB`0 9fRDR 9n/aX..N^NuNV... 98g am zn 98g Am Zn @ @.Jgb g`.9`HH/aDXR 9mB`0 9fRDR 9n/aX..N^NuNV... 98g am zn 98g Am Zn JgZ g`&Hx azXR 9mB`0 9fRDR 9n/a.X..N^NuNVaBN@XN^NuNV/9H/9Hy?HyN/9d/9@HyQHyNJDg/9DHydHyN N^NuNHx)N@eNuNVA-H#hHn/. NP n0( gp`BN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9ll  @*PJgUy"DYlError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#lp`T .p @(P .p @ gf ` <//.Hx0N `NqL0N^NuH // |p pNLNw //W.BN@d W/N WNNV4.-nBH`b yh S m. .R @HH yh"(R!AS AHH` /9h .R @HH/N8PRH nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn .R l .R`p//./.NL-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NDPJf/./.NlPJfHnHn *LZ`0SR`*0Hb1 nRJfHc0R 9nB <HL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|p` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N"XJl~0-g /-NRXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.N6 N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NpPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JIDf8 <IH#ID <ID#IH#IHIP#IDIL .^rN.*yILBIX g`(*(U g " Ҁe " Ҁd(M *@bIPfIDgB`RIX IXo "<N#IXBNRX(@ 9IX" Ҁe 9IX/NRX(@g yIP 9IPXg yIP  9IX" ҀY(#IP <ID A ` " Ҁ#ILILc A#IT A 9IL*A L0N^NuNVH0*n(MY#IL (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ IT L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxibs=obs=cbs=bs=if=of=skip=seek=count=files=conv=,ebcdicibmasciiblockunblocklcaseucaseswabnoerrorsyncbad arg: %s cannot open: %s cannot create: %s counts: cannot be zero not enough memory readwritedd: argument %D out of range %u+%u records in %u+%u records out %u truncated records @(#)dd.c 4.3 (Berkeley) 4/2/83Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$I\. 40(2:XEPB\JbVhxq$ z HLLL8@\\x rF#(/5?>DKNRZa houtz,xz0hFX0X 4%t, 3:>EK P?Y`hou}>jD(DD$.b *</>BM<QYb3j0q@xP8xx<^<@ ~4r0&F, 0m@6 # >D@J O EVT] bi o# x  GR $ ( , r0t 4 8 <8 @ MD HW@94 L@S2  P'..\5 pT<6B XGz~N \Sx[ c<h.pn `t dzz h  l$ pnrfLf8 lF6%D,28>?<DJT  \yRbLjq;"x3ix[\YsHQ R6Z  ( p!(P.7|7> I\C>Hcrt0.odd.o_sccsiddup.ofprintf.ofprintf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.oOsignal.osighandler.osyscall.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_op_atoe_stringlmult_null_cbc_ifile_block_cbs_write_nifr_unblock_seekn_lseek_dup_fprintf_number_ebcdic_sbrk_ibc_ibf_nspace_ibuf_ibm_ofile_cflag_bs_ibs_term_nofr_ntrunc_flsh_nipr_atoibm_files_skip_etoa_stats_fflag_creat_cnull_count_open_obc_match_obf_perror_signal_obs__iob_obuf_nopr_asciicerror__pfile__printulmult_sys_errlist_errno_sys_nerr_strlen__sigfunc__sighandler_syscall__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloculdivt_end_brkb[ lѹ Zv**by$,4<D 8c p$G"I#HTHS/N4 /NXNuNuNV`TR*X`D n h -fH n h(HH igHyTHyNlPBNXSX nBHytN:P-@Jm"HxHy%,/NJ /.N&XNrHy~NXJ*XgHyNXHyNX nNRJf~HyNXHxNX`bHy . /NPJgHy . /NPJf&J9*4f/.Hy*4NdPHx/.aNPN-@fNBNX-|`B .Ю @/aPR .mN^NuNVpHn/.NZPJfp0. grp0. `g^J g/.HyHyNl `NRN-@gNHnp/NZPJf0.~nf-nNB/.N:P#*TJl"/.N`"N/.Hy`zHx Hy,Hxa /.HyNP-yT 9"9dNbй-@ .-@rdh .NbrdN-@o`B-@ ."9`Nb"<N/ ."9`Nb"<N/ ."9`Nb"<N/Hy(NJf 94"98`0/9@/9< .N// .NNHN//Hy2N J*Xg 9X"9Nb-@-@Jf 9D"9H`0/9P/9L .N// .NNHN///9/.Hy:N`HyKNX/.aX/HyNNP/9*TN&XN^NuNVB .r //9*TN /./. /9*TNJ -@g6/.HyTNP/9*,/.HykN BNXN^NuNV.Hy*4/.aLPJg <`6B %L//.a*PJg %,`R m <..N^NuNVHxHy/.N JfZHxHy/. N JfZ /. /.NPJfp`p n rf/. R/NPJg n rf R//.NPJg n rf$ n rf R/ .R/NPJgBN^NuNV.*n ` .gRJfJf@B`^HHA @g` H@ H@B@ހHH0ހR`8B .S//. /.N0 A *nN^NuNVH B*n JfJf4BL N^NuNV./9HxHnN| Jf(p` n ` .gRJfJgA `A*HHx:HxHU/.a*@fB`Hx:HxHU ./a*@fp`~Hx:HxHU . /a*@fp`RHx:HU .$/a *@fp`*Hx HU .(/a *@fp`p*nN^NuNVJga,HyHyNDP#f BB`pN^NuNVJg/9N>XpN^NuNVJf aJfB`*Hyjda`X-@ g f <jdN^NuNV.aZJg$a*@JgHx/.HUN Jf `B*nN^NuNV.aJg(ap*@JgHx/.HmN Jf `B*nN^NuNVA-H#*\Hn/. NhP n0( gp`BN^NuNVA -H#*\Hn/.NhP09 gp`BN^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNHx$N@eNuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|*d`D/.NX+@f,mJf,0-g-HHj+@`m+n f09gHyNX0-gp` - //--HH/NJ *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9*,l | @*PJg*LZ`0SR`*0jb1 nRJfjc0R 9nB <jL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|Jd+|Jd+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX$e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N&XJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?NH n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`$eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N&XHx` afvJgp`p//.N:P.lB *,f6Hx/.NP.Jg Jm/N&XHx/.N:P.Jm.HxB/N `Jgp`B//.N:P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N: N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNHx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jjf8 <j#j <j#j#jk#jk .^rN.*ykBk g`(*(U g " Ҁe " Ҁd(M *@bkfjgB`Rk k o "<N#k BNX(@ 9k " Ҁe 9k /NX(@g yk 9kXg yk  9k " ҀY(#k <j A ` " Ҁ#kkc A#k A 9k*A L0N^NuNVH0*n(MY#k (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ k L0N^NuNHxN@e#(BNu /й(/@HxN@e 9(#(NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLBGNT?]`cjmqyH@|  (r#)P/ 4>=DKRY]Ddpj o?x6 BF &JVt0  $D.&-.5=.GQ<Veit<x3 4DTd!p0< <$+3<DJP~4Vr_0fJlbr{  ,HR rl %, *,* *4F? *TR :;&!)!d1Z7 =*X>.D0M@VtD],h+|oz> *\hL *dP|$ nff *#f)r/9  JdAyG$Q3Y`igHn<tx {[jYs6QRvZ.7 kvcrt0.odf.o_sccsidfstab.ofprintf.ofprintf.oprintf.oprintf.ostrncmp.ostrncpy.osync.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_readlmult_strncmp_printf_dfreefflti_sbfdivi_getfsent_setfsent_sync_lseek_fprintf_mtab_errno_endfsent_root_breadldivtieeeusedfmuli_eq_fi_mpath_strcmp_open_close_perror_strcpy_stat_iflag__iob_strncpy__ctype__fopen_getfsfile_fgets_getfsspec_fclose__pfile__printcerror__filbuf_fflush_fstat__sibuf_malloculmult_sys_errlist_write_sys_nerr_strlen_fcvt_ecvt__flsbuflmodt_isnanfcmpi_isinfffixi_modffaddi__cleanup__sobuf_free__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpfdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ 2lٹQ Z**by08@HPX 8dh 4$G"I#HTHS/N4 /NXNuNuNV.B`DHy? n /NPJf*LZ`0SR`*0lb1 nRJflc0R 9nB <lL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N>PJmJn -|`-nf9HH/NHXJgm+|++|++n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXHe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNp/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /Nj +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JlPf8 <lT#lP <lP#lT#lTl\#lPlX .^rN.*ylXBld g`(*(U g " Ҁe " Ҁd(M *@bl\flPgB`Rld ldo "<N#ldBNX(@ 9ld" Ҁe 9ld/NX(@g yl\ 9l\Xg yl\  9ld" ҀY(#l\ <lP A ` " Ҁ#lXlXc A#l` A 9lX*A L0N^NuNVH0*n(MY#lX (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ l` L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL;H3H&i-4:x|A[G8NdTYr]sf$lQsRZ Kj7 lhcrt0.odu.o_sccsidchdir.olstat.ofprintf.ofprintf.oindex.oprintf.oprintf.oseekdir.operror.oerrlst.ofork.otelldir.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTrindex.ostrcmp.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_lstat_printf_dot_index_name_fprintf_closedir_wait_seekdir_path_aflg_mlx_readdir_chdir_sprintfldivt_dirp_strcmp_fork_sflg_descend_perror_strcpy_rindex__iob_ml_telldir_opendircerror__pfile__print_lseek_sys_errlist_write_errno_sys_nerr_strlen__flsbuf__ctype__fcvt_ecvtlmodt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_open_read_ioctl_stty_realloc_sbrkuldivt_end_brkb[ Jlق; $by$*byLT  : $G"I#HTHS/N4 /NxXNuNuNVHB o( n h -f n h (nf RSX ~`ZHyl Ю @/N P .Sl4Slm 9pRp @ HH`HylHx NpPRmJf4Slm 9pRp @ HH`HylHx NpPBNxXLN^NuNVH0*n(n `(Sm",R AHH` HT/NpP.HH,f L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nlf9~HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N,X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|X` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N,XN^NuN Hx>N@eNuNVHn/.NPJlB`pN^NuN HxN@eBNuNV/. Hyt /.N" N^NuNV/. Hy@t/.N" N^NuN Hx6N@eNuNVH0JAf8 <A#A <A#A#AB#AA .^rN&.*yABB g`(*(U g " Ҁe " Ҁd(M *@bBfAgB`RB Bo "<N,#BBNX(@ 9B" Ҁe 9B/NX(@g yB 9BXg yB  9B" ҀY(#B <A A ` " Ҁ#AAc A#B A 9A*A L0N^NuNVH0*n(MY#A (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN&.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ B L0N^NuN HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLXj| -=L]q .D^|0Rp!B[u6IVj~Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVJ/A-HA#=|B-n-|Hn/. N$PSm .R @BHH`HnBN\P .N^NuNV4J/.-nBT`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/N\PRT nJg %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|p-n-n nP.HHR dgnv Ogn@ Eg.n$ DgXnJg A-H-HRJ.g/.NX-@8/.NXJljB`h|R`L|-|D`|-|D`-|DJl-|J.g `&-|q PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|s`J.g-|uJ.g"/.NX".-A< o-@ .Xf -|wL`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN -@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-hHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9\/9X .".NJgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N `S n0A .ذnJn/9d/9` .".NJfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-hHnHn *LZ`0SR`*08b1 nRJf8c0R 9nB <8L0N^NuNVJ/H-n-n .,p.@.Jl n !y .". `l o n !n  9"9`H*pprSʁ N n !Apr N// NNLN^Nu"//WPOJ/Hg kkf$`d"//WPOJ/HkgVkgBkT dB&B<Ѓe rL8Nuidpr<L8Nu rL8NurJL8Nu oD&B<ЃerL8NukgvgdkN d&B꫐k|B bH@Ѐ[k rgL8NuprL8Nu ofD& <`DgjD`"//WPOJ/HgFglEDvilE]B&HC(BHD؃BDHDH@HAHAЄjg*rL8Nuiex@ЄЀdgrL8Nu <rL8NujJrL8<NuL8NVN^HJf:rJ|`rL8NuHAH@`k <rL8Nu"//WPOJ/Hg(gvEDiBH@HAAkiH@DL&:H@HA6BŐd &BЃE&HCB@HEk :څ0:r ghL8NuJ//k.gBAkjD*Nup*<Nu* <NuBkj D*DNufDJk <*<NurJ//*<_Jg8j*N@eNuNVJ/Hn/.NPJlB`pN^NuNVJ/H B/.NP. g `/NXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVJ/H0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVJ//. Hyt /.N N^NuNVJ//. Hy@t/.N N^NuNHx6N@eNuNVJ/H0Jf8 <# <### .^rN.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<N #BNX(@ 9" Ҁe 9/NX(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#عc A# A 9*A L0N^NuNVJ/H0*n(MY# (L0N^NuNVJ/H0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLHXh .Ю-@HxNX*@/.HyHUNp `: .` .".N` .".N` .".N`*nN^NuNV. . g gr `Hy/. NPJgHy/. NPJf:Hy/.NPJgHy/.NPJf*|`*n`*n `Hy/. NPJgHy/. NPJf *|`ZHy/.NPJgHy/.NPJf*|`$*nN^NuNVH /. NX./.NX,` nJgRSf*n` nJgR SJf nB L N^NuNVH0*nB`RJfHxNX(@/HyHTNp L0N^NuNVH B`TB`B .Ї @". ҆ Af(R/HyHxNX*@/Np `"R . І @JfR .Ї @Jf <L N^NuNV./. /.abP/HyHxNX*@/Np J 4g,HyNXR/NX*@HyHUN,P *nN^NuNVH *n BHyNHHyLHHUa  4o Hya dXHyLH/.a>PJgH  4f0*y t 9 ./HUHyN  @B 9 `BL N^NuNVHyaXN^NuNVH0*n (n,.-LBHH.fJfJ fHx)aX`A-HB 4-y 4# ^fR `Se Hx2alXHH. *g \f {g-Mf`  g@ $g` *g: .g [gZ \g~-M``zHx$aXJg n g g`RHHf`@Ae Hx2aX BB Ю @BR mB.HH. ^f|HH.Jg f Hx1aJX -fNJgHHH. ]f 9с-`` .ఇl$ @".$ ԁ BR`-G  @"$ ԁ BHH. ]fbJ.g"B Ю @ R m`HH. g (gN )g~ ng {g 1mF 9n<1m Hxa.X$`&  4m Hx+aX n 7R 7R 4`tA .갈b Hx*aXS nR`HJg nBHH.B 0m, 9n$ ."HA HABAЁЇ0-@` HxadXHH. \g ,f o Hx a8X ,f* .RJg Hx,aXHH. \f" }g Hx-aXJf`jS`2--lJHx.aX`@.HH" Ҁ AHH. AHHfJ lR`HH t @-PHH @ -@/HU/.aB Jg`jHH t @-PHH @ -@&M`/.HU/.a Jf`HTHUaPJfd`x&MJf`R&MgR`F&M@.HH" Ҁ AHH. AHHfS gHTHUaPJfbBL8N^NuNV.*n# h f <N ` h# *nN^NuNVH0*n(n ..f Hx3a*X SJg gB`pL0N^NuNV/.HyHylN0 HxN4XN^NuNVHJyoXSy`N0H @< FfPJ~la8#~lB~$|`X Rf0*GfXJRm 0H~f<*lB`*JFf"09H b@0;N0H @0H〙*K0H @0H倗#=F0Hf @<0H` @0H2HЁR=@ nl*0.H @>0H @0D@2@g0H` @0H @>0.HS b@0;N,8T`p|"`Hya^XR3`n0H @0H<JFm< Fl60H @0H @ Pf0H @>`L0H @<UYAԹd``J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVA-HA# <=|B-n-|Hn/. NPSm .R @BHH`HnBN,P .N^NuNV4.-nBMH`b y < S m. .R @HH y <"(R!AS AHH` /9 < .R @HH/N,PRMH nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N8PJf/./.N`PJfHnHn .R l .R`p//./.N@-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".N|gP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9/9 .".N|fp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N8PJf/./.N`PJfHnHn *LZ`0SR`*0MLb1 nRJfMLc0R 9nB <MLL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nXf9jHH/NXJgm+| D+| D+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|D` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NRXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NpPJlB`pN^NuNHxN@eBNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JMf8 <M#M <M#M#MM#MM .^rN.*yMBM g`(*(U g " Ҁe " Ҁd(M *@bMfMgB`RM Mo "<N#MBNRX(@ 9M" Ҁe 9M/NRX(@g yM 9MXg yM  9M" ҀY(#M <M A ` " Ҁ#MMc A#M A 9M*A L0N^NuNVH0*n(MY#M (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ M L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL>=!=matchsubstrlengthindex@(#)expr.y 4.2 (Berkeley) 3/9/81-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$M. 4!t0+05p>pG.QYPdo:{BNppFMH@@@,4PPl tf:#(/5?>DKNR|Zahouhz ln$v~\:L$L| (%h,3: >EK P?Y`hou}2^888$.&<.2=<AJR[3c,l!Ps{8xx<^<4~4 r0 d% .4t:pBMA0X]d a dh  hmvvj} t l " p  t0 XPZ e  f   pr    &FpF  f~&  - D 2:CKS[zbi"r8y!,l  4%$.D[` Y 8Pd  <f,nfg@`|*8%+17?0=CMT   D\yRbLjq;x3i x[P|Ys<QR*Z ,D p 'P-7|6R<C MH>M LDTcrt0.oexpr.o_sccsidatol.ofprintf.ofprintf.oprintf.oprintf.ostrncpy.olmult.oneg_resultpos_resultzero_resulta_negb_negsprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_op_yyval_Mstringlmult_atol_printf_yyerrflag_operators_rel_yydef_Ac_low_strncpy_index_Av_yylval_braslist_bittab_fprintf_ematch_yylex_yynerrs_loc1_loc2lmodt_braelist_yyerror_getrnge_size_sed_length_sprintfldivt_locs_yyr1_yyr2_yychar_circf_yyv_strcmp_compile_yyexca_yypact_substr_match_errxx_yyparse_arith_strcpy_malloc_conj_nbra_yychk_strlen_advance__iob_yypgo_yyact_Argi_ecmp_step__pfile__printulmult__flsbuf__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_fstat_close__lastbuf_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodtcerror_gtty_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[ lٹS Y{**by 8C( $G"I#HTHS/N4 /NXNuNuNVH0HyHHyNPSoX n P -f n P(HHb bD@0;Nbv888D288l88888N88X:82`R%`R%`|B0`rR%t`hR%`^R%p`TR`JR%x`@R`6SX Jn HxNXJ%gD(|) n *P`& \fJgݹ*eBHy ]g8,HH.` 4 @"$ ԁ BRHHmR 4 @"$ ԁ BHH. ]fJ.g"B Ю @ R m`HH.g f`z (f" . lt nRR.`P )f A .氈cF S nR`( 1m 9n1l` eBHyiaPL0N^NuNVH0Jg.HyxHyy/.N Jf/.Hy{aPB%BR%*|%Sxm 9|R| @`HyxNX. gd fNJ%xg %lo/.HyNlP/9HyNlPHyNX`)efB*|%(| J%g$HTHUapPJgTJ%f./.aX` f&,HH.HHf HTHUa2PJfJg`HTHUa PJfJfJ%f`L0N^NuNVH8*n(n `@0;N*8N  @H L  `gB`Jg`Jf`p`@.HH" Ҁ AHH.4 AHHg`zHH @ `dHH%H`HH @-PHH%H @JgNHH%H @ -@/HU/.a Jg`HH @-PHH%H @JgHH%H @ -@&M`/.HU/.a Jf`HTHUaZPJfd`&MJf`R&MgR`F&M@.HH" Ҁ AHH.4 AHHfSg f*l.fHTHUaPJf& MSb`HTHUaPJf MSb` gHH% @f _gHH% @g-HH% @f -_g-HH% @g@`bHH% @fH _g@HH% @f&HHS cBHya*LZ`0SR`*0Jb1 nRJfJc0R 9nB <JL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NzPJmJn -|`-nf9HH/NXJgm+|H+|H+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N,X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|x` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNP/.N,XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN HxN@eBNuN HxN@eNuN HxN@eNuNV/. Hyt /.N" N^NuNV/. Hy@t/.N" N^NuN Hx6N@eNuNVH0JKf8 <K#K <K#K#KK#KK .^rN&.*yKBK$ g`(*(U g " Ҁe " Ҁd(M *@bKfKgB`RK$ K$o "<N,#K$BNX(@ 9K$" Ҁe 9K$/NX(@g yK 9KXg yK  9K$" ҀY(#K <K A ` " Ҁ#KKc A#K A 9K*A L0N^NuNVH0*n(MY#K (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN&.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ K L0N^NuN HxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLF\d$D\z0 # (?1r8\@~GXMU\Hbbint&{Pl\\<j&< P$t#3+29@H,QX`jt~<6< ,~4r0 l m    $$ " ,  6  H>4F,O %HY6 bj %lq %pxL %t %x %| %V  % %-0 =%p.x % %eTP ) *.t;&z. *6>yDJzQ *Y,a hn.nftf}z(F,D$Pf?P3,ix x\[D$YR-sr6<QCROUZ\athn"u{7& K(crt0.ogrep.ofreopen.ofseek.ofprintf.ofprintf.oprintf.oprintf.osetbuf.ofilbuf.ocreat.olseek.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_blkno_printf_lflag_tln_nflag_succeed_errexit__ctype__expbuf_braslist__sobuf_bittab_fprintf_braelist_freopen_setbuf_nfile_bflag_fflush_sflag_cflag_execute_nsucc_circf_compile_vflag_wflag__filbuf_hflag_yflag_advance__iob_lnum_linebuf_fseek_ecmp_ybuf_lseek_errno_creat_open_close_fclose__pfile__print_free_read_fstat__sibuf_malloccerror_fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٹ XZ**by 8=< $G"I#HTHS/N4 /NXNuNuNV ogSo,Sm ,R @` HTN|X. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg f @` f @R mHH. ]g*Jg f @` f @RJfS L N^NuNVH *nBB-y -y$-y(-y,-|-|HH. g -f -|`f +g^S`Z/9/9 .".Nl< 0N///./. 90"94NN-@-A`RHH.  @f .gZ`t/9/9 .".Nl< 0N///./. 98"90SR/9/9 .".NfrE$df`/9/9 .". NoF/9/9/9/9 .". N-@-ANl-n-n S` .D(@Jf n Dd B9D`b\E$dT/9/9 .". N-@-A Hn//Nz -@-A .".N>0`E$eB9E#`>*LZ`0SR`*0Db1 nRJfDc0R 9nB <DL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N6 .B`T0-f(mfHn-HH/NRPJmJn -|`-n(f9:HH/N\XJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N6 .+L`/.NLX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N6 . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N6 g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN(/.NLXN^NuNV .". nJ/H?N\ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN@HxN@eBNuN@HxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN@Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JE$f8 <E(#E$ <E$#E(#E(E0#E$E, .^rNF.*yE,BE8 g`(*(U g " Ҁe " Ҁd(M *@bE0fE$gB`RE8 E8o "<NL#E8BNX(@ 9E8" Ҁe 9E8/NX(@g yE0 9E0Xg yE0  9E8" ҀY(#E0 <E$ A ` " Ҁ#E,E,c A#E4 A 9E,*A L0N^NuNVH0*n(MY#E, (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNF.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ E4 L0N^NuN@HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLezk(u  $}y;3\RLi\P[~Y*QRZ0p 7(#)F0 E<5:crt0.ohostid.ogethostid.oprintf.oprintf.oscanf.odoscan.oatof.oatof.o_exp5_twoe56sethostid.ofilbuf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oread.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_sscanf_gethostid_sethostid_perrorcerror__pfile__print__iob_fscanf__doscan_scanf_atof__getccl__ctype_fsinglei__instr__innum_ungetcieeeused__sctab__filbufffltifdivi_ldexpfcmpifmulifaddi_read_fflush_fstat__sibuf_malloc_sys_errlist_write_errno_sys_nerr_strlen_fcvt_ecvt__flsbuflmodt_isnanldivt_isinfffixi_modf__cleanup__sobuf_free_close__lastbuf_isatty_fclose__exitd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lقD́ NbyA*by 0Xj| -=L]q .D^|0Rp!B[u6IVj~Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV4.-nBC`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRC nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NlX-@8/.NlXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NlX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.N8PJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9| .".NTgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9/9 .".NTfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.N8PJfHnHn -@Jg& .D".²o nJg 0g -|`J.g -|`J.g-|AU-H-nHBJHn 0R`< nJg m n0R` n"nRRRSHfJ.fJo n.R *LZ`0SR`*0Cb1 nRJfCc0R 9nB <CL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nLf9^HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|8` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN`/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDLf8 <DP#DL <DL#DP#DPDX#DLDT .^rN.*yDTBD` g`(*(U g " Ҁe " Ҁd(M *@bDXfDLgB`RD` D`o "<N#D`BNX(@ 9D`" Ҁe 9D`/NX(@g yDX 9DXXg yDX  9D`" ҀY(#DX <DL A ` " Ҁ#DTDTc A#D\ A 9DT*A L0N^NuNVH0*n(MY#DT (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ D\ L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL.L U$^gpzCb ((DL>d?^T$+j2d8@=DKDPXF`hqzNVlt4$$Tl@ ?#l+2h8@ GXMrTY_6fnu|`|l$.<Z< 3$ ,5<DtNXb<g vz&< ~4r0eO a  $l %.8+8?xIRn>Xf^fgm8tFzTv?`  yL;3i xl [&(-T3Yb<sEKQRR^dZk #sx7 Ddcrt0.ohostname.o_sccsidgethostname.oprintf.oprintf.osethostname.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_gethostname_sethostname_hostname_errno_perror_strlencerror__pfile__print__iob_sys_errlist_write_sys_nerr__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[ lٺ N**by 0= <$G"I#HTHS/N4 /NlXNuNuNVHB n(HyN`XHyN`XHxNlX n h -f@ n h (lfd~`D 4 @Jg 4 @/HyN`P fHyN`XR oHyN`XB` n h(HHY @g6 n (R/NX. m ox n /(Hy`T n (R-@~`0 4 @Jg/. 4 @/NPJg(R o/.HyN`PHxNlXSX `~X `p n P 0mv n P 9nh/ n /NX,/NVP*Jl, 9D( @//HyNN` -|S` n .LN^NuNHx%N@eNuNVA -H#HHn/.NP09 gp`BN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^Nu@HRl| ,8N`l~,9O^j})H_v6F] *LatError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV(.-nBEL`b yH S m. .R @HH yH"(R!AS AHH` /9H .R @HH/NdPREL nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHY @gT nHH0-@*LZ`0SR`*0EPb1 nRJfEPc0R 9nB <EPL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N"PJmJn -|`-nf9HH/N,XJgm+|L+|L+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JEf8 <E#E <E#E#EE#EE .^rN.*yEBE g`(*(U g " Ҁe " Ҁd(M *@bEfEgB`RE Eo "<N#EBNfX(@ 9E" Ҁe 9E/NfX(@g yE 9EXg yE  9E" ҀY(#E <E A ` " Ҁ#EEc A#E A 9E*A L0N^NuNVH0*n(MY#E (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ E L0N^NuNHxN@e#@BNu /й@/@HxN@e 9@#@NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLR`R`R(`RRJjoHyBa,BPBj`R$R`RB$#$`RB$#$`~R`tHyNX`bR`X І @J(fHyHxa+PJ$f*Hx/.NP#JfHyHxa+P ІR"9$ҹ A R$`R$B#`Hya-X#, І @"y,PB9HyHxa+ P`JfJfJfR$/. /.aPBN0XL0N^NuNVH *nB`f 0`" fn< W` Fn2 7܀`6  @f al AlHyHxa*RPHH.f L N^NuNVa-HyNܞXJnfJf/9/9vNP/9nN0XN^NuNVH0#F&B,a a . X(@~lT*\JgHUHyNP -g HUaXR`| І @Jg І @HH lgn Tgn Dgn AgnR`/azX-@ 9m@`J yJPg SP y (R!@S @BHH`B/9a-`PR 9mRX`# /aXB R`vS І @- І/` Hg`T eg`H ugn og`2 yf(`aL0N^NuNVH0*nJjl #jHUa" X-@Jg/9,Hy!NP . b@0;N$pBBa P/9NX`HHy%Hxa'P-|/.a2XJgHxHyNX/a)PP<Ѯ`-|DHx/.Hy "<ONߨ$HBHBBBЂ @$ "<ONڮ"HA HABAЁԀ*Bp-S b@0;N&Jf xJgJgFJf@0g8|g04g(JfHyNXR/HyNPR` 9ѭ` 9` 94`p- @ .`J$fJgB .ѹt 9r Nߨ#Jg0/9/9|a,P/9/94aP/94/90a PL N^NuNV/9aX-@/.aXlJg n . ѨN^NuNV.*ngB -fJg(Jf /HyNPHyBaPP` n+n *nN^NuNVBNXF#//9vN\P#,Jl.#v,B9 9 @/HxaP`HHn/9,NPp0.Ig(p0.//9vNPp0.##$B/9aPJg <`J$g < ` <#\Jg 9` J$g <`p//9aP#`J$gHx/9aP` 9#d"9t-AJlB#h#$t#$xJ$gB`$/9$aX"HA HABAЁй#lJg. y (gHyBaXP` y#p` #jpJg 9$`B#tJg 9$`B#x/9Hx Hy\a J$g"/9aXBHx/9a.P  \f <`p й`#(/9dHya`PJg /9tHy aHP/9xHya8PJ$gJf"/9lHyaPX(BHyaPN^NuNV.*nHxNܨX*JfHyHxaP/9(/adP . ѹ(*nN^NuNV.*nHUaXJg y&"H (f$ lHy8HxaP & y& "(R!ASЁ @-P g^Hx yJPg SP y (R!@S @BHH`B/9aPR 9f 9ѹHx/9aPѹHx/9aPѹ4/9NZXL0N^NuNV.p9f/9,HyNPJ9gHyHyNPHyNXp9f(Jg /9/9HyN `*|z`p9"gPJfp9g <!` <//NXp9gHyJ$g6  \f <`p й`йdйtйxS/abXJf@HyNܞXHyHyN PJlHy Hxa P# v#xnaDLN^NuNV 9gB/./9,N HxHn/9,N> B/./9,N HxHn/9,N g#Hy $Hxa PN^NuNVJ$f4Jf,##/9HyafPN^NuNV.Hy gHy 7HxaPǟ ߭Hx "<Nߨ"-RЁr /HUa `"J f  nPHUaXS J fL8N^NuNVH n*Pg, rHUNۄXR./9/HUa ߹r/. Hx /.a n L N^NuNVH0*n . r . . , gHy EHxaP mS (|| ,g(| ,gJ g (||J fpJfJ f 9 l(||)GB . //9N HxHl/9N> -@lB)n`Hy ^HxaPR +G+L g +n BA* ,+@nB L0N^NuNV.*nSlHx -Rr /HUa SS n,J lHy nHxaXPR mS +| R UR*nN^NuNVH *n#B9#, -f -lf-| |J-f*| # ,B`, Ї @ 9,Ї"@h Ї @ .Ї"@hR Ї @J(f .Ї @|. 9,Ї"@h .Ї @|a 9,Ї"@h .Ї @B( 9,Ї"@hB 9,X/N.P#mX,` B/9,N.P#l#, f(B/9,N.P#lHy HxaP# # B # # #P#HxBHyHTaXJgJTg0H,o,0T&l/HSHUa ݬƞ`A ,gHTaX "<Nڮ", 9gB/,/9,N /HU/9,N g#Hy HxavPݬ#`pL8N^NuNV.Jf*y` HUaX*m f*nN^NuNVH *nA -.Jgn 9gB/-/9,N /Hm/9,N g#Hy HxaP߭#A+H:L N^NuNV.*nHUa^XJUgSU -R @HH` /. HUaP*nN^NuNVH0*n(n ..` SJfL0N^NuNHx`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$Nu *DTlv&8DVeu'6BUf| 7Nh5Yz$9LnError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#p`T .( @(P .( @ gf ` <|//.Hx0N `NqL0N^NuH // |( pNLNw //W.BN@d W/N WNNHxN@eNuNV(.-nBiL`b y( S m. .R @HH y("(R!AS AHH` /9( .R @HH/N(PRiL nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@*LZ`0SR`*0iPb1 nRJfiPc0R 9nB <iPL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n f9 HH/NXJgm+|)L+|)L+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NܨX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| ` HUaXle*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NZXBBBB BmB- L N^NuNVNф/.NXN^NuNV .". nJ/H?NӸ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NhPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N܎ N^NuNV/. Hy@t/.N܎ N^NuNHx6N@eNuNHx N@eNuNVH0Jif8 <i#i <i#i#ii#ii .^rNߢ.*yiBi g`(*(U g " Ҁe " Ҁd(M *@bifigB`Ri io "<Nߨ#iBNZX(@ 9i" Ҁe 9i/NZX(@g yi 9iXg yi  9i" ҀY(#i <i A ` " Ҁ#iic A#i A 9i*A L0N^NuNVH0*n(MY#i (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNߢ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ i L0N^NuNHxN@e#pBNu /йp/@HxN@e 9p#pNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL __.SYMDEFran out of space for symbol tablehash table botchsymbol table overflowsymfree botchenter botchsymx botchld:%s(%s): %s old archivebad magic numbertext/data size oddbad formatran out of memory (savestr)output write erroroutput write errorl.outundefinedabsolutetextdatabsscommonF-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$li. 40!(t19@IR.T\fmq\u|}|iL< <<̆(%0,L3.L;LChIPUpYbbe6hl҈qx~?҂xԎ؈dظhӰj r z֐Ԙ%X*168H> EHMxSYא^׮g$ndu|մ ?ئӐز׌ض.|זغ Z4ׄ֠'4/47ڐ?IڐS<XڞgZkںv<zۄ$ۨ3(8H܈ܘܨ@߀߀ߐ<ߘf߲$<(/7@H0NT~4Zrc0jzs>y%z YtF]xq x ~|t 4  <T    i   z&/ }6>? yF yM pU [b i pU.xqV d4 -j #   d   8 /*n 4p a$yZ*H0ڮ6 =$rE L U1\ c jvu |      U d  uܞڨ $ ( ,& 0 Z4 [@ <!+ 2FT=G  MFߨSk[Pb m v i   ۨ ; .\ V   $\ r(r I, t0 4.  < T E6' j\2 |;DD<KM"U]gf -m .t z+Z([ ܨnB    |$ۄ =$ $ A$E M$ !$  z$    ( $ + 2| 9ߢ @ ( H P. V \  f ( p| } nb f< f( \ x & 4 Ӛ ׸  ?,  ф  )L L l 3 Ѯ   IL i Ӹ 'լ -xҐ 4[ :L Ax GYӆ PsӦ Y8 _Q fR& r xZ  h ܎ H 7ބ Z i F crt0.old.o_sccsidOumask.oatol.ocalloc.ochmod.olink.oprintf.oprintf.ostrncmp.ostrncpy.oatoi.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_negerrlst.oOsignal.osighandler.osyscall.olseek.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_tynames_read_ldrsym_bsize_libseg_bflushc_atoi_errlev_p_etext_atol_filhdr_tracesym_dorigin_torigin_strncmp_printf_bwrerror_reloc_dout_ssize_sys_errlist_ofilfnd_infil_symfree_Mflag_load2td_dsize_tsize_tabstr_tnum_write_Nflag_nflag_mkfsym_enter_ytab_strncpy_slookup_cdrel_textbase_trace__ctype__lochash_chmod_fillup_outb_symx_curstr_entrypt_lseek_endload_locseg_delarg_archdr_bopen_symseg_free_htoilmodt_Aflag_offset_errno_savetab_umask_hsize_cbrel_ofilename_error_arflag_rflag_drout_trout_addsym_cursym_delexit_funding_mget_unlinkulmodt_sflag_Sflag_ldrand_biofd_clibseg_database_borigin_bcopy_fixspec_lhinit_symreloc_dflag_finishout_setupout_toutldivt_calloc_round_ofilemode_boffset_biobufs_lastsym_fstat_sout_link_strcmp_fpage_symwrite_creat_strout_saveleft_tab_lookup_ctrel_getarhdr_filname_p_end_p_edata_open_nextlibp_text_ssiz_dseek_outfilhdr_clocseg_savestr_close_load2arg_bwrite_getfile_Xflag_xflag_nsym_bflush1_load1_load2_signal_malloc_get_middle_csymseg_li_init_page_strlen_yflag_drsize_trsize_load1arg_readhdr_zflag_nextsym_toutb_step_bflush_wroff_cfreecerrorulmultuldivt__pfile__print__ioblmult_sys_nerr__sigfunc__sighandler_syscall_fcvt_ecvt__flsbuf_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_fflush__lastbuf_isatty_fclose__exit__sibufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[lٹ= P;**by' 0@ $G"I#HTHS/N4 /NXNuNuNVH *n SXJg HyH/NPPJf R`XSJg HyK/NPPJf R\XSJg f ." Ҁ A NRJ\fB o8Hy .S" Ҁ A/NPJmTp09 @f>BB`$ .S" Ҁ A/ " Ҁ A/aDPR .Sm/NXHyPHyNPHxNXL N^NuNVJ\g <:` <-@J\fLJ`fDHy/.NPJm.p09 @f/.HyNPp`Hy/. NPJm`p09 @fJHx//.N$P-@Jf-n`R/./. HyHyXN-|X /. /. nNPJl4 Xf/. NDX`VB/.N&PJl/.`BN^NuN$Hx N@eNuNVA-H#dHn/. NDP n0( gp`BN^NuNVA -H#dHn/.NDP09 gp`BN^NuN$Hx9N@eNuNVH *| 9Xl  @*PJg*LZ`0SR`*0Hlb1 nRJfHlc0R 9nB <HlL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|h+|h+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N0X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N0XN^NuNV .". nJ/H?N$ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuN$Hx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN$HxN@eBNuN$Hx&N@eNuNV/. Hyt /.N& N^NuNV/. Hy@t/.N& N^NuN$Hx6N@eNuNVH0JHf8 <H#H <H#H#HH#HH .^rN*.*yHBH g`(*(U g " Ҁe " Ҁd(M *@bHfHgB`RH Ho "<N0#HBNX(@ 9H" Ҁe 9H/NX(@g yH 9HXg yH  9H" ҀY(#H <H A ` " Ҁ#HĹHc A#H A 9H*A L0N^NuNVH0*n(MY#H (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN*.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ H L0N^NuN$HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLZ <$$-P6>G3OV] e0nu}< :<$0~4r0  X X':0 \7F@FPN  `U&]Dek$s.yl$ dD$f,nfNF0 $B?N#-  h5y;LjCJ;Q[0c3ks0zir$x[FYsQhRRZ| (hH&7 * H"'crt0.oln.o_sccsidlink.ofprintf.ofprintf.oprintf.oprintf.osymlink.operror.oerrlst.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.oaccess.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTrindex.ostrcmp.ofstat.oisatty.oclose.ostat.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_stb_name_fprintf_errno_symlink_sflag_sprintf_link_strcmp_fflag_access_perror_stat_rindex__iob_linkitcerror__pfile__print_sys_errlist_write_sys_nerr_strlen__flsbuf__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lѹr  **by (08@HP % `MH$G"I#HTHS/N4 /NpXNuNuNV.-|B-|P-|HxXHxNXBNpXJf: y Jf. .Z/aXJf .Z/HyaP-|Jg6HyNX n (dfHy .Z/HyaH y h Jf y !| y /( NX-@ y /(NXJlLJfFHyNXJlHyNX-|`Hy-NX y !|TJ gJg HxNpXJfHy NXNt-@JoHxHyVNӞP-@mtB ."HAHABAЁ//.Nf HxHx//.N|PR/Hy N HxHy /.N /.NӊXJoNHxHy`NӞP-@m6HxB/Nf HxHy /.N /.NӊXBBHyBNvPJf-|HxHy|NӞP-@mB y ("HA HABAЁ//.Nf Hx Hn/.N. f6Jg0Jf*HnHxHnNX/HxHynNB y ("HA HABAЁ//.Nf HnNXHxHx//.N|PR/HnN Hx Hn/.N /.NӊX y /( /(/.N Hx/.NP y /( NXHxHy Hy N B9 y /( Hy NP y /(NX#Hx: y /(HyN Hx9 y /( HyN HyNXB @Jf Hx:/.aX/HyBN Hx y /HyN Hx/ y /( N|P*@Jf y *h `RHUHyNHPBNXHxNX n (df y / .Z/Hya JfVa| y /Hy^NHPHxHy^NvPJf&HnHy^N>PJgHyNXBHxNtPBHxNtPHxHxNtPBHy y /( N y /( NXHyNXBNpX*nN^NuNVHxHxNtPR N^NuNV.J gp`vHyHyNNP*@JgHUHxdHnN Jg8HnNXSAЈ @BHn/.NѨPJfHUNX`HUNXB*nN^NuNV.HzJHxNtPHyHyNP-@g n S m n (R!@S @` /.N X. gX*|\H n S m n (R!@S @` /.N X. g g\Pd`BHyHy NPHy N>X=nHn n(HH/NԔP/.HxNtP  g /.NX <\HL N^NuNVH0*n (| ` `eB`^0,fBn  rg"l afHxB/.Nf `l -+f ll L0N^NuNVA-H# 8Hn/. NP n0( gp`BN^NuNVH *n.f `JfBL N^NuNVA -H#  8Hn/.NP09  gp`BN^NuNV.*nJg0-g /-N֖Xms+n f mB `+m+| B*nN^Nu///YHxN@ NuNHxPN@eNu///YHx~N@ NuNVBJg>HxNX-@Hy\TNXJg8/.HxNtP/.NXN^NuNVHxHy\TNP`PJg" .c .`-n-|HzHxNtP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH8*n(n &MB`g` BRm`Rm L8N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUN X.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-n f +| @`D/.NX+@f,mJf,0-g-HH\+@`m+n  f09 gHy N>X0-gp` - //--HH/N. *+mSl. fm0-gm`m B` mR*nN^NuNVH *| 9 4 l 4 @*PJgXBB-HH/Nf B+mm0-gm*nN^NuNVH0*n Jm m# 4p`T .-@ @(P .-@ @ gf ` <//.Hx0N `NqL0N^NuNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNHx;N@eNuH // |-@ pNLNw //W.BN@d W/N WNNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNV4.-nB\`b y 8 S m. .R @HH y 8"(R!AS AHH` /9 8 .R @HH/NhPR\ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH } @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH } @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| ,-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| - PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -| /`J.g-| 1J.g"/.NX".-A< o-@ .Xf -| 3L`-| DLA`-H-H`P .P-@@ .P-@P".DNϞЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-| U`-| X`Jl-| n P @-h-h/./.NtPJf/./.N͜PJfHnHn .R l .R`p//./.N|-@Jg -| [`J.g -| ]`J.g-| _AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9  .".NɸgP .S-@HJlD-@HJHg6 .Hr NϞ0S n .Hr N`S n0A .ذbJn/9 /9  .".Nɸfp+`p-S n.HH } @gpE`peS n`Jl-| n P @-h-h/./.NtPJf/./.N͜PJfHnHn *LZ`0SR`*0\b1 nRJf\c0R 9nB <\L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n f9 HH/N XJgm+|-+|-+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*| ` HUaX `e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NӊXJl~0-g /-N֖XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` `eB` 0,f -+fp`B, wf0Hx/.N@P.JgJm/NӊXHx` afvJgp`p//.NӞP.lB  4f6Hx/.N@P.Jg Jm/NӊXHx/.NӞP.Jm.HxB/Nf `Jgp`B//.NӞP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NӞ N^NuNHxN@eNuNHx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LPJm0.nf .fHTNX <]` HTNXBL0N^NuNV.*n/NӊX*BHUN֖X*nN^NuNHx>N@eNuNVHn/.NԴPJlB`pN^NuNVH B/.NӞP. g `/NӊXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N. +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0J]0f8 <]4#]0 <]0#]4#]4]<#]0]8 .^rN.*y]8B]D g`(*(U g " Ҁe " Ҁd(M *@b]6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shPATH:/bin:/usr/binsh/etc/passwdrrinigrp: %s is in too many groups setgrp/etc/grouprr/dev/ttyr%s Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ `/etc/ttys/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83]H. 40#,4<DLU^`lwt.h`\.v.,$,|5>GPZd0kqs |.$4 t|"\|||!h*p1Ō9ŌAƨGNNSưW`Ƣcvfjov|?ƸP̤\ʨ˪`,˲0 ˺D#Ș("/v6̈<`CˈKʸQW\edlǤs:zF  ?nʼJ˚2t$ X%t-t5>$F.@N`U.`]pfπnxπ<ώJϪ<t[|Ѩ ; 30 ӄӘӨ(8H%p.!Ԕ5=F|M׼U<_׼is<xآ<p~4r0.<     \&d-  3@*<@G  NU^eHmvte f  fh, 1B  WNL>#W*  5|>ZHBNU^^ ftmv  |+*Ѩ\Ӟv;ӊ !p>t| 1   ($ tz. $4+ 3;[DLbU_fowOZϞ?F P$  4`vq0 h 2 ,  Ԕ #Դ ) ` 3  8 ; Cy֖ I Q Z a  @ i q4 ~  -@   z D  Q  | n f| ͜ ɸ f t    ?l "  '  - /3 7 >iF E L Rx Y[ _Ō fƸ lY us ~x Q< Rf & ZP .@  Ϙ Z Ө  0 7 ז  ]H ׂ crt0.ologin.o_sccsidOnice.oOumask.ochmod.ochown.ocrypt.octime.oOftime.oexecvp.ogethostname.ogetpwnam.ogetpwent.ogetuid.ochdir.oinitgroups.ogetgrent.olstat.ogetenv.ogetpass.ofdopen.ofprintf.ofprintf.oindex.oprintf.oprintf.osetbuf.osetgid.osetgroups.osetuid.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrncat.ostrncpy.oatoi.ofgets.ofilbuf.operror.oerrlst.orew.oOsignal.oexec.oexec.oexecve.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.oaccess.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_read_logerr_pwd_lstat_nice_shell_printf_stopmotd_getpass_speeds_crypt_utmp_stypeof_tc_catch_rhost_write_strncpy_alarm_strcat_index_gethostname_chmod_initgroups_ioctl_lseek_name_fprintf_minusnam__flsbuf_execlp_chown_setuid_umask_qlog_sleep_getpwnam_user_setpwent_rflag_securetty_fflush_ctime_rpassword_lastlog_showmotd_term_chdir_maildir_getstr_fopen_strncat_ttyb_fstat_fgets_endpwent_strcmp_envinit_open_access_close_perror__filbuf_strcpy_stat_signal_rindex_time_lusername_rusername_strlen_ttyslot_getuid__iob_nolog_nouser_setgid_ttyname_fclose_homedir_roottermcerror_encrypt_setkey_dysizelmodt_localtimeldivt_ftime_asctime_gmtime_execv_errno_execvp_getenv_getpwent_atoi_rewind_setgroups_getgrent_setgrent_endgrent_setbuf_fdopen_stty_gtty__lastbuf__pfile__print_free_setjmp_longjmp_pause__sibuf_malloc_sys_errlist_sys_nerr__sigfunc__sighandler_syscall_execl_execle_execve_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_closedir_readdir_opendir_realloc_sbrkuldivt_end_brkb[Blف^ xTby *by,4<DLT\d P$G"I#HTHS/N4 /NDXNuNuNV.SX NJfRNHyYN@X 9YN#Y<YHxNXJg2##YHnHxNXP0. f#N` n P -f n R`n& ag2n Fgn Ag"n 1fXB`NRN`DRN`:R`0 n R S @HH gfRY` RN`#4`RY`RY`RN`RY`RY` Cf#` Rgn Lg` dgNn cfzR`r ffjRY`b rg\n0 lgFn ifBRY`: qf2#Y`& tg.n sfRY` ug n PJfSX JnDJYgRNBNBYBYJNgBJf R-|8 Hx/.NpP*@f HyHyN@PHxNDX-MB`6BHx n /HUaJg n +PmX R .m-MHzHx rNƈ//.NJg/./.aPBNDXJYg*n`$*n` dg eHU/.aDPdcHy#NX op`B//-a~P`J-y n#Hy%NXHx n/aLP n/NX/.NXJfg Hy'`vBNDX*nN^NuNVH0HnHn/.ab -@JgHJYf(HzpHx .rNƈ//.NJ g/.Hy)NPJNfJYg/.Hy.NP/./.aPJYgx*n`l df`Hy9/-N8PJgJHy;/-N8PJg4HxNÈX(@/-/.abP/aNX()y#؛d*n`60-fJg /-NXJg /-NXe/.NXL0N^NuNVH0-|/.NX-@Jf$ nB"n "/.Hy>NPB`Hx/.NpP n *@ ."HAHABAЁ n А n B`B .찮l".Nz$HBHBBBЂЮ$ ."HAHABAЁԀ*BHUaX-@/.HynNP ."HAHABAЁ" Ҁ eHyqNXR`V/.NX-@`x .P-@Sm 9R @ HH`FHyHx `2 9R @ `JNfRSlHyHx N

0-g df0,g dgp`f0,g dfp`PJYg* ,fB`: ,o 94`( 94D`/,/-N8"P 94NzL0N^NuNV/. NX-@/.NXRЮR o HysHyN@PHxNDXHy/.N8PJgHy/.N8PJf/. HyN`Z/.HyNP/.NXSЮ @ /g n /gHyHyNP/. HyNP <N^NuNV/.NXR/NÈX-@Jf HyHyN@PHxNDX/./.NP .N^NuNVH8*nJNg HUaX` </JYg HUaDX` </JYg HUaX` </HyHyNHyNX&@(m`JYg  m m?`RJfJYg4 df/`( lf@` sf=`0-Ig*JNg@Jg:HyHSNPX(m`JYg  m m?`RJfB <L8N^NuNV.*n/-HyHyN <*nN^NuNV.*nHH bg cg sf BHyHyN <` -"<Nƈ/Hy`*nN^NuNVtH0*n(| 0- H/aX-@|Jg /.|Hy`0- H/HyHnN JYg>0- H/aZX-@|Jg /.|Hy`0- H/HyHnN bg cf0 -/ -/HyHnN`( sf BHy` /-HyHnN HmNX-@| -YmYo* .|/ .|X/HyHnN` .|X/HyHnN 0-H/HTaRP(@HnHnJYgA` < @HPHn0-H/HyHTN < L0tN^NuNVH -|`( n*PX.` . fXSl nR e .L N^NuNV.JmL lB ."HA HABAЁ @Jg ."HA HABAЁ`HJm .g  g^J fN# N*@JgJm m| -f#Hx/HyN `L mNN*@Jg -f#Hx/HyN NN <`t -"HA HABAЁ @JfDHx/ -"HA HABAЁ/N -f `# NNB*nN^NuNV.JmL ,lB ."HA HABAЁO @Jg ."HA HABAЁO`HJm . g g^JfN#N:*@JgJm ,m| -f# Hx,/HyN `L ,mNN:*@Jg -f# Hx,/HyN N <`t -"HA HABAЁO @JfDHx/ -"HA HABAЁO/N -f `#NB*nN^NuNVH0 .". Nh-@/NÈX*@fB`(M .VrNƂ.`BSl L0N^NuNV/.N:XN^NuNV/.aX/aXN^NuNVH HnN X0.< n"-AHnaX*@.-|w*</ Jg Kf, -Jd @, -Jh @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrNb" L N^NuNVH n "<QNb-@ n "<QNƈ-@Jl QS*|0 .r`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV.*nHUNXBB-HH/N: B+mm0-gm*nN^NuNVBHnNvPJlp`Jg n .N^NuN|HxtN@eNuNVA-HA#Y=|B-n-|Hn/. NPSm .R @BHH`HnBN

*LZ`0SR`*0@b1 nRJf@c0R 9nB <@L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/Nr .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|y+|y+n 0-gl(m m R Э "-d f -,/HT-HH/Nr .+L`/.NÈX(@+Lfm`m+n B,`* -.,o+L/HT-HH/Nr . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/Nr g m p`BL0N^NuNV.*|` HUaXDe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N.XJl~0-g /-N:XBBBB BmB- L N^NuNVN/.NȈXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`DeB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N.XHx` afvJgp`p//.NBP.lB f6Hx/.NP.Jg Jm/N.XHx/.NBP.Jm.HxB/N: `Jgp`B//.NBP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NB N^NuN|HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NXPJlB`pN^NuNVH B/.NBP. g `/N.XB`Hx NÈX*@Jg*B L N^NuN|HxN@eBNuN|HxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuN|HxN@eNuN|Hx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N~ N^NuNV/. Hy@t/.N~ N^NuN|Hx6N@eNuNVH0Jf8 <# <### .^rNƂ.*yB g`(*(U g " Ҁe " Ҁd(M *@bfgB`R o "<Nƈ#BN:X(@ 9" Ҁe 9/N:X(@g y 9Xg y  9" ҀY(# < A ` " Ҁ#c A# A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNƂ.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @  L0N^NuN|HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL %5d %4ld %4ld %-9.9s%-9d%-9.9s%-9d%3d,%4d%8ld%8ld %-7.7s %-4.4s %-12.12s %3d %s%s%s%s@(#)ls.c 4.10 83/05/12.M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/passwdrr/etc/grouprr-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$D@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83. 40p!)2=FQ Y0d@n@x. q.h@pF#,6<=PFPMPTY<bDi`q`y|"vJ?$x0| ~4$-6=BIQU[l`gJn\t4{\8x ?B n"*1H8>EMT,]HeHmv$~.4.4DD<Rn<8p;3 (<L '.7@!8GxOÈX _`gq`{p<xFƒ<ll|ȈD~4r08&z `7d' -{&7 FK IQ QZcn|ltp } A A }"N@:Zpf< cN N N 1N 1N W$ IO#r .L7F@ YF2PFƈVkp^mjg YmNw8< qYL\ YtX Y+D ! Y4È6@X aY!$)1.7@3H YNgW YY] YYc"l u Yzhy:ƂOb?  |&|r t+ Y L Y':.Qv<`EnvKfPQpX^:gHntz?@r  y;.DȈix[`YsL R R:  Z$ #  *. 1B 7l <\ C~ J8 P: V  [& `crt0.ols.o_sccsidcalloc.octime.oOftime.ogetpwent.ogetuid.ogetgrent.olstat.oreadlink.ofprintf.ofprintf.oprintf.oprintf.oqsort.ostrncpy.oatoi.ofgets.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negrew.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_dotp_lstatlmult_outrangename_qsort_printf_realloc_utmp_fmtentry_outrangegroup_cat_dflg_subdirs_strncpy_formatd_strcat_formatf_Cflg_cflg_names_outrangeuid_getdir_fprintf_getgrent_setgrent_closedir__flsbuf_usetabs_Lflg_lflg_getpwent_setpwent_Aflg_aflg_ctime_getgroup_groups_fmtlstuff_readdir_sprintf_uflg_endgrentldivt_calloc_fmtinum_tflg_endpwent_strcmp_m1_iflg_m2_m3_sixmonthsago_m4_m5_m6_m7_m8_gstat_m9_gtty_sflg_m_savestr_outrangegid_strcpy_stat_Rflg_rflg_malloc_readlink_time_fcmp_gflg_strlen_getuid__iob_fmtsize_isatty_qflg_fmtmode_Fflg_fflg_getname_opendir_now_cfreeulmult_freeuldivt_dysizelmodt_localtime_ftime_asctime_gmtimecerror_atoi_fopen_fgets_fclose_rewind__pfile__print__filbuf_read_fflush_fstat__sibuf_lseek_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_close__lastbuf__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_errno_creat_openptwoulmodt_ioctl_stty_sbrk_end_brkb[blѹQ  **byX`hpx ) hS<$G"I#HTHS/N4 /NӤXNuNuNV.HnHyNPHyLN8XHyLNXN# xJg/NXJf.N/NLX-@Jf # x` n# xHy N XJga BHz4/aPR mHyHyLNP# pJf HyLHyHyN( a n P rfR n P rgD g. n h -f,Hy n h(HH/a\PJf /. /.az` /. /.a HPa@..N^NuNVHx/.NP g/. /.NPN^NuNVH ..*n JgHHfp`BL N^NuNVN/N0X/9 xHyZHyla HnHylNPJmp0. @fHyHylNP/9 xHylNP` n h -f n h (qg n h (pfR B` n h (ff* mx n /(HylNPX S`X n h (rf # (`< n h (hg n h(HH/HyHyN( aX S nHyHylNP# dJfHyHyN(P`HylaX/9 p/9 daP/9 dN"X/9 pN"Xa|Hy#HyLNP# pB |-|B .HlJ (f 9HS-@Hy N XJgB`$JgHxHy/.a -|J gR`Hy N XHy%HyN(PHyNrXHyHxHy N Jg*9 HH mgRn -gnL !gn0 gnHy(HyN(PBHy/HyN(PHy7HyN(PHyUHyN(PHy^HyN(PHy{HyN(PHyHyN(PHyHyN(PHyHyN(PHyHyN(PHyHyN(P` B |J |ga`Sl`B 9  g$ 9  gHyNXRB` 9  gJ9 fHx! . R/NhPJg . R/HnHy~` . R/HnHyHn|NHyHn|NP-@f HxNӤXJgHy/.NPPJfp`p`p//./.a /.NXJgp`B/NӤXL lN^NuNVHyHyN(PN^NuNVH BB*n ` ^g JgR !f !g ^fB/. /.a `,/. NX-@f /. HyHyN( B`/. HyZHna Hn\HnNPJm6p0.b @f"HyHnNP/. HnNPHxNBX.HnanXJg~HnaXHyHnNP# d/NBXJ dfaHnHy`( n/( /(HnNR Hy N8X-@HyHyNP-@JgFJgBBBHxHxN.-@/9 dNX//. HyHnNHx/9 d/.a /9 dN"XJgtJgn n (3/( Hy/(N n (3HxHyBHnNXR/Hn/.N/.N2XabpL N^NuNVHz/.aPHy$HyN(PJgHxHy N2PaN^NuNV.J fJ gB`/.Hy NP/9Hy NP/9Hy NPHy N8XHy NXBHy Hy aP.Jf# `|HnHy NPJl" .R op`>HxNDX`BHnNX .".mHy N`..N^NuNVHy NXB N^NuNV.B/.NP.Jm`/.NXp`,/N2X/. /.NPJm/.NXB..N^NuNVJ gavHyLNXHy NX/9 hNӤXN^NuNVBB` . Ю @ .Ю"@RR . Ю @JfB` .Ю @ .Ю"@RR .Ю @Jf .Ю @BN^NuNVH0*n(n `R  g  g  gJfB`  g  g  gJg`B L0N^NuNVHn/.N.PJm: nfp0. f/.Hy&HyN( B`pN^NuNHxHxNX-@HyXN XJg8/.HxNP/.NXN^NuNVHxHyXN2P`PJg" .c .`-n-|HzHxNP-@/.NXN`N^NuNHxN@eNuNHxN@eNu o HBNu o /L.NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^Nu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNuNVH8*nBNXN(@Jg,HU/NPPJg&l`XJgHU/NPPJfN L8N^NuNVJ`fHyhHyTNP#``/9`NX .dN^NuNVJ`gJdf/9`N"XB`N^NuNVH0J`fNHyjHyTNP#`f2BL0N^NuNVH0*n`<(n `,f" `./9`HxHyY(N -@g @ #gHyl/.aP*@gBHyo/.aP*@gB#],]L/.NX y]L #]H#]D`R  g  g#]<#]P]@(y]@HyrHUaP*@f8`8R`4Jg8  g  g]d(HyuHUaP*@gBfB <]<`RJfRfBL0N^NuNVH0BNXN*@JgJ//.NPPJg(m`XJg//.NPPJfJ g/. /- NPPJfN\ L0N^NuNVJfHyHyxNP#`/9NX .N^NuNVJgJf/9N"XBN^NuNVH0JfNHyHyxNP#f2BL0N^NuNVH0*n`L(n `<f2 `>/9HxHy]N -@g @ #gHy/.aP*@gB#aHy/.aP-@Jg @BR n  g  gHy/.aVP*@gnB/.N,X#a#a#aa(yaHyHUa P*@f8`8R`4Jg8  g  gbxd(HyHUaP*@gBfB <a`RJfRfBL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NߪPJmJn -|`-nf +|`D/.NX+@f,mJf,0-g-HHb|+@`m+n f09gHyNrX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|` eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/N2XHx` afvJgp`p//.NFP.lB 3f6Hx/.NP.Jg Jm/N2XHx/.NFP.Jm.HxB/N `Jgp`B//.NFP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NF N^NuNVH *nA-HB| 0f|R xg Xf|` "NHH0`hrA`^HH5 @f fNHH5 @Dg6HH HH5 Agra"Ё.Rf .f .찎d @ XR`8JgHH5 @g n XA .쐈* S b@0;N*N... `p .r"..` .r".t婀".` .r".t婀".ቀ".`pL N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 93l  @*PJgTn&@b 1Rk$FYfzError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNrXBB-HH/N B+mm0-gm*nN^NuNHxN@eNuNHxaN@eNuNVH0N"-@f.B/.HyHyHyNHxNXHxHxNP*@HxHxNP(@HnNX-@g f f-|HUHxNPHTHxNP .L0N^NuNVH0*n Jm m#3p`T .3 @(P .3 @ gf ` <4//.Hx0N` `NqL0N^NuHxN@NV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNHx;N@eNuNHxN@eJgBNuH // |3 pNLNw //W.BN@d W/N WNNHxN@eNuNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNHxN@eNuNVA-HA#=|B-n-|Hn/. NLPSm .R @BHH`HnBNМP .N^NuNV(.-nBb`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NМPRb nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH5 @gT nHH0-@*LZ`0SR`*0bb1 nRJfbc0R 9nB <bL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NߪPJmJn -|`-nf9HH/NߴXJgm+|4(+|4(+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N2XJl~0-g /-NNXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N, n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N\PJlB`pN^NuNVH B/.NFP. g `/N2XB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHx N@eNuNVH0Jc$f8 <c(#c$ <c$#c(#c(c0#c$c, .^rN.*yc,Bc8 g`(*(U g " Ҁe " Ҁd(M *@bc0fc$gB`Rc8 c8o "<N#c8BNNX(@ 9c8" Ҁe 9c8/NNX(@g yc0 9c0Xg yc0  9c8" ҀY(#c0 <c$ A ` " Ҁ#c,c,c A#c4 A 9c,*A L0N^NuNVH0*n(MY#c, (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ c4 L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL rmail: cannot reopen %s for reading wmail: cannot open %s Mail saved in %s null name researcresearchmail: can't create proc for remote %s %suux - %s!rmail \(%s\)uux - %s!rmail %sw/bin/mailUsage: mail [ -f ] people . . . mail: can't send to %s /amail: cannot append to %s localhostbiffudp%s@%d mail: %s has more than one link or is a symbolic link vax.lock/usr/spool/mail/tmXXXXXXM:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/etc/passwdrr//bin/shsh-c/etc/utmp/etc/hostsrr# /etc/servicesrr# ,/ Unknown error: F/bin/shsh-c-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ /etc/ttys/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83c<. 40<#L+\3<DLlZ|bjfuL(8xeXTXl`.((h v.'00D8AJ S \Dfpx (8,q..  ,280A$JPY(b8ku} 4`FLLV bͰͰ Ͱ',М5Ӥ<C.KSYԂ`eiruԪx|?Dڄڐ,$۔`d#+x/ 5:VA֪HڼNڔUټ]c4in"w֘~nz(T ?&*٢ .~f: ըX'.ی7ۨ?ۨGOrYc<hw{.<$[$Pވ t;ߤߴ3 ,@P!<|'094@tHRt\f<kzZ~<Ӥ~4r0    .q, |"D+ f 16  ? p E   M 8 V^^Af  (o8w~vher,D (  0l2,HCh | d-R01B wVD"L,=4I<D  hK  lSLr[W\buj"t  pzZFhJt.  x+-8 9 x P .   | " $J -o 3h =  C M U [  `;2 g0 o  y  4L !    $   or . ` 3ߴ e c "   x8   |  O '" -?t 8F > E N V _ ffМ o y      p z r   XT  F     L yN    ! - 9 E PL\ \L hs tߪ {   3  4     3 4 `   Q n gͰ   ۚ &ۨ - 3, 9J ??ڠ EV K U  4( ]iz d, k qy x[N ~  Y s ׬ Qp Rۚ Z Zք  $ [ވ Zt P  \  < 7x N  c< : !crt0.omail.o_SccsIdOumask.ochown.octime.oOftime.ofgetc.oftell.ogethostname.ofputc.ofputs.ogetpwnam.ogetpwuid.ogetpwent.ogetuid.olink.olstat.omktemp.oaccess.ofseek.opopen.odup2.opipe.ogetenv.ogetlogin.ofdopen.ofprintf.ofprintf.oindex.oprintf.oprintf.osetbuf.osetuid.osleep.oOalarm.oOpause.osetjmp.osetjmp.ostrcmpn.ostrncmp.obcopy.obcopy.oretbloopbwdbytesgethostbyname.ogethostent.ogetservbyname.ogetservent.oatoi.ofgets.ofilbuf.ofopen.ocreat.oinet_addr.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.osendto.osocket.osystem.oOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.olseek.otime.ogettimeofday.ogetpid.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ottyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_sjbuf_safefile_iop_lstat_atoi_delflg_strncmp_printf_fputs_sendmail_ftell_strcmpn_flgf_cat_curlock_flgp_locked_locktmp_copymt_pclose_forward_system_popen_index_strcat_gethostname_sendrmt_setjmp_fprintf_lfil_mailfile_longjmp_dead_nlet_usage_execv_wait_malf_chown_setuid_umask_unlock_sleep_getpwnam_getpwuid_isfrom_getarg_setbuf_error_hseqno_fflush_ctime_unlink_getlogin_tmpf_maildir_bcopy_sprintf_printmail_lock_fgetc_fopen_socket_setsig_line_fgets_link_lockname_getservbyname_gethostbyname_my_name_strcmp_creat_changed_fork_netname_done_bulkmail_resp_maillock_sendto_from_let_close_perror_biffaddr_rmail_lettmp_strcpy_stat_signal_time_strlen_any_getuid_lock1__iob_getenv_isatty_fseek_copyback_fclose_delete_forwmsg_mktemp_copylet_fputccerror_dysizelmodt_localtimeldivt_ftime_asctime_gmtime__filbuf_lseek__flsbuf_getpwent_setpwent_endpwent_rewindulmodtuldivt_access_getpid_execl_pipe__exit_fdopen_dup2_read_open_ttyslot__lastbuf__pfile__print_free_alarm_pause_ovbcopy_endhostent_gethostent_sethostent_inet_addr_endservent_getservent_setservent_fstat__sibuf_malloc_errnoulmult__ctype_lmult_sys_errlist_write_sys_nerr__sigfunc__sighandler_syscall_execle_execve_gettimeofday_fcvt_ecvt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwo_rindex_ttyname_closedir_readdir_opendir_gtty_ioctl_stty_realloc_sbrk_end_brkb[lق@ Nby*bylt| 0*LZ`0SR`*0Cb1 nRJfCc0R 9nB <CL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n\f9nHH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|H` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNX/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDKS\eFlqNxdl, Ld8 ?zd`#+2P8j?DJ.QY`gmXt|td$.<R<|3 '/l9CM<Raep<t{~4r0.H  $d!n6'f-f6<0CFILOX_nekq?w}X  yL;3ixd[ LYZ sz Q!R-3Z: #BGNT [a7jpw DT|crt0.omkdir.o_sccsidmkdir.ofprintf.ofprintf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_fprintf_perror_mkdir__iobcerror__pfile__print_sys_errlist_write_errno_sys_nerr_strlen__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lق2) Pby*by  0? $G"I#HTHS/N4 /NtXNuNuNVH0 l HyHyNHyN.*nBg fp0//.Hy`p0//.HyN| RJGg"gSm@ 9R @<HH`8Sm 9R @>HH`HyHxNlPL N^NuNVH8*n(yJg/HUa"P&@Jg ` =f `0BL8N^NuNVH0*n(n gJf ,=gBL0N^NuNVA-H#Hn/. NP n0( gp`BN^NuNVA -H#Hn/.NP09 gp`BN^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH *| 90l 0 @*PJgNe2Ti|Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV(.-nBF`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NlPRF nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@*LZ`0SR`*0Fb1 nRJfFc0R 9nB <FL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N*PJmJn -|`-nf9HH/N4XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N^XJl~0-g /-N~XBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JGf8 <G#G <G#G#GG#GG .^rN.*yG BG g`(*(U g " Ҁe " Ҁd(M *@bGfGgB`RG Go "<N#GBN~X(@ 9G" Ҁe 9G/N~X(@g yG 9GXg yG  9G" ҀY(#G <G A ` " Ҁ#G G c A#G A 9G *A L0N^NuNVH0*n(MY#G (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ G L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLFusage: mt [ -f device ] command [ count ] -t-fTAPE/dev/rmt12mt: unknown command: %s mt: negative repeat count %s %s %d failedmtunknown tape drive type (%d) %s tape drive, residual=%d ds er%s=%o%s=%x@(#)mt.c 4.7 (Berkeley) 83/02/26weofeoffsfbsffsrbsrrewindofflinerewofflstatusTapeMasterPROTBUSYRDYEOTBOTONLEOFArchiveEnaReadyEnaExcepCatchReady Burst Xfer Reset Request OnlineInterruptEdgeReadyAckExceptionDircReadyNoCartNoDrive WriteProt EndMedium HardErr WrongBlock FileMarkInvCmdNoDataFlakingBOT42GotResetUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$G. 40!`<+<5|>|G.QXqa$0js|&Flt.Rz ?!$(07T>EKP`W^cksd{04H&zdh> J$! &?/6>EKSrZ`glNry6 x(\xxB<<$$!4*3X2l9|@HQdX`$jt~<<t~4r0q|R "<+fl4 :4?G YOrU\d j$r.x` 0 0nfFjx?p &  #y~)LB1*8;^?IQ34Yah &piJw~x[Ys|Q@Rj*ZT|7~ Gjcrt0.omt.o_sccsidgetenv.ofprintf.ofprintf.oprintf.oprintf.ostrncmp.oatoi.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ofstat.oisatty.oclose.oopen.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_atoi_printf_strncmp_printreg_status_mt_status_ioctl_fprintf__flsbuf_mtfd_com_strcmp_mt_com_open_tapes_perror_tape_strlen__iob_getenv__pfile__print_sys_errlist_write_errno_sys_nerr__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exit__sibufd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodtcerror_gtty_stty_realloc_sbrkuldivt_end_brkb[lٹ Q7**by  0= $G"I#HTHS/N4 /N,XNuNuNV-| o. n h -f n (R/NX-@SX l HyHy4NPHxN,X/.NX . X/ n /(N,P n /( 9 @/HyPHyNHxN,XN^NuN0Hx"N@eNuNVHn /.aPN^NuNVlH ~BHyN$X-@f-|Hx//.NPJg <` .*@Hn|/.HUa6 *@` gfJg # pL lN^NuNVH8*n(n &nJg :g -g`-||A|-H-|x` xm #`RxA| .xR .xЮ "@ fHn|Hy|N P``R bT/NX/. Hn|N P 9 g* gZ g fR` .g/`JfBJgR `BL8N^NuNVH0*n(n `(Sm",R AHH` HT/N$P.HH,f L0N^NuNVH8*n(yJg/HUa"P&@Jg ` =f `0BL8N^NuNVH0*n(n gJf ,=gBL0N^NuNVA-H#Hn/. NP n0( gp`BN^NuNVH *n.f `JfBL N^NuNVBJg>HxNX-@HyD|NXJg8/.HxNpP/.NXN^NuNVHxHyD|NP`PJg" .c .`-n-|HzHxNpP-@/.NXN`N^NuN0HxN@eNuN0HxN@eNu o HBNu o /L.NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^Nu&8HTfv-ARap8Wt,\s1Me&:M\Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNVH0*n Jm m#p`T . @(P . @ gf ` <//.Hx0N `NqL0N^NuNV/9Hn /.N~ N^NuNV/9/. /.N~ N^NuNVA -H .X @Jf n/Hn /.N~ N^NuN0Hx;N@eNuH // | pNLNw //W.BN@d W/N0 WNNV4.-nBD`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/N$PRD nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN<-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N0PJf/./.NXPJfHnHn .R l .R`p//./.N8-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NtgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N<`S n0A .ذbJn/9/9 .".Ntfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N0PJf/./.NXPJfHnHn *LZ`0SR`*0Db1 nRJfDc0R 9nB <DL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N& .B`T0-f(mfHn-HH/NPJmJn -|`-npf9HH/NXJgm+||+||+n 0-gl(m m R Э "-d f -,/HT-HH/N& .+L`/.NBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N PJlB`pN^NuN0HxN@eBNuNV/. Hyt /.N2 N^NuNV/. Hy@t/.N2 N^NuN0Hx6N@eNuNVH0JEf8 <E#E <E#E#EE#EE .^rN6.*yE BE g`(*(U g " Ҁe " Ҁd(M *@bEfEgB`RE Eo "<N<#EBNX(@ 9E" Ҁe 9E/NX(@g yE 9EXg yE  9E" ҀY(#E <E A ` " Ҁ#E E c A#E A 9E *A L0N^NuNVH0*n(MY#E (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN6.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ E L0N^NuN0HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL#/9Hx HxHy|N e|gHxHy.Hy|N JfRBB/9N< Jg./9a,X xo y/Hy7NTPB/9Hx HxHy|N |gP |gD  |g8`( |g` |gR  |gDHy=`JfHn y(HH/NP  |f <`p йййй -@Hx//9N< 9r Nf*JfHyHBaP`\  |f <`p йййййXJg"9`".cHyUHxa8PBJtg/9tNXBt`/9Hx HxHnNJgp.gp.gJpgJfJf~JfHx NlX`$ R"HA HABAЁ//.NHP-@JfHyHxafPA "HA HABAЁЮ"@"#h#hRSl Jg"/9NXXm Hy`h/9HxHxHyN gHyBaP`/9NlX#tJfHyHxaP/9Hx 9Y/ 9tX/N gHyHxahPB` "HA HABAЁЮ @Jg@ $HB HBBBЂЮ @$Թt "HA HABAЁЮ @ ` "HA HABAЁЮ @ Rm|J(fHzHx //.NJf xo0J,f(Jg <4` y /HyNTP//.afPJg/.NXBJtg/9tNXBtJg/9aXJfx/9NXLN^NuNVH *nB` "HA HABAЁ" Ҁ A(, gJ,gFJg y/Hy NTPJg <4` y /HyNTP "HA HABAЁ" Ҁ A/ "HA HABAЁ" Ҁ A(/aX/ "HA HABAЁ" Ҁ A0(/ "HA HABAЁ" Ҁ A(/ "HA HABAЁ" Ҁ A/(HyNT` Jg6 gT gP gL gH gD`D ugD`N|u "HA HABAЁ" Ҁ AJg|c`|a`|t` |d`|b`|fJfJ,gFJg y/Hy.NTPJg <4` y /Hy2NTP "HA HABAЁ" Ҁ A(g  ,Jf\ ug UfHy6NTX`, "HA HABAЁ" Ҁ A/(Hy?NTP/HyDNTP "HA HABAЁ" Ҁ A/HyINTPR m"L N^NuNVJ0g6 n"n (c 9F`> n"n (d 9FD`" n / n/N|"P 9FNN^NuNVH B/9/.N< /.Hx`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuN`HxN@eNuNVA-HA#=|B-n-|Hn/. NPSm .R @BHH`HnBNP .N^NuNV(.-nBG`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRG nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH9 @gT nHH0-@*LZ`0SR`*0Gb1 nRJfGc0R 9nB <GL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NV .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|&+|&+n 0-gl(m m R Э "-d f -,/HT-HH/NV .+L`/.NlX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NV . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NV g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNX/.NlXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N %s: bad formatno name listold format .o (no string table) or truncated fileout of memoryno string table (old format .o?)no string table (old format .o?)ran out of memoryerror reading string table %s: %s:%s:%08x - %02x %04x %5.5s %s %s:%s: %08x %c %s nm: %s:(%s): %s %02xGSYMFNAMEFUNSTSYMLCSYMRSYMSLINESSYMSOLSYMSOLPSYMENTRYLBRACRBRACBCOMMECOMMECOMLLENGPC-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$Gl. 40 t'</e9CTLTU.\Ndnw.@.0@@FG Z!( /. 7 ?<ELQDU^6a dh\mtz?VLb\8<>FNdl!,&- 4:AILOUdZcj8qx ?zd`Pj.X t#+3d;EdO<Trc.gr<vX$|3 \lDDT<\* v<P"P*`3l;AG~4MrV0] $c (iot u`|T|7H , 0 4yWJ 1p$ t x f|F@   t@ \(|0m7f>DsM TUN\Fblj ap.ve<} 8 6L [f  &.;` 8n6f &0-Fl3L9B$XJQnW]c?ioXyV  &3lixd[ LYZsz QRZP| <b" Gl' ,crt0.onm.o_sccsidatol.oftell.ofseek.ofprintf.ofprintf.oprintf.oprintf.ordwr.oqsort.ostrncmp.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_neglseek.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_errs_pflglmult_atol_qsort_printf_strncmp_ftell_realloc_oflg_nflg_fprintf_archdr_nextel_free_stabnames_aflg_error_strp_narg_mag_un_sprintf_uflg_archive_fopen_fi_fstat_namelist_strcmp_psymsuldivt_stab_compare_strsiz_fread_rflg_malloc_gflg__iob_fseek_xargv_fclose_off_lseek_fflush__filbuf__pfile__print_fwrite__flsbufulmult_read__sibuf_errno_creat_open_close__lastbufcerror__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_sbrk_end_brkb[lٹF Y\*(*(by 8< $G"I#HTHS/N4 /N8XNuNuNVH HnHy`NPX B o, n *P -fJgHH hgRn Xgn Hgxn Dg`o#`4|`4|`4|`4|` 4`@4`4`4`34`~ Og`r cgn bg`\ dgp`N wgn ogJ`6 xgX`(SX J4f##4 o\ n P +gPHyLHy< n /N Jf( n /Hy>HytN( HxN8XX S o n /aXz`JB`  @ "@0QfVR094HmJfHyRNhXz߹ HyL094H/HxHyN.ovJl RrN/Hy/9 a BB`  @ "@2R094HmB094Hln  @BPR`Hx/96/9 a S`m 9dRd @ HH`Hy`Hx N0PBN8XL N^NuNVH|z` 4gtJgNHx/96/.aB S`m 9dRd @ HH`Hy`Hx N0PB`4S`m 9dRd @ HH`Hy`Hx N0P gB 94?g4S`m 9dRd @ HH`Hy`Hx N0PB` g f,/ Ю /a`/ Ю @0/anPS`m( .Sfp `p "9dRd AHH` Hy` .Sfp `p /N0PRmhJf|LN^NuNV . g& g8 gD gP g`&HxaJXHxHx/.`Hxa0XHxHx `HxaXHxHx`HxaX=n .HH/aVXS`m 9dRd @ HH`Hy`Hx N0P.HH/aX`|HxaX=n HxHx./a S`m 9dRd @ HH`Hy`Hx N0PHxHx./a~ N^NuNV . @g g( g>`fHxaXHxaXHx Hx`:HxaXHxaXHx Hx `HxaXHxaXHxHx n/a N^NuNV oP lFHyUNhXS`m 9dRd @ HH`Hy`/.N0P`~ . b`@0;NVVVVVVV.N>V6F`JHyXNhX`:Hy\`Hy``Hyd`Hyh`Hyl`HxHx/.a N^NuNVJg .S//. .". N/a .". N-@ c8S`mW"9dRd AHH`@Hy` .W`$S`m .0`Hy` .0/N0PN^NuNV-n`8S`m 9dRd @ HH`Hy`Hx N0PR .mN^NuNVH0*n +fR xfR` -xfT#6` 0g 0f #6(M` .f # 6JfB`n 9n. ."96N\Ї0-@`FHH. 0l am4 fn, 6f ."96N\ЇW`RJf .fR bg Bf ."HAHABAЁ-@B/.HyLNP # L0N^NuNVH0*n (n -+fp`B,HTNX wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.N.P.lB 8f6Hx/.NP.Jg Jm/NXHx/.N.P.Jm.HxB/N `Jgp`B//.N.P.JlB`*B@Jgl` rgl`l L0N^NuNVH nh n0(g6 lJg0(f,-n Jf$HxB(HH/N "Ӯ` n0(f0Jo, .n$ (".m Ѩ n .` . .`B n0(g"H#h nh/. . / n(HH/N -@ nBJg n S m n (R!@S @`t/.NX`f n0(gV/NX n0(gB nh n"H#h/./. n(HH/N -@ fp`BLN^NuNVA-H# *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNV4.-nBDX`b y< S m. .R @HH y<"(R!AS AHH` /9< .R @HH/N0PRDX nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DN ЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N*LZ`0SR`*0D\b1 nRJfD\c0R 9nB <D\L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-n`f9rHH/NXJgm+|$D+|$D+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|L` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NJXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.N. N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NhPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JDf8 <D#D <D#D#DD#DD .^rN.*yDBD g`(*(U g " Ҁe " Ҁd(M *@bDfDgB`RD Do "<N#DBNJX(@ 9D" Ҁe 9D/NJX(@g yD 9DXg yD  9D" ҀY(#D <D A ` " Ҁ#DDc A#D A 9D*A L0N^NuNVH0*n(MY#D (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ D L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLhGhP.WN`i.\q|DXDDD08TTp xj >#',39?BHORV^elsyl~$pr(z `>P(P",)l07>BIO T?]dlsy6b< <<$ .Z$.<3BFQ<U]f3n(u8|H0pp<V<||8~4r#0*h2 7 =\DJP(Yf0b$j $ p6y@4ln jFp16N.L x4eP 8..;L <!)[1yJ7>=D DLTnZcnjifDo ud|.$<?4  $D3ix[ TY!s*@0Q7R.CIZPW|\hbiHo7txJ~ D6crt0.ood.o_sccsidfreopen.ofseek.ofprintf.ofprintf.oprintf.oprintf.ordwr.osetbuf.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_neg_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_max_wordulmult_putn_putx_fprintf__flsbuf_offset_addr_freopen_nword_setbufulmodt_putlx_lastword_cputldivt_line_baseuldivt_pre_fread__iob_conv_fseek_lseek_errno_creat_open_close_fclose_fflush__filbuf__pfile__print_fwrite_free_read_fstat__sibuf_malloclmult__ctype__fcvt_ecvtlmodt_isnanfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltiscerrorptwo_gtty_ioctl_stty_realloc_sbrk_end_brkb[lٺÁ F$*0*1by  (<$G"I#HTHS/N4 /NXNuNuNVN/Hy0NTPN^NuNVA -H#Hn/.NP09 gp`BN^NuNV4.-nBC`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRC nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|L-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NLX-@8/.NLXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|M PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|O`J.g-|QJ.g"/.NLX".-A< o-@ .Xf -|SL`-|dLA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN -@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|u`-|x`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|{`J.g -|}`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/98/94 .".N4gP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N `S n0A .ذbJn/9@/9< .".N4fp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Cb1 nRJfCc0R 9nB <CL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NjPJmJn -|`-nf9HH/NtXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN@/.N XN^NuNV .". nJ/H?Nt n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHx@N@eNuNVH0JCf8 <C#C <C#C#CC#CC .^rN.*yCBC g`(*(U g " Ҁe " Ҁd(M *@bCfCgB`RC Co "<N #CBNX(@ 9C" Ҁe 9C/NX(@g yC 9CXg yC  9C" ҀY(#C <C A ` " Ҁ#CCc A#C A 9C*A L0N^NuNVH0*n(MY#C (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ C L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL4JD t$l"&*2;D.KP6WL_cTinu|4|Lj p ?bLnHr 8Rv#)08?FL@S[\bks{L$p.pp<~:<dt3  d&0:<?NR]<ahpy ~4r0T .nffF 4$LV#t)/?5;@EL  TyZLbji;pz 3tj ithxL[4YBsbQRZ #  '-76<C DHM CTcrt0.opagesize.oprintf.oprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostty.oioctl.ogetpagesize.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_getpagesize__pfile__print__iob__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodtcerror_gtty_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[lѹω u*8*9by (0 HCL $G"I#HTHS/N4 /NXNuNuNVB l:Nh-@fHylNxXHxNX/.HyNxP` n -hNJ# 8g/. @/NPJfNN-@J 8gJg& y 8gHyNxXHxNXN y 8 hJgtJgnHyNX/Hy HNP y 8/(Hy HNxP# < y 8/(/NPJgHyNxXHxNXHyNX/Hy HNPHy HN,X-@JfHyNxXHxNXBB-| H`b zn(`N Zn`: al Al 0m 9n ` .R @HH-@f m m-| g f m-| g g f m-|Jf: l0 f <` </HyNxPR`xHy,NX/Hy HNPJgHyANxXHxNXHnN4XN"HA HABAЁ-@?@ .?@BAHH.-@ 9o^ Zo\AR mHnHy HNxP# fHyDHy0NPP#>`/9>NXN^NuNVJ>g/9>NJXB>N^NuNV.*n` :gRJfJgB *nN^NuNV.J>f"HyFHy0NPP#>fB`/9>HxHyNDN *@g#RHHUazX*@#RLHUajX*@HUNX#RPHUaPX*@HUNX#RTBRX#<R\HUa&X*@#R`HUaX*@#RdHUaX*@#Rh`  gRJfB <RH*nN^NuNDHxN@eNuNDHxN@eNuNVH N.fB`BHyHNP,mB "HAHABAЁ//N HxHyRl/N g /NX`/NX R|*|Rt  fSB <RtL N^NuNVH Hy]HxHyTNP/NP-@f -|8`B/.NPHxHxNXP-@Hn n(HH/NP0.H-@nHn n(HH/NP/.Hy_Hy`N8 Hy`NX*|R n S m n (R!@S @` /.NX. g gRd`BHybHy`N8PHy`NX=nHn n(HH/NP/.HxNXP 8g /.NJX <RL N^NuNVH0*n (|8`eB`^0,fBn  rg"l afHxB/.N `l -+f ll L0N^NuNVA-H# THn/. NtP n0( gp`BN^NuNVA -H#L THn/.NtP09\ gp`BN^NuNV.*nJg0-g /-NXms+n f mB `+m+| B*nN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N^PJmJn -|`-n8f +| X`D/.NPX+@f,mJf,0-g-HHR+@`m+n 8f09\gHyLNX0-gp` - //--HH/N *+mSl. fm0-gm`m B` mR*nN^NuNVH *|d 9 @xl  @*PJgP\n})?NZm~8Of&6Mq<QdError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV.*nHUNXBB-HH/N B+mm0-gm*nN^NuNVH0*n Jm m# @p`T .)X @(P .)X @ gf ` <//.Hx0N `NqL0N^NuH // |)X pNLNw //W.BN@d W/ND WNNVBHnNjPJlp`Jg n .N^NuNDHxtN@eNuNV4.-nBR`b y T S m. .R @HH y T"(R!AS AHH` /9 T .R @HH/NPRR nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N,X-@8/.N,XJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.N,X".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DNP-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9| .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr NP`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0Rb1 nRJfRc0R 9nB <RL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N: .B`T0-f(mfHn-HH/N^PJmJn -|`-nLf9^HH/NhXJgm+|)+|)+n 0-gl(m m R Э "-d f -,/HT-HH/N: .+L`/.NPX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N: . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N: g m p`BL0N^NuNV.*|8` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN /.NPXN^NuNV .". nJ/H?NT n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|8`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB  @f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNDHxN@eNuNDHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx NPX*@Jg*B L N^NuNDHxN@eBNuNDHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNDHxN@eNuNDHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N6 N^NuNV/. Hy@t/.N6 N^NuNDHx6N@eNuNDHx N@eNuNVH0JS4f8 <S8#S4 <S4#S8#S8S@#S4S< .^rNJ.*yS6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /etc/passwdrr/etc/utmp/dev/ttyr%s Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$/etc/ttys/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83SL. 40$(,7H@XIhT^g.8q8{xx.q.p$X4dtt~R )07"<ELT\bin r{~$?l*$TL %,,484>C~JQW^fl\r,wJP| ?B,N(R2V b! (0<7@HP,Y$Pa.ip.xJ<<[< (;Xh3 )07@I!P0X@aPjq(y¨(8<@Z<44DP~4r0   8x  <x!pT) 089`?  @FJPuFX"hbj 4 Hqm^yp!X4$,N.8pJD(qtP+  ;'08L@FLU_  Tgtoyu^|  XP:x )XQjnffFP 6%T+r1?7~= G  )O3hWP^ieTlHrx,y[vY"sBQRZ.4[<Z(  67,"(J/ SL49crt0.opasswd.o_sccsidchmod.ocrypt.ogetpwent.ogetuid.orename.ogetlogin.ogetpass.ofdopen.ofprintf.ofprintf.oprintf.oprintf.osetbuf.oatoi.ofgets.ofilbuf.operror.oerrlst.orew.oOsignal.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_pwd_printf_pw_getpass_crypt_passwd_chmod_fprintf_temp_errno_getpwent_unlink_getlogin_fdopen_pwbuf_rename_endpwent_strcmp_open_perror_strcpy_signal_time_strlen_getuid__iob_getpid_fclosecerror_encrypt_setkey_atoi_setpwent_fopen_fgets_rewind_read_lseek_close_ttyslot_setbuf_fflush_stty_gtty__filbuf__lastbuf__pfile__print_free_fstat__sibuf_malloc_sys_errlist_write_sys_nerr__sigfunc__sighandler_syscall_gettimeofday__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_rindex_ttyname_strcat_closedir_readdir_stat_opendir_ioctl_realloc_sbrkuldivt_end_brkb[1lٹ¬ e*A*Bby$,4<D @^ P$G"I#HTHS/N4 /N0XNuNuNVHy!8HyxNPHxHxNHP gHzvHxNHP .SЮ #aB oX n P -fP n R @HHf b@0;NzTr n P +fH n R /NTX#S`f mX n #S`R%<`R%8#<@` n R /NTX#<` n R /NTX#8` n R @Jg n PHH#`d# `VR`L n /aXJg: n /NTX#4f$HyHHyNP#4` n /HynHyN HxN0X`/. n /aPRJgJf BBaPaN^NuNVJg/9/9NPBN0XN^NuNV` n 9n 0lB`R nJfpN^NuNVJg/9/9NPHxNXN^NuNVHxN$X#Jg2Hn/NPp0.#Hx/9NPN^NuNVH0J%*LZ`0SR`*0f(b1 nRJff(c0R 9nB <f(L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NFPJmJn -|`-nxf9HH/NPXJgm+|E+|E+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N(X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|d` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|d`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB Ef6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N& `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx N(X*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /Nr +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jff8 <f#f <f#f#ff#ff .^rN".*yfBf g`(*(U g " Ҁe " Ҁd(M *@bfffgB`Rf fo "<N(#fBNX(@ 9f" Ҁe 9f/NX(@g yf 9fXg yf  9f" ҀY(#f <f A ` " Ҁ#ffc A#f A 9f*A L0N^NuNVH0*n(MY#f (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN".d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ f L0N^NuNHxN@e#TBNu /йT/@HxN@e 9T#TNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLcgZr<v$ ;@P3t l|!($<)8<2G<K R Zc0io~4ur~0 rXqT \A<8 >` E cD4   @  uf(&. 6W= C )H<P XFlaF(g(\ntu~ k  p  ;o n /XN  u! H !(, !4.d !8[$ Rn Y%8 %<$+O>3N9?DK 4T\ %@dl[ztyzrLF %H( EH E Qbwbf<\x&$4 ?,&,6=  EE<LV3P^ielrxy[LxYs8QR&Z&. HZ! t#7,2"9 f>Ccrt0.opr.o_sccsidchmod.octime.oOftime.ofprintf.ofprintf.ordwr.osetbuf.oatoi.ofilbuf.oOsignal.o_exit.osighandler.osyscall.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exitstart_main_environmcount_bufp_atoi_mopen_peekc_tpgetc_width_buffer_ifile_file_margin_ncol_pgetc_onintr_chmod_fixtty_tabc_plength_fprintf_mflg_lastarg__flsbuf__exit_setbuf_nspace_ctime_mode_tty_length_header_sprintfldivt_print_fopen_numeric_nofile_line_icol_col_fpage_done_colp_putpage__filbuf_fread_colw_stat_signal_isclosed_time_page__iob_obuf_ttyname_fclose_nexbuf_fflg_ntflg_putcerror_dysizelmodt_localtime_ftime_asctime_gmtime__pfile__print_fwrite_free_read_fflush_fstat__sibuf_malloc__sigfunc__sighandler_errno_syscall_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_close__lastbuf_isattyd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_creat_openptwoulmodt_strcat_closedir_readdir_strcpy_opendir_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[Llق:G GbP*Jby8@HPF (= $G"I#HTHS/N4 /NXNuNuNVHnNXJf&HnHy4HyN HxNXHnHy=N,PBNXN^NuNVtA-HBDBHnHydNP=n-nHnHyfNP .f 0.ngHyhNX-@fNHyk/.NP/.HyaP/NXBN^NuNVH0*n(n BJgjRR`HyNXJlHy`Hnv n/NrP0.nvfp .xf0/.N*LZ`0SR`*0Db1 nRJfDc0R 9nB <DL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NrPJmJn -|`-nf9HH/N|XJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N,X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx N,X*@Jg*B L N^NuN HxN@eBNuN HxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuN HxN@eNuN Hx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N" N^NuNV/. Hy@t/.N" N^NuN Hx6N@eNuNVH0JDf8 <E#D <D#E#EE#DE .^rN&.*yEBE g`(*(U g " Ҁe " Ҁd(M *@bEfDgB`RE Eo "<N,#EBNX(@ 9E" Ҁe 9E/NX(@g yE 9EXg yE  9E" ҀY(#E <D A ` " Ҁ#EEc A#E A 9E*A L0N^NuNVH0*n(MY#E (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN&.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ E L0N^NuN HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL*ENJPW_Zfmxsz4$$H.HH<Vr<<;l|3 #*4;BK!RZ,cjr|<6< ,~4r0, ^.Z<!*1r8!@F O V ^lfXonuf{ffF, $$.Lj?v  yL;< ,3|B#,*i1L8@>x$E[nKR XYas:jpQwRzZ $`"7& E Dcrt0.opwd.o_sccsidgetwd.ochdir.ofprintf.ofprintf.oprintf.oprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_fprintf_getwd__iob_closedir_readdir_chdir_fstat_strcpy_stat_opendircerror__pfile__print__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_fflush_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_open_read_ioctl_stty_realloc_sbrkuldivt_end_brk_errnob[_lق Xby&*RbyLT\dlt 8= $G"I#HTHS/N4 /NXNuNuNV.BBNXJfRBB o n h -fX n *PSJ-f4` igB rg@ n /Hy4NPHxNXRJgHH ffR`R`R`B/././. n /aR`0HyKX n /NlPJfHyNHyLNPSn/9NX*nN^NuNVHn/.NPJgJ fL/.Hyf`0p0. @fzJgdHx/.NnPJlJ f/.Hyz`Jg"Jg/.HyNPaJg/.NX-@fx/.HyNPHxNX`X nJgP P/aXJf@ .P//.HyHnN  .R//././. Hna/.NX-@f/.NX/.a"XJfJg/.HyNPa.Jg/.NXJlHyHyLNP/.NX`/.Hy`Jg/.HyNPaJfZ`J fPp0. g*LZ`0SR`*0E8b1 nRJfE8c0R 9nB <E8L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NZ .B`T0-f(mfHn-HH/NPJmJn -|`-n8f9JHH/NXJgm+|% +|% +n 0-gl(m m R Э "-d f -,/HT-HH/NZ .+L`/.NpX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NZ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NZ g m p`BL0N^NuNV.*|$` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NbXJl~0-g /-N"XBBBB BmB- L N^NuNVN8/.NpXN^NuNV .". nJ/H?Nl n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNdHx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N0PJlB`pN^NuNVH B/.NvP. g `/NbXB`Hx NpX*@Jg*B L N^NuNdHxN@eBNuNdHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNdHxN@eNuNV/. Hyt /.NV N^NuNV/. Hy@t/.NV N^NuNdHx6N@eNuNdHx N@eNuNVH0JEf8 <E#E <E#E#EE#EE .^rNj.*yEBE g`(*(U g " Ҁe " Ҁd(M *@bEfEgB`RE Eo "<Np#EBN"X(@ 9E" Ҁe 9E/N"X(@g yE 9EXg yE  9E" ҀY(#E <E A ` " Ҁ#EEc A#E A 9E*A L0N^NuNVH0*n(MY#E (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNj.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ E L0N^NuNdHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL $G"I#HTHS/N4 /NgSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg . @` . @R mHH. ]g*Jg . @` . @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9/9 .".Nl< 0N///./. 9"9N8N-@-A`RHH. q @f .gZ`t/9/9 .".Nl< 0N///./. 9"9N8N-@-ASHH. q @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH. q @fJl D*܅-FJl D,B g(  @/(/ .".N8-@-AJg R mJl/./. .".N`/./. .".N8-@-A/.//N -@-AJl ` .".L N^NuNVH8*n(n ..&MJfSgSlSB L8N^NuNVH0*n(n ..SmfJfB`JmHHSHHL0N^NuNVH0*n(nS o2Sm -R @` HUNX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|d`D/.N *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n Jm m#%p`T .%d @(P .%d @ gf ` <,//.Hx0NX `NqL0N^NuHxN@NV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuNLHx;N@eNuNLHxN@eJgBNuH // |%d pNLNw //W.BN@d W/NL WNNVA-HA#`=|B-n-|Hn/. NPSm .R @BHH`HnBN4P .N^NuNV4.-nBFP`b y` S m. .R @HH y`"(R!AS AHH` /9` .R @HH/N4PRFP nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHq @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHq @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-| -n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-|! PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|#`J.g-|%J.g"/.NX".-A< o-@ .Xf -|'L`-|8LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN<-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|I`-|L`Jl-| n P @-h-h/./.N@PJf/./.NhPJfHnHn .R l .R`p//./.NH-@Jg -|O`J.g -|Q`J.g-|SAU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9 /9 .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N<`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HHq @gpE`peS n`Jl-| n P @-h-h/./.N@PJf/./.NhPJfHnHn *LZ`0SR`*0FTb1 nRJfFTc0R 9nB <FTL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NB .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|%+|%+n 0-gl(m m R Э "-d f -,/HT-HH/NB .+L`/.NBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNLHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNLHxN@eBNuNLHxN@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNLHx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0JFf8 <F#F <F#F#FF#FF .^rN6.*yFBF g`(*(U g " Ҁe " Ҁd(M *@bFfFgB`RF Fo "<N<#FBNX(@ 9F" Ҁe 9F/NX(@g yF 9FXg yF  9F" ҀY(#F <F A ` " Ҁ#FFc A#F A 9F*A L0N^NuNVH0*n(MY#F (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN6.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ F L0N^NuNLHxN@e#XBNu /йX/@HxN@e 9X#XNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLFrom %s %sremote from %s!remote from somewhereremote from %s -em -f%s/usr/lib/sendmail ''wpclose: status 0%o /bin/shsh-c@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$TF. 40#fL+X2X90B.LV^v$fo:v} .,Xxx F'FP.H7H>HEJ4S<ZXbXjtpw||nB?p(tv ,'~.3:BFLdQXB_Te,lTtz0p ?: f"@)/6>E$N@V@^g$n.v~><<3$8Hp! A<$.8$B<G,VZFe<i p w<L<~4r0A8LHvb \Fx+  !p$!.'f40z7=&CJ0RX;*_goXuL|T `xD:$njps A2.x!?8'->3L ;B dJ<R %d\,i %pXy onfHhF<@B  %y3i[X YDQ R2,2Z9 >EKRX7ag6n Fsxcrt0.ormail.o_SccsIdfputs.opopen.odup2.opipe.ofdopen.ofprintf.ofprintf.oindex.oscanf.odoscan.oatof.oatof.o_exp5_twoe56strncat.ostrncmp.ofgets.ofilbuf.oOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTrindex.ofstat.oisatty.oclose.oread.ostrcat.ostrcpy.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_strncmp_fputs_pclose_popen_strcat_index_sscanf_fprintf_Debug_sprintf_strncat_fgets_strcpy_rindex_strlen__iob__flsbuf_execl_pipe_wait__exit_fdopen_fork_close_signal_fclose_dup2cerror_lseek__lastbuf__pfile__print_fscanf__doscan_scanf_atof__getccl__ctype_fsinglei__instr__innum_ungetcieeeused__sctab__filbufffltifdivi_ldexpfcmpifmulifaddi_read_fflush_fstat__sibuf_malloc__sigfunc__sighandler_errno_syscall_execle_execv_execve_fcvt_ecvtlmodt_isnanldivt_isinfffixi_modf__cleanup_write__sobuf_free_isattyd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lٹx N*c*cby| 0*LZ`0SR`*0Cb1 nRJfCc0R 9nB <CL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N~PJmJn -|`-n\f9nHH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|H` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNT/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JD*LZ`0SR`*0D8b1 nRJfD8c0R 9nB <D8L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N~PJmJn -|`-nf9HH/NXJgm+|$+|$+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N0X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*||` HUaX e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N0XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (||` eB` 0,f -+fp`B, wf0Hx/.NTP.JgJm/NXHx` afvJgp`p//.NP.lB Df6Hx/.NTP.Jg Jm/NXHx/.NP.Jm.HxB/Nz `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN$HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN$HxN@eBNuN$HxN@eNuN$HxN@eNuNV/. Hyt /.N& N^NuNV/. Hy@t/.N& N^NuN$Hx6N@eNuNVH0JDf8 <D#D <D#D#DD#DD .^rN*.*yDBD g`(*(U g " Ҁe " Ҁd(M *@bDfDgB`RD Do "<N0#DBNX(@ 9D" Ҁe 9D/NX(@g yD 9DXg yD  9D" ҀY(#D <D A ` " Ҁ#DDc A#D A 9D*A L0N^NuNVH0*n(MY#D (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN*.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ D L0N^NuN$HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLtF@OX_DdksXw}6txNZ4 ?  %+27^=DFLSZ8`govl$.Tt.t<N<x 3!( 009@HR\f<k z~:<$0~4r0 tN ,.| [Bf|%+LR3~: B0J(SnYf_elF0rxz$ *?6  $y; 30iZ x[.Y$s-3QP:RzF:LZdSzZ Da.Thn$uz&7 * Dcrt0.osize.o_sccsidprintf.oprintf.ordwr.ofilbuf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.oopen.oread.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_header_fopen_fread_fclose__pfile__print__iob_fwrite__flsbuf__filbuf_read_fflush_fstat__sibuf_malloc__ctype__fcvt_ecvtlmodt_isnanldivtfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_free_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_errno_creat_opencerrorptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lٹ HI*s*tby (=x $G"I#HTHS/N4 /NXNuNuNV.HxHxNPHxHxNPHxHxNPHy4NX#|Hx/N`P/NbXHx/9|NvP#TJlHy@NhXHxNX~` Ю @/aHX XnRm/9TNbX/9|NX/9XNX..N^NuNV.B/.NvP.JlD/.HyY`" \gN  \gB/.HyiNhP#X`JHx Hy\/N \fJlf&JtfJxf/.HyNhP` 9`йd-@Bx#xt#tlBB/9TN Hx Hy\/9TN  \f/./9T//.aJf /NbXHx/.N`P.Jl/.Hy`BB/9TN /.//9T/.a$Jg #X/NbX..N^NuNVH`n.< l../Hn/. N ,g"/.Hy` /.HyNhPp`&/Hn/.N ,fПJfBLN^NuNVA -H#Hn/.NP09 gp`BN^NuNVH0*n Jm m#p`T . @(P . @ gf ` <8//.Hx0Nd `NqL0N^NuH // | pNLNw //W.BN@d W/N WNNV4.-nBE `b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPRE nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHHe @gT nHH0-@HR ."HA HABAЁЮH-@`B nHHe @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.N*LZ`0SR`*0Eb1 nRJfEc0R 9nB <EL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N.PJmJn -|`-nf9HH/N8XJgm+| +| +n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXHe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NbXJl~0-g /-NXBBBB BmB- L N^NuNVN0/.NXN^NuNV .". nJ/H?Nd n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNV/. Hx/.Nv N^NuNHxN@eNuNVH N*.*nJfS` r NL0 r N.S XgR|a` zf <L` RB/.NP f .L N^NuNHx!N@eNuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHx N@eNuNVH0JE`f8 <Ed#E` <E`#Ed#EdEl#E`Eh .^rN.*yEhBEt g`(*(U g " Ҁe " Ҁd(M *@bElfE`gB`REt Eto "<N#EtBNX(@ 9Et" Ҁe 9Et/NX(@g yEl 9ElXg yEl  9Et" ҀY(#El <E` A ` " Ҁ#EhEhc A#Ep A 9Eh*A L0N^NuNVH0*n(MY#Eh (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Ep L0N^NuNHxN@e#PBNu /йP/@HxN@e 9P#PNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLl D$G"I#HTHS/N4 /NpXNuNuNV.HnHy PN(P# #  Hy Hy@tHxN Hy Hy@tHxN Hy Hy@tHxN Hy Hy@tHxN #   fBa XBNpX  f0Hy< y /(NPJfHxaXBNpX  fHy@ y /(NPJfHxaXBNpX`# @ `X y # HyKaXJfHyNaXJg# Hy HytHxN JlpHyR`X#   9  m  Hy HytHxN JlHyXN` Hy^a\XJfHyeaLXJg.  9  m `HyiaXJg0B Hy HytHxN JlHym`jHysaXJgt   #  P 9  m  Hy HytHxN JlHyw`*|d`/aDXJgzS gX y P uf m` y P ^f0 y P (?fp` y P( m`v y P"m`d JfpHy}aXJg   `4HyaXJg&BHy tHxN JlHy`B`B .4 @/aDXJg$ .8 @    `R .4 @JfHyaXJgBHyNnP-@JlHyNXHxNpXHy Hy@t/.N B`H9 HH".8 Af( .4 @/HyNPBNpXR .4 @JfHyNXHxNpXB`| ."HA HABAЁ @/aXJgN ."HA HABAЁ @ F ."HA HABAЁ @  R ."HA HABAЁ @JfbJ g/9 HyHy PN S n,Hy Hyt HxN Hy HytHxN Hy HytHxN *nN^NuNVJ fB`>B 9 Ю @".Ү Af .Rй @JfB pN^NuNVH  fHy`$  fHy` fHyHy PNP9 9 g,9 HH/Hya P9 HH/Hy`9 HH/Hya P f <` < /Hy PNP.9 g  g< gHy Hy PNP @gHyHy PNP g  g&  gp`B/Hy PNP g f& fp`B/Hy PNP g f& gp`B#/Hy PNP g g& gp`B*/Hy PNP g g& gp`B2/Hy PNP  gp`B;/Hy PNP g g& gp`BB/Hy PNP g g"HyK "<N/a nP  g"HyN  "<N/a

Hy PNPHx9 HH/aPHx9 HH/aPHx9 HH/axPHx9 HH/abPHx9 HH/aLPHx9 HH/a6P9 HH/9 HH/aPHx9 HH/aPHx9 HH/aP9 HH/9 HH/aP9 HH/9 HH/aPHy`  g-|*|d`b m-g0Jg <` <// mHH/a B  fJ g JfHyHy PNPL N^NuNVB . f-| f g g .g HyHy PNPT f"HyHy PNPR-|?`* l HyHy PNPR@/.HyHy PN R gHyHy PNPR-n ` HyHy PNPR mN^NuNV/. /.HyHy PN fHyHy PNP`HyHy PNP .gHyHy PNP fHyHy PNP-|?`& dHyHy PNP@/.HyHy PN N^NuNVJg/./. HyHy PNN^NuNV .  @//.HyHy PNN^NuNVA-H# Hn/. NP n0( gp`BN^NuNVA -H# < Hn/.NP09 L gp`BN^NuNV.*nJg0-g /-NzXms+n f mB `+m+| B*nN^NuNVH *| T 9  hl , @*PJg*LZ`0SR`*0Nb1 nRJfNc0R 9nB <NL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/N&PJmJn -|`-n BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNHxN@eBNuNHxN@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JNTf8 <NX#NT <NT#NX#NXN`#NTN\ .^rN.*yN\BNh g`(*(U g " Ҁe " Ҁd(M *@bN`fNTgB`RNh Nho "<N#NhBNzX(@ 9Nh" Ҁe 9Nh/NzX(@g yN` 9N`Xg yN`  9Nh" ҀY(#N` <NT A ` " Ҁ#N\N\c A#Nd A 9N\*A L0N^NuNVH0*n(MY#N\ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Nd L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLDIO@S@X \ a hlotz  00 000   @@@ e e       "  (@ , 2 9 B L U _ g p v }    @ @         @ @             #  (  ,  0  5  ;  A  G  N 2Kn,X `%Kalleverythingeknewioctlioctlnewcrtcrtoldioctldecioctlgspeedhupioctlspeed/dev/ttyopen%s unknown unknown mode: %s net discipline, new tty, old tty, input speed output speed speed ; even odd -raw -nl -echo -lcase -tandem -tabs -cbreak nltabcrffbs crt crt: (crtbs crterase crtkill ctlecho) -crtbs -crterase -crtkill -ctlecho -prterase -tostop -tilde -flusho -mdmbuf -litout -nohang -pendin -decctlq -noflsh erase kill intr quit stop eof erase kill werase rprnt flush lnext susp intr quit stop eof , M-^^%c/ %s%s = M-^^%c%s%d %s%d baud@(#)stty.c 4.12 (Berkeley) 2/23/8305075110134134.515020030060012001800240048009600exta19200extb38400even-evenodd-oddraw-rawcooked-nlnlecho-echoLCASElcase-LCASE-lcase-tabstabstandem-tandemcbreak-cbreakcr0cr1cr2cr3tab0tab1tab2nl0nl1nl2nl3ff0ff1bs0bs133tty3337tty3705vt05tntn300titi700tekcrtbs-crtbsprterase-prterasecrterase-crterasecrtkill-crtkilltilde-tildemdmbuf-mdmbuflitout-litouttostop-tostopflusho-flushonohang-nohangctlecho-ctlechopendin-pendindecctlq-decctlqnoflsh-noflsherasekillintrquitstartstopeofbrksuspdsusprprntflushweraselnextUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ Nl. 40$.7@.(IR$,[dm"wN~|||hpNv? !P(/5:\AHMU]`e,nw~0D"v`d:F   ? (/5=nDJQVJ\c2krty$Xtt$.b<<  03T#h*x19B`IQ [eo<t<p~4r04   )   hv( W 'V,F26d?GJN W q ^ndl. (r S x  } f   yz,   h$ ng|fhf t &?l,"2<  DL>L&S;ZZ dl30t|iFx[YsxQ<Rf&ZP .  x7z& Nl+f0crt0.ostty.o_sccsidfprintf.ofprintf.oprintf.oprintf.osetbuf.operror.oerrlst.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrcmp.ofstat.oisatty.oclose.oopen.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_speeds_sb_flags_tc_ioctl_fprintf_prspeed_modes_setbuf_oldisc_pitldivt_eq_special_strcmp_delay_prmodes_ldisc_open_perror__iob_argc_arg_speed_argv_pcol__pfile__print_free_sys_errlist_write_errno_sys_nerr_strlen__ctype__fcvt_ecvt__flsbuflmodt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodtcerror_gtty_stty_realloc_sbrkuldivt_end_brkb[lѹ{ u**by HID 8$G"I#HTHS/N4 /NPXNuNuNV-|4-|9 o n -h/.NPX#f/.HyAN|PHxNPX y hJgNJgHyQNX-@ y/(/NP/ y/(NxPJgxHy[N|X yJfRHyoHybNP-@Jg6HxNX/Nl/Hyq/.N</.NXHxNPXN yJfRHyHyNP-@Jg6HxNX/Nl/Hy/.N</.NX y/( NXJlHyNXHxNPX y/( /.N PJg HyHyN*LZ`0SR`*0Xb1 nRJfXc0R 9nB <XL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NĞ .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|),+|),+n 0-gl(m m R Э "-d f -,/HT-HH/NĞ .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NĞ . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NĞ g m p`BL0N^NuNV.*|` HUaX,e*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NZXJl~0-g /-NfXBBBB BmB- L N^NuNVN/.NĴXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|`,eB` 0,f -+fp`B, wf0Hx/.N P.JgJm/NZXHx` afvJgp`p//.NnP.lB (f6Hx/.N P.Jg Jm/NZXHx/.NnP.Jm.HxB/NF `Jgp`B//.NnP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.Nn N^NuNĨHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NnP. g `/NZXB`Hx NX*@Jg*B L N^NuNĨHxN@eBNuNĨHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNĨHxN@eNuNĨHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNĨHx6N@eNuNVH0JY,f8 <Y0#Y, <Y,#Y0#Y0Y8#Y,Y4 .^rN®.*yY4BY@ g`(*(U g " Ҁe " Ҁd(M *@bY8fY,gB`RY@ Y@o "<N´#Y@BNfX(@ 9Y@" Ҁe 9Y@/NfX(@g yY8 9Y8Xg yY8  9Y@" ҀY(#Y8 <Y, A ` " Ҁ#Y4Y4c A#Y< A 9Y4*A L0N^NuNVH0*n(MY#Y4 (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN®.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Y< L0N^NuNĨHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /etc/passwdrrinigrp: %s is in too many groups setgrp/etc/grouprr/etc/utmp/dev/ttyr%s Unknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$,/etc/ttys/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83YD. 40 P+6? L.Wlblu.<<||.,<Pq@.$T@$$  *3<FXM\V\]\diHrPyll.V?0 <$,@4 =FMRYa$ekxpwV~h@hD& ? N %*+z2:ATHNU]d8mTuT}$. @.@PP<^z<D[Lx ;!*34 T<hCxMT[d@m!dt|LŒ Œœ<¤r¾<ØĘĨĴP~4 r0   |(18@ L>Uz$\<e<mPw"ltx!@.[2qP+ @Ĩ2%/92.CIFPnV;Z]DfnLv~d@, yf TĞ ($ ( d'D.6H?nEf\KfHTnZ|aF´gmFvT}?L  ),3Ĵi&x[lYsXQ RFZ0". )Ø.h5L=ZGxPV _f7ofu®| YDRcrt0.osu.o_sccsidcrypt.ogetpwnam.ogetpwent.ogetuid.oinitgroups.ogetgrent.ogetlogin.ogetpass.ofdopen.ofprintf.ofprintf.oprintf.oprintf.osetbuf.osetgid.osetgroups.osetuid.oatoi.ofgets.ofilbuf.operror.oerrlst.orew.oOsignal.oexec.oexec.oexecve.osighandler.osyscall.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_pwd_printf_getpass_crypt_strcat_initgroups_shellis_execl_fprintf_setuid_getpwnam_getlogin_fopen_homeis_endpwent_strcmp_perror_strcpy_getuid__iob_setgid_ttyname_fclose_encrypt_setkey_getpwent_setpwent_atoi_fgets_rewindcerror_setgroups_getgrent_setgrent_endgrent_read_lseek_open_close_ttyslot_setbuf_fflush_fdopen_stty_gtty__filbuf_signal__lastbuf__pfile__print_free_fstat__sibuf_malloc_sys_errlist_write_errno_sys_nerr_strlen__sigfunc__sighandler_syscall_execle_execv_execve__ctype__fcvt_ecvt__flsbuflmodt_isnanldivtfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_creatptwoulmodt_rindex_closedir_readdir_stat_opendir_ioctl_realloc_sbrkuldivt_end_brkb[lق $by*by  :$G"I#HTHS/N4 /NTXNuNuNVNJN^NuNpHx$N@eNuNVN/.N|XN^Nu#pNuHxN@NVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nlf9~HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.N$X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|X` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNpHx>N@eNuNVHn/.NPJlB`pN^NuNpHxN@eBNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNpHx6N@eNuNVH0JAf8 <A#A <A#A#AB#AB .^rN.*yBBB g`(*(U g " Ҁe " Ҁd(M *@bBfAgB`RB B o "<N$#B BNX(@ 9B " Ҁe 9B /NX(@g yB 9BXg yB  9B " ҀY(#B <A A ` " Ҁ#BBc A#B A 9B*A L0N^NuNVH0*n(MY#B (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ B L0N^NuNpHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL`@J0fJdf JDfaB 98r /NLX#(Jf&/98Hy Hy N HxaBXJ0g^J4g J\gaHxHxNDP gHz~HxNDPHxHxNDP gHzHxNDPHxHxNDP gHzLHxNDPHy9/9NPJfDJ4fHy;Hy NPHxanXHxNVX#p#8`bHx/9NP#plHJ4gHx/9NP#pl&/9HyjHy N HxaX/. aXBaXHy/9NPJfBNVX#p#8`>B/9NP#pl&/9HyHy N HxajXJdg /. a X`aFBaJXN^NuNVHyHy NPHxa$XN^NuNV,H0J4fa@aJX/.NXX dm/.Hyb`X/.Hy NpP 9R dm/.Hy`(HxcHyi/. N -@Jl/.N` .i @B2hJPg6/.HyHy N HyiHyHy N BHyHyHN4 a /HyHy`N4 Hy az`B/. NP-@l/.Hy`BHyaX/.NXX dm/.Hy`/.Hy NpP yoxB<-yt@` .@ /HyiNpP1ha @/HyHy`N4 Hy aXJPgHy N /.HyDHy N a/HyPHy`N4 Hy a X`Jo*Hna XSHxHn/.NV -@n/.NXJfJg /.HyTHy N `aSl*n8N^NuNV`6-n`Hy n/a \PJf"X nJfa`R`D nJfHy HxxaPJgJHg8Hx/Hy NP-@f-| p09//.aPJgHy a>XJf 92hfHy NBXHy HyiNrPJl Hy HypHy N `>JPg4HyiHy Hy`PHy NBXHy HyiNPJlHy Hy`JPgHyiHy HyHy N` 91hgp09/Hy NP-@l Hy HyHy N `d09H/09H/Hy N -y ."<NL-@JPg/./.Hy HyHy N`Hna 4X o(HxHn/.NR JlNHy Hy `&/.Hn/.NR Jl&Hy Hy0Hy N HxaX .SJnp/.NXJ f(BNX-@-yHnHy NPJgp09/Hy NPaRa8JgN^NuNV`vJPg HyaXHy HyUNHP 91hfHyiHyXNHP 92hfHyiHyfNHPHy{NHXaaaJg~N^NuNVHxHnNPHnaXN^NuNVH0*nHUadX0- H/0- H/Hy}NH /-HyNHPHmNX(@HlHlHyNH L0N^NuNVH0*n(|`HU/aP"eL0N^NuNVH *n.` n 0(fXSl/HyNHPL N^NuNVH0*nHx/HUNP(@JgBBHUNPJm/J,fp`/(M` /fzBBHUNPJldHxHUNPJlHUNX/`X09H/09H/HUN Jgp09/HUNP/RJfz ,/g`BL0N^NuNVHxHxNDPRgSo,Sm ,R @` HTNX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y -y -y -y -|-|HH. g -f -|`f +g^S`Z/9 l/9 h .".N@l< 0N@///./. 9 "9 NNܪ-@-A`RHH.  @f .gZ`t/9 l/9 h .".N@l< 0N@///./. 9 "9 NNܪ-@-ASHH.  @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH.  @fJl D*܅-FJl D,B g(  p @/(/ .".N-@-AJg R mJl/./. .".N݀`/./. .".N-@-A/.//NX -@-AJl ` .".L N^NuNV.*nHUNX-@ . gJ-@ . -@B/./N B -lHUNX-@Jf*nN^NuN\Hx9N@eNu o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNu"o /B/gS @`"Q g2gNuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/N*PJmJn -|`-n f +||`D/.NLX+@f,mJf,0-g-HHQ@+@`m+n  f09 gHy NX0-gp` - //--HH/NV *+mSl. fm0-gm`m B` mR*nN^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9$ l @ @*PJg*LZ`0SR`*0QXb1 nRJfQXc0R 9nB <QXL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/NR .B`T0-f(mfHn-HH/N*PJmJn -|`-n f9 HH/N4XJgm+|0+|0+n 0-gl(m m R Э "-d f -,/HT-HH/NR .+L`/.NLX(@+Lfm`m+n B,`* -.,o+L/HT-HH/NR . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/NR g m p`BL0N^NuNV.*| ` HUaX le*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNL/.NXN^NuNV .". nJ/H?Nـ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (| ` leB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB $f6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuN\HxN@eNuNVH N.*nJfS` r N0 r NF.S XgR|a` zf < p` RB/.NP f .L N^NuN\Hx!N@eNuN\HxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx NLX*@Jg*B L N^NuN\HxN@eBNuN\HxN@eNuNVH0*nJf HxHm /NV +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuN\HxN@eNuN\Hx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN\Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuN\Hx N@eNuNVH0JQf8 <Q#Q <Q#Q#QQ#QQ .^rNF.*yQBQ g`(*(U g " Ҁe " Ҁd(M *@bQfQgB`RQ Qo "<NL#QBNX(@ 9Q" Ҁe 9Q/NX(@g yQ 9QXg yQ  9Q" ҀY(#Q <Q A ` " Ҁ#QQc A#Q A 9Q*A L0N^NuNVH0*n(MY#Q (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNF.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Q L0N^NuN\HxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL%sX; mv %sX %sr-Ctar: missing links to %s %o%o%o%lo%lo%otar: directory checksum error (%d != %d) %s %s tar: %s: cannot open file tar: %s: no such file or directory tar: %s: cannot stat file tar: %s is not a file. Not dumped tar: %s: file name too long %6o%s/%s.tar: %s: directory read error ....tar: %s: file name too long tar: %s: symbolic link too long a %s symbolic link to %s %11lo%6otar: %s: cannot open file tar: %s: file name too long %6oa %s link to %s tar: out of memory, link information lost a %s %ld blocks %6otar: %s: file changed size tar: %s: symbolic link failed x %s symbolic link to %s tar: %s: cannot link %s linked to %s tar: %s - cannot create x %s, %ld bytes, %ld tape blocks tar: %s: HELP - extract write error tar: %s: HELP - extract write error %s linked to %s symbolic link to %s %3d/%1d%7D %-12.12s %-4.4s %c%6o %6o %6o %11lo %11lo %c %s: SCCScoreerrsa.out%s %lotar: tape read error tar: tape blocksize error tar: blocksize = %d tar: tape write error tar: tape write error tar: tape backspace error tar: %s @(#)tar.c 4.19 (Berkeley) 83/05/12M:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/...getwd: can't open .....getwd: can't chdir to ../getwd: read error in ..getwd: read error in ../getwd: can't change back to .@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$@(#)seekdir.c 4.8 4/13/83Unknown error: F/bin/shsh-c@(#)telldir.c 4.4 4/13/83-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ l/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83Q. 40"*2:@CPI`S[ cjrz eHH.Nt:LL p hJl|| '/{ 6q?.GxR:]bijovu~$@,€DTd|ĨJ$44FŠŠ#Ѫ-QT4=DKNPY`hp0v}8*P?ؘJ@VP,ހ0x 2ڴ$-:4߸9B@XHL`R Wܪ^ekrz@ވXv,|ߨ ?nXzT~D^ނ "ں!ڎ(/߬5L<DhKT\dXm$|u.}.x| <f<;$43X" *1;PB`IpR!YajA<sL|$$4<< V<00L\~4r 0V  &q ,&2z:NDMHU L\ emxu ~ }  4R €  ^8VN\   Z#C*0,7 $>GXO6`Xra (g ,n 0uL}WuB 4 n8 <{%|F4 @ D*FLt| wR* *_F39AVEfIvM  HT  L[  Pbf.mnw{zl%VLo$ T lX+ ;  \ -`  -d _ N &7 0!p 8f >D FL N V \ f  o$X w =h ~ . e l > } F p /t x d < , J  X \ O ?0 F  "b *v 2 x :Š B[ Jf S: \t cnL i r {sn \ T A   @ ݀ yX @ ? ܪ  |  @  z 6  j  0| %| 2Ĩ ; C JZ RQ* `r* ff l$ s zb ؞ L  0 y  l 34 i ـ t [ܢ  YN  Q R ޮ Z  F p 0  ! '8( 0 6 Q ; @crt0.otar.o_sccsidOutime.ochmod.ochown.octime.oOftime.odup.ofreopen.ogetwd.ochdir.olink.olstat.omkdir.ofseek.oreadlink.ofprintf.ofprintf.oprintf.oprintf.ordwr.oscanf.odoscan.oatof.oatof.o_exp5_twoe56seekdir.osymlink.obcopy.obcopy.oretbloopbwdbytesbzero.obzero.oatoi.ofilbuf.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.osystem.oOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.otelldir.otime.ogettimeofday.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.omktemp.oaccess.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTrindex.ostrcmp.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcpy.ostty.oioctl.oungetc.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcount_read_dblock_lstat_atoilmult_checkf_readtape_dotable_printf_stbuf_putfile_checkw_fscanf_usefile_mflag_chksum_freemem_write_low_system_passtape_onintr_chmod_sscanf_oflag_dorep_nblock_ioctl_lseek_longt_dup_getdir_fprintf_pflag_njab_closedir_usagelmodt_chown_errno_seekdir_getcwd_freopen_symlink_tbuf_Bflag_rflag_fflush_ctime_unlink_cflag_first_checkdir_term_bzero_flushtape_readdir_chdir_bcopy_sprintf_recno_tflag_breadldivt_onterm_cmp_fopen_utime_bsrch_fstat_doxtract_endtape_link_strcmp_m1_m2_m3_Fflag_fflag_vflag_m4_creat_response_m5_m6_m7_lookup_select_m8_m9_putempty_backtape_magtape_done_wflag_onhup_high_m_open_onquit_access_close__filbuf_perror_tfile_hflag_xflag_getwd_fread_checksum_strcpy_stat_signal_malloc_rindex_time_readlink_tomodes_strlen_iflag_mkdir__iob_fseek_linkerrok_pmode_checkupdate_prefix_mt_ihead_mktemp_writetape_tname_rewind_telldir_opendircerror_dysize_localtime_ftime_asctime_gmtime_fclose__pfile__print_fwrite__flsbuf__doscan_scanf_atof__getccl__ctype_fsinglei__instr__innum_ungetcieeeused__sctabffltifdivi_ldexpfcmpifmulifaddi_ovbcopy__sibufulmult_sys_errlist_sys_nerr_execl_wait__exit_fork__sigfunc__sighandler_syscall_execle_execv_execve_gettimeofday_fcvt_ecvt_isnan_isinfffixi_modf__cleanup__sobuf_free__lastbuf_isattyd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltisulmodtuldivt_getpidptwo_gtty_stty_realloc_sbrk_end_brkb[>lٺB- &T**by   B$G"I#HTHS/N4 /N@XNuNuNVH`T ig4`B n h -fF n h(HHJg afR\`HxHxNdPX S nHnHxNPp0. fp`B#HxBHxN f> `f0R`&J\gHx n /(NP"94 A 94 @Jl&Hx n /(N\P"94 A HxB 9R4 @/N `,Hx n /(N\P"94 A RHn n /(NPJmp0. f4R`,Hya8X n /(a*XHyaXSX .S nB.Bm2JoJnHHxHydBN ,BJn/a8X`* d @ d"@RR m/aX`LN^NuNVJgp` .-@B`bB`H .".l ` ./ .d/ .4 @/N R .m .Ѯ .mN^NuNV`Hx .R/HxN nJfN^NuNVH0*n Jm m#`p`T . d @(P . d @ gf ` <//.Hx0N `NqL0N^NuH // | d pNLNw //W.BN@d W/N WNNVNL/.NXN^NuNV/. Hx/.N N^NuNHxN@eNuNHx>N@eNuNHxN@eNuNHxN@eNuNHx&N@eNuNHxN@eNu#`pNuHxN@NVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+| +| +n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXTe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N"XJl~0-g /-N2XBBBB BmB- L N^NuNVHn/.NPPJlB`pN^NuNHxN@eBNuNV/. Hyt /.Nv N^NuNV/. Hy@t/.Nv N^NuNHx6N@eNuNVH0JJf8 <J#J <J#J#JJ#JJ .^rNz.*yJBJ g`(*(U g " Ҁe " Ҁd(M *@bJfJgB`RJ Jo "<N#JBN2X(@ 9J" Ҁe 9J/N2X(@g yJ 9JXg yJ  9J" ҀY(#J <J A ` " Ҁ#JJc A#J A 9J*A L0N^NuNVH0*n(MY#J (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrNz.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ J L0N^NuNHxN@e#XBNu /йX/@HxN@e 9X#XNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL<d@!'~4-r60=C4JQ6W^ \e `lFs dx.\ d,2d  d L   fy2L;"T .3"v* *2P8v?0E7\N2TFZza Jfkdpcrt0.otee.o_sccsidOsignal.osighandler.osyscall.oexit.ocreat.olseek.ofstat.oopen.oread.ostat.owrite.ocerror.o_exit.oflsbuf.odata.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.o_exitstart_main_environmcount_read_openf_write_puts_lseek_aflag_errno_stash_out_fstat_creat_in_n_open_t_stat_signal__sigfunc__sighandler_syscallcerror__cleanup__exit__sobuf__flsbuf_free_fflush_close__lastbuf_malloc__iob_isatty_fclose__sibuf_gtty_ioctl_stty_realloc_sbrkldivtuldivt_end_brkptwob[Ilقz bby=*by$,4<D @N $G"I#HTHS/N4 /NXNuNuNVH0HxHxN4P#$HxHxN4P#HxHxN4P-@HxHxN4PJfHzrHxN4PX `d qg0 xgB`J n P -fP n P(HHJfB6`$BHxN4P#6` #0X S nJ0ga%Hya L. am zo Hy0a tXa>ana y@ "a A `Ba`J@f 9X#@`Raaa*yHx a`"a `H !g` Pgn Eg2` Qg` egn( cgn ag` dg` ggDn fg` ig6` tgn\ pgn( lgn kgN`N mg`@ rg n qg`& sgf` wgn vgn ugf` xg``L N^NuNVH B`t 9n|B ."HA HABAЁ-@ 0Ѯa, 0m 9o#Ȼf*yLJl .D-@ .Ba, 0l~BfJgR  .gn 'gnX gn> g#ȻfB`rRf*y`Sg`v/aX*y /fXc*yL`YLd*yHUBaPJffHy0aX`*yJg Hy0aX`*y`a, am zo Hy0aX*yL`Xb a @ "f` Lec Hy0a`X `R $gV` -gn +g` ?gn /g` ^g`|L N^NuNVJ@f#@#@< 9<@c Hy0aXN^NuNVJ@f0 9LX#<#@ 9Lf #LB pp`:HxHnBN Jn #T`.#T 9TN^NuNVH0(|D*y p`: fg# `HgBe Hy0atXa*. fB 9.Df J9Efp`BL0N^NuNVH0*|D(y tSl|HxHy t/9 N S#lp`(| t 9 td6gJg$/9 9R/Hy tHyf . `Jga B#>HyHyL/a JDgBHxHyLHy a L`Bg|J g^JBmfJDgF*|<(|$*<` SJfBHxHy$Hy aHynHy$` HynHy#BBHx/9PN P/NXHx/9PNP#:J0g#DHy Hy daP#L#*nN^NuNVH0J pg Hy0a0Xalaa. f Hy0aX/aZXA*H`F f Hy0aX \fa. g\Ae Hy0aXan. f B(yL`.Jf Hy0a~XL0N^NuNVH a". g f Hy0aJX/aX*|a, \f a, fJ pg` Hy0aXgeHy0aX`Ba# gfBap`aBL N^NuNVH0*|D(y <fp` fB f&,fHTHUa2PJg # @p`Jg`HTHUaPJfJfBL0N^NuNVH8(n*n HHS b@0;N ,Dj28`gB`Jg`Jf`# Dp`HxHH/HUa JgHH`|BHH/HUa Jf`HH @ `LHH L`HH-@ L @Jf Hy0aLXHT/.aFPJgH . L @ ". A`HH-@ L @Jf Hy0aX&L`" . L @ ". AHT/.aPJfιeHUHTahPJf . L @ ". A`&LJf`<&LgR`0&L -fp`B/HH/HUa JfHHSg>HUHTaPJfFb`&Hy0a X`L8N^NuNVH0..*n  @(Pf  L @ep`BL0N^NuNVH *n.Jg"HH,Sg f .` Jfp`BL N^NuNV. 9r N. 9r Nh#Jga 0/aR H mB \ f~>` f:~<-``#V /HyHxNn `L l g\ 0 0T gd#VL N^NuNVH<(n &@ $@ .-@ .-@*n `tHHЮ" Ҁ AHHЮ" Ҁ AHH" Ҁ AHHR fBR fBR .SJfL<N^NuNVH HxHxN4P-@HnBN(P f HyaX0.H-@nHnBNPHyaX*| d` g mda. fB=nHnBNP/.HxN4PJ9 dgp`BL N^NuNVH8*n (@ &@ nJfB`Hx/.HnNt ` nBR nJfnnHnN:XJl-|-nNRJfjBNXHxNX/.N*X/.N*XBHyHyN BHyHyN HxNXHx Hn/.Nn BNRX gHx Hn/.N g Hya`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH0*n Jm m#p`T .\ @(P .\ @ gf ` <d//.Hx0N `NqL0N^NuNV/9Hn /.NB N^NuNV/9/. /.NB N^NuNVA -H .X @Jf n/Hn /.NB N^NuNxHx;N@eNuNxHxN@eJgBNuH // |\ pNLNw //W.BN@d W/Nx WNNVBHnNPJlp`Jg n .N^NuNxHxtN@eNuNVN/.NXN^NuNV/. Hx/.N N^NuNxHxN@eNuNVH N.*nJfS` r N0 r Nb.S XgR|a` zf <` RB/.NP f .L N^NuNxHx!N@eNuNxHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N(PJlB`pN^Nu@(#)crt0.s 1.2 (crt0.s) (SUN) 1/26/83TMPWRITE ERRORr/tmp/eXXXXXEntering encrypting mode!ed.hupMEM?/bin/shsh-t!Input not ttyKey:/usr/lib/makekey-/lib/makekey-crypt: cannot generate key/V. 4$4P&P/t9ALWcio4y<Ld ,<xN<&* 5<9AHOVH^Xghpw@@P<X&r<LLhx. ~4r'0.6 ]=CBI{NSYFa f m t } x 7D B cD 8>Gxnt0t <$ "$ }  d#$(1 ;D2K*PPXz_ 0fboPx3 )4 <  <:R e @ f Dy  Lj  dB e pu^hF " t   t"y,p4<^D  |Oq<XFh^=g I nt z  w  02dVQ  6P.   ( FR p'0-4  8HAGRN $W  (` ,i;pgy: -04h 4HB < y< z@i DqT UD xHx<! JL(  L. P6 T=xDK \Udb irzBQbLN V  fLb.3  6crt0.oed.odup.opipe.osetjmp.osetjmp.ostrncpy.olmult.oneg_resultpos_resultzero_resulta_negb_negOsignal.oexec.oexec.oexecve.ofork.osighandler.osyscall.otime.ogettimeofday.oexit.ocreat.olseek.omktemp.oaccess.ogetpid.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTclose.oopen.oread.ostty.oioctl.ounlink.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.oflsbuf.odata.ofstat.oisatty.o_exitstart_main_environmcount_gettty_kflag_read_join_getblocklmult_setdot_dol_savej_peekc_putfile_dot_global_rhsbuf_realloc_ninbuf_file_append_nleft_iblock_putd_rdelete_write_strncpy_move_dosub_onintr_puts_crbuf_expbuf_names_listf_oldhup_crblock_newline_braslist_nonzero_lseek_dup_setjmp_execl_pflag_longjmp_getline_address_tline_obuff_linebp_pipe_wait_loc1_loc2_freelmodt_braelist_filename_key_error_globp_gdelete_unlink_putchrulmodt_genbuf_place_execute_nextip_commands_crinit_getsub_exfile_savedfile_reverseldivt_putline_tperm_stty_locs_anymarks_setnoaddr_line_cclass_col_Q_T_getcopy_linp_compile_substitute_subolda_vflag_callunix_creat_ichanged_circfl_setall_gtty_quit_WRERR_fork_count_init_onhup_io_backref_open_nlall_oldquit_fchange_subnewa_close_getfile_tfile_xflag_blkio_signal_malloc_time_nbra_getchr_advance_oblock_perm_addr1_addr2_getkey_linebuf_getpid_makekey_compsub_delete_xtflag_wrapp_mktemp_ibuff_zero_tfname_lastccerrorulmult__sigfunc__sighandler_errno_syscall_execle_execv_execve_gettimeofday__cleanup__exituldivt_accessptwo_ioctl_sbrk_end_brk__sobuf__flsbuf_fflush_fstat__lastbuf__iob_isatty_fclose__sibufb[clٹԁ \8**byLT\dlt 8T `$G"I#HTHS/N4 /NXNuNuNVH Hx Hy,NPHyJHy@N$P-@f HyLHyNPHxNXBNX#$Hy$N`X#d-|d mFHyc n /(N$P-@f* n /(HyeHyN HxNX n S m n (R!@S @` /.NX. gH Pm HyuHyNPHxNX"9Pl ARP`|/.NXHxNX#L/.HxHxHylN/.NXJLg4Hx 9L"HAHABAЁt/Hy4Nl B "HAHABAЁl*@J-g"HxHyHmN( JgHUa XR mBNXL N^NuNVH N. f*BNX fHyHyNP`JfHyHnNP/.HnNhPBHxNPHx NXHyHnN$P-@f&HnHyHyN HxNXHn/.NP yd/(/( 9L"HAHABAЁl/HxHy4Hy,Hy/.N *|l,9P`HH* f: n S m n (R!@S @ HH`/.Hx NP n S m n"(R!AS AHH`/./NPR SJntBNXL N^NuNV/.aX/aXN^NuNVH HnNvX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J@ @, -JD @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN-@Jl QS*|\ .rPJlp`Jg n .N^NuNHxtN@eNuNV4.-nB\8`b yT S m. .R @HH yT"(R!AS AHH` /9T .R @HH/NPR\8 nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn .R l .R`p//./.N-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N`S n0A .ذbJn/9/9 .".Nfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.NPJfHnHn *LZ`0SR`*0\BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|d`eB` 0,f -+fp`B, wf0Hx/.NpP.JgJm/NXHx` afvJgp`p//.NP.lB ;f6Hx/.NpP.Jg Jm/NXHx/.NP.Jm.HxB/N `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNHxN@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /NN +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0J\f8 <\#\ <\#\#\\#\\ .^rN.*y\B\ g`(*(U g " Ҁe " Ҁd(M *@b\f\gB`R\ \o "<N#\BNX(@ 9\" Ҁe 9\/NX(@g y\ 9\Xg y\  9\" ҀY(#\ <\ A ` " Ҁ#\Թ\c A#\ A 9\*A L0N^NuNVH0*n(MY#\ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ \ L0N^NuNHxN@e#`BNu /й`/@HxN@e 9`#`NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLyNLn" \ ;\(5 ;<EQ>S\nbfhou~$ (F?R   ;;3, iv(x[J Ys$*Ql1R=VCZJQ.pX^cjrz[Z^ P7 \crt0.owall.o_sccsidctime.oOftime.ogethostname.ofprintf.ofprintf.ordwr.osetbuf.oOalarm.ostrncmp.ostrncpy.ofilbuf.oOsignal.ofork.osighandler.osyscall.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.ofopen.ocreat.odata.olseek.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTttyslot.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exit.o_exitstart_main_environmcount_strncmp_localclock_utmp_mesg_who_alarm_strncpy_clock_strcat_gethostname_hostname_sline_fprintf__flsbuf_wait_setbuf_localtime_fopen_msize_fork__filbuf_fread_strcpy_signal_time_ttyslot__iob_fclose_sendmes_dysizelmodt_ctimeldivt_ftime_asctime_gmtimecerror__pfile__print_fwrite_free_read_fflush_fstat__sibuf_malloc__sigfunc__sighandler_errno_syscall_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write__sobuf_close__lastbuf_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis_lseek_creat_openptwoulmodt_strcmp_rindex_ttyname_closedir_readdir_stat_opendir_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[|lٹC [**byPX`hpx 8BP $G"I#HTHS/N4 /NXNuNuNVH8Hy/Hy NPHy@HyNPHyN|XaBNXHyFHTNP&@JfHyHN@XHxNX`d fFHx HyNjPHUHyNPJf4HyHy^NPaLBNXJ9 f ga.HSHxHxHyN gzL8N^NuNV.HyHxHxHy HxHxHybNHyN,X*@HmHypNP*nN^NuNV/.aX/aXN^NuNVH HnNZX0.< n"-AHnaX*@.-|w*</ Jg Kf, -J @, -J @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN" L N^NuNVH n "<QN-@ n "<QN-@Jl QS*|Ed .r *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NXHx` afvJgp`p//.NP.lB EDf6Hx/.NP.Jg Jm/NXHx/.NP.Jm.HxB/Nr `Jgp`B//.NP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N N^NuNV.*nHUNXBB-HH/Nr B+mm0-gm*nN^NuNHxN@eNuNVBHnNPJlp`Jg n .N^NuNHxtN@eNuNV(.-nBI`b y%< S m. .R @HH y%<"(R!AS AHH` /9%< .R @HH/N PRI nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@*LZ`0SR`*0Ib1 nRJfIc0R 9nB <IL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9.HH/NXJgm+|<+|<+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNh/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuNVH B/.NP. g `/NXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N> +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JJ8f8 <J<#J8 <J8#J<#J<JD#J8J@ .^rN.*yJ@BJL g`(*(U g " Ҁe " Ҁd(M *@bJDfJ8gB`RJL JLo "<N#JLBNX(@ 9JL" Ҁe 9JL/NX(@g yJD 9JDXg yJD  9JL" ҀY(#JD <J8 A ` " Ҁ#J@J@c A#JH A 9J@*A L0N^NuNVH0*n(MY#J@ (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ JH L0N^NuNHxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLh &t.8tB<GV>Ze<ihr${ ; 3@ 8HX! L(2<7FJU<Y`hqy~4r0  ej a@  <tW,=tN !| 6(..[7O?E?DPFVZ] fvnu2qP+f  %<[v@y>L %Dr ED. ;'1Q?HnFNf T@[\a j$hry~?h3ixt[0\YjsQR Z")X1Z;DNJ @SY`f7ou| JPcrt0.owho.o_sccsidctime.oOftime.ogethostname.ogetpwuid.ogetpwent.ogetuid.oputs.oprintf.oprintf.ordwr.osetbuf.oatoi.ofgets.ofilbuf.ofopen.ocreat.orew.olseek.otime.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.orindex.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printf_pw_utmp_gethostname_hostname_puts__sobuf_getpwuid_setbuf_ctime_putline_fopen_strcmp_fread_strcpy_rindex_time_getuid__iob_ttyname_dysizelmodt_localtimeldivt_ftime_asctime_gmtimecerror_getpwent_setpwent_endpwent_atoi_fgets_fclose_rewind__flsbuf__pfile__print_fwrite__filbuf_free_read_fflush_fstat__sibuf_malloc_lseek_errno_creat_open_close__lastbuf_gettimeofday__ctype__fcvt_ecvt_isnanfcmpiieeeused_strlen_isinfffixifdivi_modffmulifaddi__cleanup_write_isatty__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_strcat_closedir_readdir_stat_opendir_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lٹѰ \**by| 8@ $G"I#HTHS/N4 /N0XNuNuNV,H BNX-@HnNX-@ lHyPNtXHxN0X n # o#HywHymNP*@JfHyyNtXJhf(J9f /9HyNtPHxN0XHUNXJf( hoHy/9HyNt J9f*/9NtXJhgHy`HxNX#pJfHyNtXHxN0XHn/9pNPJlHyNtXHxN0Xp0.fHyNtXHxN0XHx//9pN4PR#pJg(Hy.HyN(P/9HyNPHUHxHxHyxN fvJ9g/9pHyxN`PJfBB  @HH-@ fB D @Jg R m y -fJ(gTB 9Ї @HH-@  @HH-@JfJg g .f R mRhJ9fHy4HyN(PHyx`Hy:NtXHxN0XBHyN6PJlHyJNtXHxN0XHzHxNPHxNXHyWHyNP#lg^BNXHn yl(HH/NPJm2p0.g"Hzda6XHx HnNPHyY/9lN4P n/(/(/9pHyDHnHyi/9lN4/9lNX`x/Hn4 yl(HH/N g /9HyNtPHxN0XA4 S  f$HxHy yl(HH/N HxHn4BN .Jnab .!4fdA4BHn4ap`NHyNtXHxN0XL ,N^NuNVHyNtXHxN0XN^NuNVHy/9lN4PBN0XN^NuNV.HxaXN:.JlHy`tJf\BaXB .R/HyHyHyNXJgHyNX` </NBN0XBNXfHyNtXHz8a X..N^NuNV.B`/. 4 @/NPR 4 @Jf..N^NuNV/.aX/aXN^NuNVH HnNX0.< n"-AHnaX*@.-|w*</ Jg Kf, -JP @, -JT @*/HUaZP,/HUaPP*Jng:nf2 m(mf lHnafX*@R L N^NuNVH *n.. :m/-aXmހ ЭrN^" L N^NuNVH n "<QN^-@ n "<QN-@Jl QS*|G\ .r*LZ`0SR`*0Gb1 nRJfGc0R 9nB <GL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|'@+|'@+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|t` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NBXJl~0-g /-NNXBBBB BmB- L N^NuNVN/.NXN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuNVH0*n (|t`eB` 0,f -+fp`B, wf0Hx/.NP.JgJm/NBXHx` afvJgp`p//.NVP.lB '8f6Hx/.NP.Jg Jm/NBXHx/.NVP.Jm.HxB/N& `Jgp`B//.NVP.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.NV N^NuNHxN@eNuNHx!N@eNuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NlPJlB`pN^NuNVH B/.NVP. g `/NBXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0JHf8 <H #H <H#H #H H#HH .^rN.*yHBH g`(*(U g " Ҁe " Ҁd(M *@bHfHgB`RH Ho "<N#HBNNX(@ 9H" Ҁe 9H/NNX(@g yH 9HXg yH  9H" ҀY(#H <H A ` " Ҁ#HHc A#H A 9H*A L0N^NuNVH0*n(MY#H (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ H L0N^NuNHxN@e#dBNu /йd/@HxN@e 9d#dNuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLXJlHy)NXHxN(XaN.-@a/9 HxHn/9p@N& g/.HyvNP .N^NuNVJkg /./. /.N N^NuNV# Jkg o n (` <# B/9 NޖP#p@Jl/9 NXHxN(XJkg#p@ # p8`>#p8B/9p8NޖP# Jl/9p8NXHxN(XJkg oP o n ( ` <# B/NޖP#Jl/9 NXHxN(XN^NuNVH  o n (` <#SdHy4/NHPJ98f(/9SdHyHyN0 HxN(XJkg$*|4` -+@ e#TSh#HSB/9l/9p@a HxHyS/9p@N& g/9 HyaPHxN(XB/9x/9p@a HxHySl/9p@N& g/9 HyaPHxN(XB/9/9p@aB HxHyR/9p@N& g/9 HyalPHxN(XB/9/9p@a HxHypD/9p@N& g/9 HyaPHxN(XJkf Jkg/9aTTTTTTHyuHUNܠPJfB`Hy}HUNܠPJf`HyHUNܠPJf`R UfR mf -ef -mfJ-f`R rg ug hfR rf -pg8 uf -pg* rf -kg rf -mg mfT -tfLTHHq @g2J-f,` mf" -tf`HyHUNܠPJg 9p4P yp42(ЁS*@B -df SfjHnHyN6PJfJ0.#S`B -ag -pf-HHq @gvJ-fn`B#S SfB`-| 9p4Pcz-HHq @g`HHq @gH-HH "HA HABAЁHHЁ0` fnHHWѮ`. alHHq @gHH`-|Hx azX(@ 9p4P/HTNhP)yk9|#k g* .S @)P .S @ L0N^NuNVH0JX@f <`09XD-@S @(P`L lf4HnHTN6PJfp0. f9n`9|0,yXDgp(lf(yk`L lf4HnHTN6PJfp0. f9n`9|0,yXDg(lf <`*L tf -tf -yfV L0N^NuNVH< y (g aJga-@JRf @ ?gJp0gHx/./9p0N Jf 9 й *@ax-@Jg~Hx2atX(@+L L y )h  y (H9@ y (H9@ y 9h$ y 9h( y ( H9@ y (H9@ y (H9@ nP( nJ(g (HH`p @) lfB*` y (:Ш>)@ y )hB9yXD( 9XHйXP)@*JSg 9XйXѬ* y JVgNJkgF (VRrJN"HAJJHABAЁйk$@)j40*@H)@"*EH9@& y )hF.JSpgVHx aX-@* y "n2* y "nh lg y "n#hR n!yR`Jkg`HxaX-@* lg4 y "n#hJ n Xl y JVg0*BH n!@aNԞ n!@ `@Jkg atNԞ`*Jkg$ lg&|ZkxdJg <kx*R L<N^NuNV.*n -f-y-y` -Э"<NV-@ 9pDNp///9/9 .Np// -NN~NNذNذ-@-AJm&gh 9pDNp//0-&HNp///9/9 -"NN~NذNذNذ// .".N-@-A/./. 9"9N$*nN^NuNV y (HH-@Jg ( f 9"9`Jkg( y (dN~// 9"9N$`z/9R/9RNdP// .NpN$//NP// 9 "9N// y (dN~// 9"9N$NذN^NuNV.Jkg <` <,-@ y ( fJlB`B y (Nr //9N /.HySx/9N& g,/9 y 0((H/HyHyN0`BRBp,` Jkg y (Z!@Z y (ZSh"<N y 2(4HЁSйS-@B//9p@aX HxHn/9p@N& g(/9 y 0((H/HyN `Bp0.@Rr //9 a HxHn/9 N& g/9 y 0((H/Hy`.f 0.@gp0.@r #p,`Bp,p0.@#R ."<N-@Sm..BA Rp0(@r //9 a Hx r Sx//9 N& g/9p8 y 0((H/A Rp0(@/Hy#N`p..N^NuNVH0 y (g ( g <Q`lJ gHxHySHnNP `> y ( gJp,fnJmHxHnHyUHxBaB .r //9N HxHn/9N& f\-y `@B/9p,/9 a HxHn/9 N& f-yp8A(HQYJg Af`  XB*L`8 `0 9 R"HAHABAЁR".m `L?RAd>@J.g . m .~nJ f .=fS  gbBS  g*LAHPHUHnNP -g ?g  nHyRHnN@PHxHySHnN HyU`X/. y 0((H/HyWHyN0HyHnNhPHxHySHnN HyHnN@PHna "XL0N^NuNVH0 n*h(P -r "<N/ -r "<N//,0-H/0-H/,/0H/0- H/0- H//-HyN, ,/Jg <` </NPHUaX/HyNPHm(aXHUa&XL0N^NuNV/.HyNPN^NuNV n (*r|P`6p>`N ml -f|D`|R`|Z`|? -g -.np `pW@ ml|<` mo|N`| -gpA` -gpS`p @PQRS <P*nN^NuNVH0..*n,9k .P(@ . . -@ Jm Ю no*Hy>atX`S`l H@H@B@܀XlJo ІSo HyEa6X //. a0P+@Jg Э"`"Ҕ*L0N^NuNVN^NuNV . m . N^NuNV.Jkg, n N~// n N~Npop`lp`hJkg/.abX-@/. aVX`F n h0((H n h2((H.Jf n h0( H n h2( H. ..N^NuNVH0 n*h(P -g Jm&g2-&H`r -"NЭ`Jm&gB` ,ЬL0N^NuNV.JmL lB ."HA HABAЁ @Jg ."HA HABAЁ ` XgJXfN#XN**@Jgh l -"HA HABAЁ @JfHx/ -"HA HABAЁ /NP -f`H#XNB*nN^NuNVH .R-@ oT n <./NX#kJf HyPHyN0PHxN(X # ` . *yk..`BSl#k L N^NuNVH /.N|X. R/a`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH *| 9pHl  @*PJg*LZ`0SR`*0b1 nRJfc0R 9nB <L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|P+|P+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaX Te*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NނXJl~0-g /-NXBBBB BmB- L N^NuNVN|/.NXN^NuNV .". nJ/H?N԰ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.N߬PJlB`pN^NuNVH B/.NޖP. g `/NނXB`Hx NX*@Jg*B L N^NuNHxN@eBNuNHxN@eNuNVH0*nJf HxHm /N& +@JnB`D -mB`A (HJlgp0,"<bp0,ѭJg L0N^NuNHxN@eNuNHx&N@eNuNVH8*n(n &MJfSf L8N^NuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNVH0Jf8 <# <## # .^rN.*yB( g`(*(U g " Ҁe " Ҁd(M *@b fgB`R( (o "<N#(BNX(@ 9(" Ҁe 9(/NX(@g y 9 Xg y  9(" ҀY(# < A ` " Ҁ#c A#$ A 9*A L0N^NuNVH0*n(MY# (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ $ L0N^NuNHxN@e# BNu /й /@HxN@e 9 # NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL swapper pagedaemon ip input %.*s error reading kmem at %x /dev/kmem/vmcore/dev/mem/dev/drum/vmunix%s: No namelist nswapmaxslpccpuecmxno room for text table text tableps: specify only one of s,l,v and u SSIZ %s COMMAND ps: error reading %s from %s .Can't open . in /dev consoledrumfloppynullttyd0??ps: cant read u for pid %d from %s ps: cant read indir pte to get u for pid %d from %s ps: cant read page table for u of pid %d from %s ps: cant read page %d of u of pid %d from %s ()ps: error locating command name for pid %d from %s ()%7x%4d%6u%6u%3d%4d%3d%5x%4d%5d %5x %4.4s %-2.2s%3ld:%02ld%-8.8s %5d%5.1f%5.1f%5d%5d %4.4s%5u %4.4s%3d%3d%7d%5d%5d xx%5d%5d%4d%5.1f%5.1f%4d %5u %4.4svstodbvstodb *ipps: ran out of memory @(#)ps.c 4.25 (Berkeley) 5/12/83_proc_Usrptmap_usrpt_text_nswap_maxslp_ccpu_ecmx_nproc_ntext_dmmin_dmmax F UID PID PPID CP PRI NI ADDR SZ RSS WCHAN STAT TT TIMEUSER PID %CPU %MEM SZ RSS TT STAT TIME SIZE PID TT STAT TIME SL RE PAGEIN SIZE RSS LIM TSIZ TRS %CPU %MEMSSIZ PID TT STAT TIME?.B9@kU?栞f;8 @>$q3%#FmH?r ( @3{ !|D@?@???A?XA@ݓ0Ju@NNPAV'-As@U&8?Ge+?f;@È????/etc/passwdrrrUnknown error: F-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$ T/dev/@(#)closedir.c 4.5 4/13/83@(#)opendir.c 4.5 4/13/83@(#)readdir.c 4.5 4/13/83,. 40d$pH,p85@(I8QHYXae0k0up}v.N Pq|..4Tz#$,l2:CLV]4f4m4t~y (D.DD`hZ.Ӏ?zpՆـ\ 'ٰ.`3Ԩ;bCKT]jdirp׈x|ՐP.@@pٸ؈ئ\֬ ?ٞԈ٪؄ٮ#&*t0؎7ٲ<BRIQվX,_e|ltט{,,ۈۈ<ۖR۲<|$ܠ ;3( |!ސ(ޠ2 90@@IhR!ߌYajtqy4<<(~4r0pDp&  q!`( 19 Q ?pEK  RX  _  f   m"rr  yd~JذY~     V PHp@vpD A  }  sԞ  R R! LR(/ KR5 mS<'C0L *SS S\XaZk kSuf ~~ S .S  :S`ۦ Sd Sh .Sl Sp Sx* 1kx k| k'L Xk k+! k)ޠ2>9 k?FEpKSk8[dm?$sElz @k k[ܠ  kT kޖ kIpD$ kvv!h6n{}P" ap(($|06.> xp,G/M  p0SY[b Jp4h p8n4rw %p<r p@ (Z XpD  pHDԒxӈpH<Ty  t , Ҧ l & -;ނ 4N ;eX B| K pL S [[J c j pP r/4 y T f    nZ f4 T , |  P 3  i ԰ ֤ 0 Q R   ۠ !߬ ' .ߌ 47 = , Bz Gcrt0.ops.o_sccsidlog.oexp.ofloor.ocalloc.ogetpwent.ogetuid.ochdir.onlist.ofseek.ofprintf.ofprintf.oindex.oprintf.oprintf.ordwr.oqsort.ostrncat.ostrncmp.ostrncpy.oatoi.ofgets.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_negperror.oerrlst.orew.olseek.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.ostrcmp.ottyname.oclosedir.ofstat.oisatty.oopendir.oclose.oopen.oreaddir.oread.ostat.ostrcat.ostrcpy.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_gettty_getcmd_read_npr_atoi_qsort_strncmp_printf_eflgfflti_pcpu_mproc_uhdr_kmemf_ntext_nproc_vpr_nleft_log_getdevfdivifdoublei_mem_save_savcom_swapf_strncpy_nlist__ctype__strcat_lpr_printhdr_index_openfiles_cflg_names_shdrfsinglei_vsize_pcbpf_xflg_atext_lseek_ccpu_mytty_ptime_fprintf_nswap_Usrptma_min_closedir_dialbase__flsbuf_alloc_sumcpu_cand_dmmaxlmodt_nlistf_usrpt_maxslp_lflg_user_getpwent_setpwent_sbrk_aflg_chkpid_vflg_maybetty_fflush_cmdstart_kflg_pmem_klseek_rawcpu_readdir_chdir_uflgldivtfcmpi_vstodb_calloc_strncatieeeusedfmuli_state_dmmin_freebasefsubi_endpwent_strcmp_allttys_upr_sflg_open_textfaddi_getkvars_exp_savestr_perror_proc_cantread_strcpy_stat_pscomp_getu_getw_panic_gflg_strlen_ptty_getuid_argaddr__iob_tptr_lhdr_ttyname_dbuf_memf_nl_spr_twidth_vhdr_getname_kmem_opendirffltis_swap_ecmx_log10_errno_frexpffixi_ldexp_floor_modf_ceilulmult_freeuldivt_malloc_cfree_fopen_fgets_fclose_rewindcerror_close_fread_fseek__filbuf__pfile__print_fwrite_fstat__sibuf_creat__lastbuflmult_sys_errlist_write_sys_nerr_fcvt_ecvt_isnan_isinf__cleanup__sobuf_isatty__exitd_packd_unpkg_intf_rcpffixisfloatflavorfmodiptwoulmodt_gtty_ioctl_stty_realloc_end_brkb[lٹ҉ Z**by 8=x d$G"I#HTHS/N4 /N0XNuNuNV. n BN0XBHnNPN.JlHy4NXHxN0XJf4 . X/ n /(NP n /(NXHxN0XHxHxNPHxHxNPHnBHnN\ fBHnNP .gHy9Hy`N(P . .Jl SB@HnHyYaJPHnHy^aHxNVX-@HyDNpXJg8/.HxNP/.NVXN^NuNVHxHyDNP`PJg" .c .`-n-|HzHxNP-@/.NVXNf`N^NuN4HxN@eNuN4HxN@eNu o HBNu o /L.NuNVH *|d 9аxl < @*PJg`uError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough corePermission deniedBad addressBlock device requiredMount device busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededNV/9Hn /.N N^NuNV/9/. /.N N^NuNVA -H .X @Jf n/Hn /.N N^NuN4Hx;N@eNuN4HxN@eJgBNuN4HxtN@eNuNV4.-nBE `b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/N(PRE nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NX-@8/.NXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DNЮLЮ@ @S"n .P".DN@-@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn .R l .R`p//./.N<-@Jg -|`J.g -|`J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9| .".NxgP .S-@HJlD-@HJHg6 .Hr N0S n .Hr N@`S n0A .ذbJn/9/9 .".Nxfp+`p-S n.HH @gpE`peS n`Jl-| n P @-h-h/./.N4PJf/./.N\PJfHnHn *LZ`0SR`*0Eb1 nRJfEc0R 9nB <EL0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N* .B`T0-f(mfHn-HH/NPJmJn -|`-nLf9^HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N* .+L`/.N@X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N* . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N* g m p`BL0N^NuNV.*|8` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVN/.N@XN^NuNV .". nJ/H?N n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuNVH *nB`RJf L N^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN4HxN@eBNuNV/. Hyt /.N6 N^NuNV/. Hy@t/.N6 N^NuN4Hx6N@eNuNVH0JE`f8 <Ed#E` <E`#Ed#EdEl#E`Eh .^rN:.*yEhBEt g`(*(U g " Ҁe " Ҁd(M *@bElfE`gB`REt Eto "<N@#EtBNX(@ 9Et" Ҁe 9Et/NX(@g yEl 9ElXg yEl  9Et" ҀY(#El <E` A ` " Ҁ#EhEhc A#Ep A 9Eh*A L0N^NuNVH0*n(MY#Eh (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN:.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ Ep L0N^NuN4HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLFJPXU\6cHi pHxx~$d ?.|  Z&4-3:BIR4Z4bk$r.z"<~<30@ (<0'+J6<:$A$I4R@Z0`f~4lru0|&(F@\Q.8C> >NM  &4-vh4H;CJ`R ZbVipqzf<*x$z(hnbf<f(\x&4 ?,'  /y5L=D;KU@]3em@ti{x[LxYs8QR&Z $$67 : Ex!crt0.otime.o_sccsidsigset.o_cactions_setflgwait3.onostatusnoerrorsignal.osignalSIGDORTIsigoldnoerrorexecvp.ogetenv.ofprintf.ofprintf.oindex.osleep.oOalarm.oOpause.osetjmp.osetjmp.operror.oerrlst.oexec.oexec.oexecve.ofork.ogettimeofday.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.ostrlen.odata.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTfstat.oisatty.oclose.ostty.oioctl.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owrite.ocerror.o_exit.o_exitstart_main_environmcount_printt_fprintfldivt_wait3_gettimeofday_fork_execvp_perror_signal__iobcactions_sigignore_errno_sighold_sigpause_sigsyssetflg__sigcatch_sigset_sigrelsecerror_index_execv_execlp_sleep_getenv__pfile__print_alarm_setjmp_longjmp_pause_sys_errlist_write_sys_nerr_strlen_execl_execle_execve__ctype__fcvt_ecvt__flsbuflmodt_isnanfcmpiieeeused_isinfffixifdivi_modffmulifaddi__cleanup__sobuf_free_fflush_fstat_close__lastbuf_malloc_isatty_fclose__exitd_packd_unpkg_int_ldexpfsubi_frexpffltifdoubleifsingleif_rcpffixisfloatflavorfmodiffltis__sibufptwoulmodt_gtty_ioctl_stty_realloc_sbrkuldivt_end_brkb[lٺ5" .(**bypx  :$G"I#HTHS/N4 /NXNuNuNV## # n #g^Hy4/9NPJfFS 9Ю @#gHy6/9NPJgHyBHy8aP 9Ю @B n HxNXahJgB`p/NXN^NuNV 9m"Jg RB`*HyUHyCa,P 9й @ RN^NuNVa>-@HxaX#gHyV/NPJfaЀ` S .N^NuNVa@-@Hxa\X#gHyY/NPJfa` S .N^NuNVBaX#g"Hy\/NPJfaJfp` B`SaN^NuNV.BaX*@#gZHy^/ NPJfFa-@BaX#gHy`/NPJgHymHybaP .`6#gBHyn/ NPJf.B`Hyq/ NPJfHxBa6X/a`#f#gdHyt/ NPJfPBaX/aX g2B`Hyw/ NPJf&BaX/aX fp`x#f#g(Hyz/ NPJfBaX/aX`@#gDHy}/ NPJf0 9m HxN`BaBX/NX/`#g@Hy/ NPJf,BaX#gJHy/NPJf4`#g@Hy/ NPJf,BaX#gHy/NPJg`HxaX-@Jf$#gHy/ NPJf`#g@Hy/9NPJf(BaDX#gLHU/NPJgl`6#g@Hy/9NPJf(BaX#g4HU/NPJf"`#g0Hy/ NPJf/.aX-@BaX-@`HUNX-@BaX/NX-@#g(Hy/9NPJf .g`^#g(Hy/9NPJf .fb`,#g(Hy/9NPJf .n0`#g(Hy/9NPJf .m`#g(Hy/9NPJf .l`#g(Hy/9NPJf .o`d/.HyaP*nN^NuNV/. /.NBP-@ Jm/N.Xp`BN^NuNVHn/.NRPJlB`p0. @fp`pN^NuNVHn/.NRPJm Jop`BN^NuNVHxHyHxN /.NX//.HxN /. NX//. HxN HxHyHxN HxNXN^NuNV-n .R @Jf .SN^NuNVH *nBB`4 9nZ "HA HABAЁHHЁ0.`.RR`(RHH g g +g -g 0lJg D` L N^NuNVN,/.NXN^NuNVH *nB`RJf L N^NuNVH0*n(n fJfB`HHSHHL0N^NuNVHn/.N|PJlB`pN^NuNHxN@eBNuNHxN@eNuNHx&N@eNuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuNHx6N@eNuNHxN@eNu#pNuHxN@NVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|+|+n 0-gl(m m R Э "-d f -,/HT-HH/N .+L`/.NX(@+Lfm`m+n B,`* -.,o+L/HT-HH/N . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N g m p`BL0N^NuNV.*|` HUaXxe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/N.XJl~0-g /-NXBBBB BmB- L N^NuNHx>N@eNuNVH0JBf8 <B#B <B#B#BB#BB .^rN.*yBBB g`(*(U g " Ҁe " Ҁd(M *@bBfBgB`RB Bo "<N#BBNX(@ 9B" Ҁe 9B/NX(@g yB 9BXg yB  9B" ҀY(#B <B A ` " Ҁ#BBc A#B A 9B*A L0N^NuNVH0*n(MY#B (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ B L0N^NuNHxN@e#|BNu /й|/@HxN@e 9|#|NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL 0 int cgopen(), cgmmap(); #else #define cgopen nodev #define cgmmap nodev { cgopen, nulldev, nodev, nodev, /*14*/ nodev, nodev, nodev, 0, seltrue, cgmmap, }, files.sun: sundev/cg.c optional cg device-driver PICKLE: device cg0 at mb0 csr 0xe8000 priority 3 b[l:4 ,^bbnet/af.c standard net/if.c standard net/raw_cb.c standard net/raw_usrreq.c standard net/route.c standard netdecnet/nsp_input.c optional decnet netdecnet/nsp_output.c optional decnet netdecnet/nsp_subr.c optional decnet netdecnet/nsp_usrreq.c optional decnet netdecnet/tp_input.c optional decnet netdecnet/tp_output.c optional decnet netdecnet/tp_usrreq.c optional decnet netimp/if_imp.c optional imp inet netimp/if_imphost.c optional imp inet netinet/if_ether.c optional ether inet netinet/if_loop.c optional loop inet device-driver netinet/in.c optional inet netinet/in_pcb.c optional inet netinet/in_proto.c optional inet netinet/ip_icmp.c optional inet netinet/ip_input.c optional inet netinet/ip_output.c optional inet netimp/raw_imp.c optional imp inet netinet/raw_ip.c optional inet netinet/tcp_debug.c optional inet netinet/tcp_input.c optional inet netinet/tcp_output.c optional inet netinet/tcp_subr.c optional inet netinet/tcp_timer.c optional inet netinet/tcp_usrreq.c optional inet netinet/udp_usrreq.c optional inet netpup/pup.c optional pup netpup/pup_proto.c optional pup netpup/raw_pup.c optional pup sys/init_main.c standard sys/init_sysent.c standard sys/kern_clock.c standard sys/kern_descrip.c standard sys/kern_mman.c standard sys/kern_process.c standard sys/kern_prot.c standard sys/kern_resource.c standard sys/kern_sig.c standard sys/kern_synch.c standard sys/kern_time.c standard sys/quota_charges.c standard sys/quota_share.c standard sys/quota_sys.c standard sys/subr_mcount.c optional profiling-routine sys/subr_prf.c standard sys/subr_rmap.c standard sys/subr_xxx.c standard sys/sys_directory.c standard sys/sys_domain.c standard sys/sys_file.c standard sys/sys_generic.c standard sys/sys_process.c standard sys/sys_socket.c standard sys/sys_xxx.c standard sys/tty.c standard sys/tty_bk.c optional bk device-driver sys/tty_conf.c standard sys/tty_pty.c optional pty sys/tty_subr.c standard sys/tty_tb.c optional tb device-driver sys/tty_tty.c standard sys/tty_xxx.c standard sys/ufs_alloc.c standard sys/ufs_bio.c standard sys/ufs_bmap.c standard sys/ufs_dsort.c standard sys/ufs_efs.c optional efs device-driver sys/ufs_fio.c standard sys/ufs_inode.c standard sys/ufs_nami.c standard sys/ufs_subr.c standard sys/ufs_syscalls.c standard sys/ufs_tables.c standard sys/ufs_xxx.c standard sys/uipc_mbuf.c standard sys/uipc_mu_msg.c standard sys/uipc_pipe.c standard sys/uipc_proto.c standard sys/uipc_socket.c standard sys/uipc_socket2.c standard sys/uipc_usrreq.c standard sys/vm_drum.c standard sys/vm_mem.c standard sys/vm_mon.c standard sys/vm_page.c standard sys/vm_proc.c standard sys/vm_pt.c standard sys/vm_sched.c standard sys/vm_subr.c standard sys/vm_sw.c standard sys/vm_swp.c standard sys/vm_swap.c standard sys/vm_text.c standard b[lJ e$ >,^bbvsun/locore.s standard special sun/autoconf.c standard device-driver sun/clock.c standard sun/conf.c standard sun/cons.c standard sun/dkbad.c standard sun/in_cksum.c optional inet sun/machdep.c standard sun/mem.c standard sun/probe.c standard sun/trap.c standard sun/ufs_nd.c optional nd sun/vm_machdep.c standard sun/setjmp.s standard sun/mcount.s optional profiling-routine sun/movc.s standard sun/ocsum.s standard sunmath/ffloat.s standard sunmath/ldivt.s standard sunmath/lmodt.s standard sunmath/lmult.s standard sunmath/ptwo.s standard sundev/ar.c optional ar device-driver sundev/cg.c optional cg device-driver sundev/dd.c optional dd device-driver sundev/win.c optional win device-driver sundev/winioctl.c optional win device-driver sundev/wintree.c optional win device-driver sundev/rect.c optional win device-driver sundev/rectlist.c optional win device-driver sundev/ip.c optional ip device-driver sundev/dsd.c optional dsd device-driver sundev/mb.c optional mb device-driver sundev/ms.c optional ms device-driver sundev/tm.c optional mt device-driver sundev/oct.c optional oct device-driver sundev/su.c optional su device-driver sundev/vp.c optional vp device-driver sundev/xy.c optional xy device-driver sunif/if_ec.c optional ec inet device-driver sunif/if_en.c optional en inet device-driver b[lٺ߁ 0,^bbif [ ! -r version ]; then echo 0 > version; fi touch version echo `cat version` `basename \`pwd\`` | \ awk ' { version = $1 + 1; system = $2; }\ END { printf "char version[] = \"4.1c BSD UNIX (%s) #%d: ", system, version > "vers.c";\ printf "%d\n", version > "version"; }' echo `date`'\n";' >> vers.c b[ l:4 ,^bb/* param.c 4.16 82/11/15 */ #include "../h/param.h" #include "../h/systm.h" #include "../h/socket.h" #include "../h/dir.h" #include "../h/user.h" #include "../h/proc.h" #include "../h/text.h" #include "../h/inode.h" #include "../h/file.h" #include "../h/callout.h" #include "../h/clist.h" #include "../h/cmap.h" #include "../h/mbuf.h" #include "../h/quota.h" #include "../h/kernel.h" /* * System parameter formulae. * * This file is copied into each directory where we compile * the kernel; it should be modified there to suit local taste * if necessary. * * Compiled with -DHZ=xx -DTIMEZONE=x -DDST=x -DMAXUSERS=xx */ #define HZ 100 int hz = HZ; int tick = 1000000 / HZ; struct timezone tz = { TIMEZONE, DST }; #define NPROC (20 + 8 * MAXUSERS) int nproc = NPROC; int ntext = 24 + MAXUSERS; int ninode = (NPROC + 16 + MAXUSERS) + 32; int nfile = 16 * (NPROC + 16 + MAXUSERS) / 10 + 32; int ncallout = 16 + NPROC; int nclist = 100 + 16 * MAXUSERS; int nport = NPROC / 2; int nmbclusters = NMBCLUSTERS; #ifdef QUOTA int nquota = (MAXUSERS * 9)/7 + 3; int ndquot = (MAXUSERS*NMOUNT)/4 + NPROC; #endif /* * These are initialized at bootstrap time * to values dependent on memory size */ int nbuf, nswbuf; /* * These have to be allocated somewhere; allocating * them here forces loader errors if this file is omitted. */ struct proc *proc, *procNPROC; struct text *text, *textNTEXT; struct inode *inode, *inodeNINODE; struct file *file, *fileNFILE; struct callout *callout; struct cblock *cfree; struct buf *buf, *swbuf; short *swsize; int *swpf; char *buffers; struct cmap *cmap, *ecmap; #ifdef QUOTA struct quota *quota, *quotaNQUOTA; struct dquot *dquot, *dquotNDQUOT; #endif b[ lJ$ ,_bb# makefile.obj 1.1 83/04/26 # # Makefile for 4.1c bsd # # This makefile is constructed from a machine description: # config machine # Most changes should be made in the machine description # /usr/sys/conf/``machineid'' # after which you should do # config machineid # Generic makefile changes should be made in # /usr/sys/conf/makefile # after which config should be rerun for all machines. # C2= /lib/c2 CC= cc AS= as LD= ld AWK= awk TOUCH= touch -c DESTDIR= COPTS= ${IDENT} -DKERNEL CFLAGS= -O ${COPTS} AHEADS= %OBJS %CFILES %LOAD clean: rm -f eddep *vmunix* tags *.o locore.i [a-tv-z]*.s \ errs linterrs makelinks assym.s: ../h/param.h ../machine/pte.h ../h/buf.h ../h/vmparam.h \ ../h/vmmeter.h ../h/dir.h ../h/user.h ../h/cmap.h ../h/map.h \ ../h/proc.h ../h/mbuf.h ../h/msgbuf.h ../machine/reg.h \ /usr/include/framebuf.h /usr/include/mon/sunromvec.h ${CC} ${IDENT} -DKERNEL ../sun/genassym.c; ./a.out >assym.s; rm -f a.out ../h/param.h: /usr/include/signal.h ${TOUCH} ../h/param.h ../h/tty.h: ../h/ttychars.h ../h/ttydev.h ${TOUCH} ../h/tty.h ../h/ioctl.h: /usr/include/sgtty.h ../h/ttychars.h ../h/ttydev.h ${TOUCH} ../h/ioctl.h ../h/user.h: ../sun/pcb.h ../h/dmap.h ../h/types.h \ /usr/include/errno.h ${TOUCH} ../h/user.h ../h/vm.h: ../h/vmmac.h ../h/vmmeter.h ../h/vmparam.h ../h/vmsystm.h ${TOUCH} ../h/vm.h depend: grep '^#include' ${CFILES} | grep -v '<' | \ sed 's/:[^"]*"\([^"]*\)".*/: \1/' | \ sed 's/\.c/.o/' | sed 's,../[a-z]*/,,' | \ ${AWK} ' { if ($$1 != prev) { print rec; rec = $$0; prev = $$1; } \ else { if (length(rec $$2) > 78) { print rec; rec = $$0; } \ else rec = rec " " $$2 } } \ END { print rec } ' > makedep echo '$$r makedep' >>eddep echo '/^# DO NOT DELETE THIS LINE/+1,$$d' >eddep echo '$$r makedep' >>eddep echo 'w' >>eddep cp makefile makefile.bak ed - makefile < eddep rm eddep makedep tags: ../h/*.h ${CFILES} /usr/ucb/ctags ../h/*.h ${CFILES} ioconf.o: ioconf.c ../h/param.h ../machine/pte.h ../h/buf.h ../h/map.h \ ../h/vm.h ../sundev/mbvar.h ${CC} -I. -c -O ${COPTS} ioconf.c param.c: ../conf/param.c cp ../conf/param.c . param.o: param.c makefile ${CC} -I. -c ${CFLAGS} ${PARAM} param.c %RULES # DO NOT DELETE THIS LINE -- make depend uses it b[lsA,"byb[l{́**bynoname b[lڇӁ*byb[lŦ| )f5byb[l= +<+]bysun:\ :dv=/dev/ttya:br#1200:el=^C^S^Q^U^D:ie=%$:oe=^D: krypton:\ :dv=/dev/ttyb:br#9600:el=^U^C^S^Q^D:ie=%$:oe=^D: decvax|DEC VAX-11/780:\ :pn=9876543210:tc=UNIX-1200: arpavax|ucbarpa|arpa:\ :pn=9876543:tc=UNIX-1200: tip0|tip1200:tc=UNIX-1200: tip300:tc=UNIX-300: cu0|cu300:tc=UNIX-300: cu1200:tc=UNIX-1200: UNIX-300:\ :dv=/dev/cua0:\ :el=^D^U^C^S^Q^O@:du:at=ventel:ie=#$%:oe=^D:br#300: UNIX-1200:\ :dv=/dev/cua0:\ :el=^D^U^C^S^Q^O@:du:at=ventel:ie=#$%:oe=^D:br#1200: VMS-300|TOPS20-300:\ :dv=/dev/cua0:\ :el=^Z^U^C^S^Q^O:du:at=ventel:ie=$@:oe=^Z:br#300: VMS-1200|TOPS20-1200:\ :dv=/dev/cua0:\ :el=^Z^U^C^S^Q^O:du:at=ventel:ie=$@:oe=^Z:br#1200: -------------------------------------------------------------------- The attributes are: dv device to use for the tty el EOL marks (default is NULL) du make a call flag (dial up) pn phone numbers (@ =>'s search phones file; possibly taken from PHONES environment variable) at ACU type ie input EOF marks (default is NULL) oe output EOF string (default is NULL) cu call unit (default is dv) br baud rate (defaults to 300) fs frame size (default is BUFSIZ) -- used in buffering writes on receive operations tc to continue a capability b[lAr +^+gby0|lp|vp|versatec|Versatec:\ :lp=:rm=lprhost:rp=versatec:sd=/usr/spool/vpd:\ :lf=/usr/spool/vpd/log: 1|ip|imagen|Imagen:\ :lp=:rm=lprhost:rp=imagen:sd=/usr/spool/ipd:\ :lf=/usr/spool/ipd/log: b[lŦM *fYbyb[lJ!; b|ib|jb|j (08@HPX`. p ;tL$G"I#HTHS/MN8 /NXNuNuNVHHzHxNȨPHzpHxNȨPSX .SJgB n P(HH`#Zh` #Zl` dg fgX `aN-@a y f$/.NvX/.NXNNNN/.NXavHyN\XHy N\XHyBN\XHysN$X f HxNX/.NXNqLN^NuNVH *n.. "-Nr-@ .S"Ҁ ".N ".Nr-@ .`NqL N^NuNVH/. /.aFP-n nJg( nHH- @HHf` R``NqLN^NuNVH nBHyN\X/. HyN\P/.NX n qf$HyN$X f HxNX```NqLN^NuNVHHyHyNP-@JfHyHyNPHnHnHnHy/.N fX-| nJgFHn n/NPJf& .r n!@ .r n!@ ` ``/.N~XNqLN^NuNVHJZhgHyN\X`HyN\XNqLN^NuNVHaHyHyN\PHyN\XHyN\XHy)N\X-|-|p nJg$ n//.Hy+N\ RP` .S/Hy4N2P-@ .Sp# y/HyZHnN< HnN$X g&NqLN^NuNVHHz/.NȨPHyN$X f HxNXNqLN^NuNVHJZlg/.HyHyN ` /.NXNqLN^NuNVH/.aX-@/./9ZpabP n!@/.aX-@/./.aPHyTN\XHyVN\XHyN\X n/( n/HyN\ B .l, n (Ю/ n/(HyN\ R`HyN$X g& yN .#N .`NqLN^NuNVH/.NX-@ nBNHyN\X n/HyN\P/.adX-@/./.aPHyN\X/. n/HyN\ B .l"/. n/(Hy>N\ R`HyEN$X gN n h!|c yN .#N/.NXNqLN^NuNVHNHyeN$X f"/.aX-@/.NXN`NqLN^NuNVHB-nJg2 n / n/NPJf nJ gT n-h` .`NqLN^NuNVHHyN\X-n-|Jg2 n/( n//.HyN\ n-hR` .S/HyN2P-@-n-| .l n-hR`HxN X-@ n"n <"Q nB .`NqLN^NuNVH n/HyHnN< HxHnN2P-@ .`NqLN^NuNVH n!n .-@B . lZHxN X-@ n!| n (Ю n nB nB n .-@R`NqLN^NuNVHHyHy0NP-@fHy0HyNPBA-H/.HxdHnN JgHx)HnNxP-@ nBHx(HnNxP-@ nB( .R-@HxN X-@HnHnNTXR/N X/NTP n /./.NTXR/N X/NTP n!@ nB nB nB nB n .-@` .`NqLN^NuNVH 9Zp`NqLN^NuNV@H n /( n / n/(HyHnN<Hn@HnNJP f. n / n/(Hy)HnN<HnNXHxHnN*P-@|l n / n/(HyAN HyHy@d/.|N Jf #Z|`HnHy[NPHyHy@&d/.|N Jfp09#Ztp09#Zx`HnHyNP <Zt`NqL@N^NuNVH n J g$ n h h fBZ n B Hx/. /.a4 /. /.aDPHyN$X gNqLN^NuNVH .  -@/. /.NP-@Jf" n"n #h/. /.aP-@`* n -h Jg .-@ n-h` n /( n / n/(HyHnN<-|JfjJZfbHxN X-@ nBHnHnNTXR/N X/NTP n!@/././. a -@`Jo n -h -| .l n-hR` n ( n Ѩ f./././. a~ Jf/././. a ` /.NX/././. an n ( n B`ZHxN X-@ nBHnHnNTXR/N X/NTP n!@/././. a Jg,Jg& n .-@ n ( n /. /.aP-@ n /(/.a*P-@ f n Jo~HxN X-@ nBHxNX n!@ n "n#hHnHnNTXR/N X/NTP n!@ nB n n BNqLN^NuNVH n/(aXX n !@ n /(/./.aD n !@ n h gal/N\X n /. aXJgNqLN^NuNVHJ f/./.NPJf`BHy N\X/.HnHy N\ `Hn .(/NTPNqLN^NuNVH-yZJg./. .(/NPJf .`` n-h8` y f /.HyhNPJf < `&`/.HyNPJf <`B`NqLN^NuNVHNHy N\XHy N\XHy -N\X-|-yZJg4 .(//./.Hy /N\R n-h8` .S`NqLN^NuNVH n-PJf` n ( f nB n ($f nB$ nJ f^ nJ$fT-|Z-yZJg> .f n"n"8/.NX` .8-@ n-h8`NqLN^NuNVHN y fHy N\XHy RHnNPHnHy NTPHy Hy oHnN< HnHnNPHnHyhNTPHy N\XHy N\XHy N\XHyhHy Hy N\ `,Hy N\XHy N\XHy HnNPHnHyNTP y gHy N$X fHyHy HnN< HnHnNPHnHyNTPHy KN\XHy MN\XHy uN\XHyHyHy wN\ `>Hy N\XHy N\XHy N\XHyHy N\PHy N$X-@ gNqLN^NuNVH 9Z`NqLN^NuNVH/.Hy HnN< HnHnNHnHy HnN f m . n .``NqLN^NuNVH  o/. /.Hy HnN<`/. /.Hy HnN<HnHnNHnHy HnN f m . n .``NqLN^NuNVH  o/. /.Hy HnN<`/. /.Hy HnN<HnHnNPHnHy HnN f m . n .``NqLN^NuNV@HHnHy NJPJgHy NX-nJg n/(Hy Hn@N< HnHn@NJPJfHp0.` `f40.nf*HxN X-@ n"n <"Q .` n-h`tHy 'NXNqL@N^NuNVHHy `Hy TNP-@/.a|X y f /.aX/.aX/.a"X`/./.aP/.aX y f /.a,X/.N~XNqLN^NuNVHHy b/.NPNqLN^NuNVHNp-@ n/(HyhHy Hy o/.NNqLN^NuNVHN-@Jg0 .(//.Hy /.N n-h8`NqLN^NuNVHNp-@Jg n-hJg n/( n/ n/(Hy HnN<B n-h Jgn n h f -| ` n-P n/(/.Hn/. n h/Hy /.N n (Ѯ n-h` n-h`@ n-h` NqLN^NuNVH y`/(Hy /.N NqLN^NuNVHHyXHyHy /.NNqLN^NuNVH/. NX-@J9g <` < -@ n/(/.HyHy /.NNqLN^NuNVHNHy N\XHy N\XHy N\X n / n/(Hy HnN<HnN$X fp`/. /.NP-@Hx/.a|P-@Hx/.ajP-@Hx/.aXP-@ .Ю-@NJf-n`B n (".N -@ n / n/(Hy VHnN</.HnN2P-@ n"n #h .".Nr n"(蒀-A .".N -@/./././. /.ap`NqLN^NuNVhH n /( n / n/(Hy HnlN<HxaX-@Hxa|X-@HxanX-@ .  -@ n -hhJoHxN X-@ nB n!n n!nHnlHnlNTXR/N X/NTP n!@ nB n .-@ .h/.NXJhoVHy HnNPHxN X-@HnN\X n n!n n!nHnlHnlNTXR/N X/NTP n!@ nB n .-@ n P!n$ .hHxN X-@HnN\X n n!n .ho .` .h n!@HnlHnlNTXR/N X/NTP n!@ nB n .-@ n P!n .h`NqLhN^NuNVH/. a@X-@Jf/. Hy NP n/(/.NP`NqLN^NuNVH-| nJg n (f .``B`NqLN^NuNVH y fa fa`NqLN^NuNVHBN-@Jgh nJ f$Hy N\X/.Hy N\PR nJ$f$Hy N\X/.Hy N\PR n-h8`NJf HyN\XHyN\XRJgDHyDN\X/.HyFN\PHyaN\XHycHnNNPHyMN\XHyeN\XHyg/.NPHyj/.NPHy/.NPHy/.NPHy/.NPBNp-@Jg n-hJgB n/( n/ n/(HyHnN< n-h Jg2 n h (`/. n/(/.Hn n/Hy/.N n!n R` n/(/.Hn n/Hy/.N n!| ` n/(/.HnHy/.N n!| `Z/. n/(/.HnHy/.N n!n R`" b@0;NB| n (Ѯ n-h` n-h`| n-h`\Hy!/.NPHy&/.NPHy)/.NPHya/.NP/.N~XHydNXNqLN^NuNV,HHy~N\XHyN\XN-@/.aXNp-@ n-h n/ n/(HyHn,N< n/(Hn, y`/(HyHnN<HnNXNqL,N^NuNVH/.HyN\PHyN\XJgF#ZBN-@/. n/( n h /( HyHnN<`2/. n h /( yZ h /( Hy)HnN<HnNXNqLN^NuNVHN-@JgD/.Hy_N\PHy|N\X n/( a*X/.aX n-h8`NqLN^NuNVH/.NX-@Hy~N\XHyN\X n/(HyHnN< HnNXHyHyHnN< HnNX y f( n/( y`/(HyHnN<`,Hy n/( y`/(HyHnN<HnNXNqLN^NuNV4H n/(aX-@4 n h f n/(Hy$Hn8N< ` n/( Hy,Hn8N< n40(/ n40( / n/(Hn8Hy7HnN<HnNXNqL4N^NuNVH/.HycHnN< HxHnN*P-@ fHnHylNPHyZHy@&d/.N fHnHy{NP <Z`NqLN^NuNVHNHyN\XHyN\XHyN\X-|-| nJg0 n/( n//.HyN\R ` .S/HyN2P-@ .S"HA HABAЁ#` y`/HyHnN< HnN$X g y f y`/HyHnN< HnHnNPHnHyNTPHyHy@HnN< HnHnNPHnHyXNTPHynN\XHyXHy y`/HypN\HyN$X g>NqLN^NuNVH *nSm 9R @`HyNĈX. g Jm`Jl fB`B .L N^NuNVA-H#Hn/. NʨP n0( gp`BN^NuNVA -H#Hn/.NʨP09 gp`BN^NuNVHn /.HyN$ N^NuNVHn/. /.N$ N^NuNV.*n=|A-M-MB`RJf-nHn/. HnN$ *nN^NuNVH0*n (nBBHH.Jg& gz gp gf %g, n S m n (R!@S @`HH. %gB *g LX-H`HH.B-|`* ."HA HABAЁЇ0-@HH. - @fJf-|u0 lf-|`BHH.` hg [f HUaX*@ - @g  .-|Jfp`Hn/./././/.aJg JgRJg|Jg` n S m n (R!@S @` /.NĈX-@ g g g g/./NP`/.NĈX-@g g*/./NP .L0N^NuNVH c g s g [ f././././. Jg n `B/a`BBB e g f f-|| o f|` x f|A*HBB n S m n (R!@S @` /.NĈX. g g g -fFR n S m n (R!@S @` /.NĈX.S` +fS n S l/.NĈX` am fo Am FnR f .` f .Ю` .-@-G - @g0` am fnW`7߮.. n S mB n (R!@S @.Sm - @f< g .f fJgR` eg Ef~Jfx fpJgjJgdR n S m n (R!@S @` /.NĈX. +g -g 0m 9oJg .D-@ g/./NP nB` n JgAgJgAfB`B .退 bJ@0;N^jj@@@@@@@@@@@@@&&DHnNtXNv n P p`2HnNtX n P !A` n P0` n P `L N^NuNVH8*n(n nB&M c f u0f-|B s f-|Sm ,R @` HTNĈX. @HHg f-| c fB`` [ fV-|`L  @HHf>gSo,Sm ,R @` HTNĈX. f gJo HT/NP nB` n gg c gBp`BL8N^NuNVH *nB ^fRRBJg  @`  @R mHH. ]g*Jg  @`  @RJfS L N^NuNVH *nBB-y-y-y-y-|-|HH. g -f -|`f +g^S`Z/9`/9\ .".NHl< 0NH///./. 9"9NN-@-A`RHH. - @f .gZ`t/9`/9\ .".NHl< 0NH///./. 9"9NN-@-ASHH. - @f Eg efpHH. +g6 -f -|`$S` "HA HABAЁ"0Ё*HH. - @fJl D*܅-FJl D,B g( d @/(/ .".N-@-AJg R mJl/./. .".N`/./. .".N-@-A/.//N` -@-AJl ` .".L N^NuNVH0*n(nS o2Sm -R @` HUNĈX.m  fJl fB`B .L0N^NuNV.*n0-gm0-fp`80-@f`ZHn-HH/NPJmJn -|`-nf +|`D/.N X+@f,mJf,0-g-HHZ+@`m+n f09gHyNX0-gp` - //--HH/N: *+mSl. fm0-gm`m B` mR*nN^NuNVH0*n (|`eB` 0,f -+fp`B, wf0Hx/.N@P.JgJm/NXHx` afvJgp`p//.N*P.lB 9f6Hx/.N@P.Jg Jm/NXHx/.N*P.Jm.HxB/N2 `Jgp`B//.N*P.JmB@Jgl` rgl`l L0N^NuNV/. Hx/.N* N^NuJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$NuNVH0N-@f.B/.HyHyHyN@HxN8XHxHxNȨP*@HxHxNȨP(@HnN X-@g f f-|HUHxNȨPHTHxNȨP .L0N^NuNVH0*n Jm m#9p`T .9 @(P .9 @ gf ` <//.Hx0N `NqL0N^NuHxN@NV/9Hn /.Nɾ N^NuNV/9/. /.Nɾ N^NuNVA -H .X @Jf n/Hn /.Nɾ N^NuN0Hx;N@eNuN0HxN@eJgBNuH // |9 pNLNw //W.BN@d W/N0 WNN0HxN@eNuNVA-HA#=|B-n-|Hn/. NʨPSm .R @BHH`HnBNP .N^NuNV4.-nB[`b y S m. .R @HH y"(R!AS AHH` /9 .R @HH/NPR[ nJg ` %fB.nnnB.` 0g n *f n X @-hJl .D-@|R n .f4R n *f n X @-hR`|` #g6 +g -fh|R nHH f|`|`|`B nHH- @gT nHH0-@HR ."HA HABAЁЮH-@`B nHH- @g@ nHH0-@HR ."HA HABAЁЮH-@`-|B. nHH hg lgB-|-n-n nP.HHR dgn Ogn Eg.n DgXnJgA-H-HRJ.g/.NTX-@8/.NTXJlB`|R`L|-|D`|-|D`-|DJl-|J.g `&-| PgZ .PD-@P`N .dNq n X @-hP .dg .Df$JPmJ.g -|`J.g-|J.g"/.NTX".-A< o-@ .Xf -|L`-|LA`-H-H`P .P-@@ .P-@P".DN~ЮLЮ@ @S"n .P".DN -@PJPf .Ю-@J.gZ .gN.HH Xg8 og xg`* l-|`-|`-|`Jl-| n P @-h-h/./.NPJf/./.N,PJfHnHn .R l .R`p//./.N -@Jg -| `J.g -| `J.g-|AU-H nJg R @HH`p0 nRJfJ.g n.R-n` nJgS"nRRJnAU-HA-HB/9/9 .".NHgP .S-@HJlD-@HJHg6 .Hr N~0S n .Hr N `S n0A .ذbJn/9/9 .".NHfp+`p-S n.HH- @gpE`peS n`Jl-| n P @-h-h/./.NPJf/./.N,PJfHnHn *LZ`0SR`*0[ b1 nRJf[ c0R 9nB <[ L0N^NuNVH0*n 0-g mm0-fp`B,`$n |/Hn-HH/N& .B`T0-f(mfHn-HH/NPJmJn -|`-nf9HH/NXJgm+|:h+|:h+n 0-gl(m m R Э "-d f -,/HT-HH/N& .+L`/.N X(@+Lfm`m+n B,`* -.,o+L/HT-HH/N& . - S* +Lg m `l .L0N^NuNVH0*n0- f\(mgP -.oF+L0-gB` - *m/HT-HH/N& g m p`BL0N^NuNV.*|` HUaXe*nN^NuNVH *n~0-gF0-@f:HUa&X.-HH/NXJl~0-g /-NXBBBB BmB- L N^NuNVNT/.N8XN^NuNV .". nJ/H?Nވ n g B5H 4BFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE softwareNVJ gB` g fpN^NuNV . gB` .fJ gpN^NuDJlDa DNuNVN^NuJg` JmJglDJ/H<&SƁg&BCHCf*$BBHBl B@H@LN@eNuNVHn/.NPJlB`pN^NuN0HxN@eBNuN0HxN@eNuN0HxN@eNuN0Hx&N@eNuNVH8*n(n &Mf L8N^NuNV/. Hyt /.N N^NuNV/. Hy@t/.N N^NuN0Hx6N@eNuNV.*n g:0-g -b -fJfRRS m B`p*nN^NuNVH0J[\f8 <[`#[\ <[\#[`#[`[h#[\[d .^rN.*y[dB[p g`(*(U g " Ҁe " Ҁd(M *@b[hf[\gB`R[p [po "<N #[pBNX(@ 9[p" Ҁe 9[p/NX(@g y[h 9[hXg y[h  9[p" ҀY(#[h <[\ A ` " Ҁ#[d[dc A#[l A 9[d*A L0N^NuNVH0*n(MY#[d (L0N^NuNVH0*n -gHUaX --@/. aX(@gpgl-M-L . VrN.d-G` n"n"XX .SJfd& " Ҁe " Ҁ Ё @ [l L0N^NuN0HxN@e#BNu /й/@HxN@e 9#NuDJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlL /dev/null/etc/setup.files/fixhostname %s/etc/setup.files/xtrusr %s %s/etc/setup.files/rxtrusr %s %s %s/dev/%s/dev/ndl%d/etc/mkfs %s %d %d %d 4096 1024 > /dev/null/dev/r%sCannot open %sIoctl failed on %s Tape Information %d) %s (%s) Enter the number for the type of tapeYou have specified a %s; is this correctEnter the name of the remote host that the %s is attached toEnter the hexadecimal ethernet address for %s The %s is attached to %s at ethernet address %s Is this correct@(#)doscan.c 4.2 (Berkeley) 82/12/03Cp@@9@AׄBAy7D]?@$@$/bin/shsh-c-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ InfinityNaN(null) ((((( DDDDDDDDDDAAAAAABBBBBB @$?Q@$@$?@$[t. 8Zl%Zh,`3N:ZpENUZdsN`\ Z$ T."\+\4.<$E:tLtSdY\a iĈr.z.@`džǮǶȨ8@@ɸ ,<<$Fʨ-ʨ6ֲ@[G P W ^Vclsz.8@2X?ݠRH^X4 8ހ%:-5߼>GBNSJZ`bfhl(qxH`~4 ?v`\ Lf!&,*3;ߖBIOTV^penv~``<n*<T$x3$4D T!x"+A 4;CxMWa<fuy*< 0~8r4r \fg x$ X08B,K dVs$]foq<z]o @p (F<"F t B2 &93ACM  ZaȨiyo `uHv.~ hvy0w.+ `|p!T #x+L6$T>EM %P .S*YJ_Jg/bv^\zYZZ  :  n *d 68 Fn N6 ]q< fcd r t t K  C,   t a@ - ^< | p 8 2 #P 3 < JĈ S  [ʨ c:$ l snt y sv  | A   H  x` H ?  : L   2 9 .@ ;  ` #z@ * 08 7 = 9 G T ]0 dɀ l` sɾ {f o2 f ~ ,  j ݦ T &  :h 3 i ވ | [  YV  Q R  Z ! &x - 3x 97 B H O [t T Ycrt0.osetup.o_constfile_dflag_fflagdisk.o_backp_cntlr_hdrdkinfo.opart.o_pub_allocated_get_part_type_get_client_name_pub_parterror.oclient.o_client_backp_client_hdryesno.ofind_root.owrite.o_intermediatedefault.overify.oinstall.otape.ogets.ofprintf.ofprintf.oprintf.oprintf.oscanf.odoscan.oatof.oatof.o_exp5_twoe56fgets.ofilbuf.ofopen.ocreat.olmult.oneg_resultpos_resultzero_resulta_negb_negsystem.oOsignal.o_exit.oexec.oexec.oexecve.ofork.osighandler.osyscall.olseek.osprintf.osprintf.o_print.o_print.o_emitchar_countctype_.oecvt.oecvt.o_cvtflsbuf.oexit.odata.ofrexp.ofrexp.omodgonotnanZEROoneRESTMASK$1$2NANgoneNSAVEDPLAINSAVEMASKldnangohomeGUINFfloat.oSAVE03usetopd_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerosigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_rcpgnshaddingi_packeswapdmexittopzeroendasshsubusela_geninfi_unpkd_normf_packNSAVEDunpf_unpkmsignCODESAVEMASKgennanxit_2_dgotnanuselngenzeroextremassgna_ovflsignnormutopbigdrcpbigd_useld_extemexitasexitFETCH03gotcmpm_gennanisinf.oisinf.olmodt.odiv_big_bdiv_neg_aSAVEdivide_by_zeropotdiv_recallRSTstrlen.orindex.ostrcmp.ofstat.oisatty.oclose.oopen.oread.ostat.ostrcpy.ostty.oioctl.oungetc.omalloc.oObrk.oldivt.odiv_big_bdiv_neg_adiv_neg_bSAVEdivide_by_zeropotdiv_recallRSTptwo.owait.owrite.ocerror.o_exitstart_main_environmcountlmult_host_name_printf_clear_screen_get_tape_read_constants_fscanf_get_client_addrs_tape_ether_system_mysystem__ctype__tape_host_yesno_fprintf_terminate_getline_get_more_cntlrs_get_host_info_get_environment_environment_read_cntlr_file_getline1_env_error_host_ether_sprintf_roundupldivt_fopen_get_int_parttypes_strcmp_install_from_tape_verify_write_file_server_name_tapes_signal_gets_tape_get_root_cntlr__iob_fclose_server_ether_find_root_start_unit_partition_cntlr_cntlr_file_get_nunits_fgets_get_disk_info_alloc_units_get_cntlr_hdr_strcpy_malloc_rindex_get_cntlr_strlen_ioctl_dkinfo_g_p_open_stat_prompt_get_part_info_get_ptype_user_swap_ok_sscanf_get_partitions_make_client_free_pr_parts_get_pub_set_pub_clear_client_default_parts_get_part_size_yesnoint_reg_part_dup_addr_get_addr_pr_clients_get_client_hdr_yesint_wr_partitions_wr_tape_wr_network_wr_standalone_wr_rmtape_wr_server_wr_clients_def_part_get_min_bad_setup_edit_units_mkfs_hostname_add_to_hosts_copy_client_hosts_init_standalone_dskinfo_init_pub_add_to_ndlocal_ndlocal_init_clients__filbuf__pfile__print__doscan_scanf_atof__getcclfsinglei__instr__innum_ungetcieeeused__sctabffltifdivi_ldexpfcmpifmulifaddi_read_fflush_fstat__sibuf_lseek_errno_creat_close__lastbufulmult_execl_wait__exit_fork__sigfunc__sighandler_syscallcerror_execle_execv_execve__flsbuf_fcvt_ecvtlmodt_isnan_isinfffixi_modf__cleanup_write__sobuf_isattyd_packd_unpkg_intfsubi_frexpfdoubleif_rcpffixisfloatflavorfmodiffltisptwoulmodt_gtty_stty_realloc_sbrkuldivt_end_brkb[KlK  b|b|b|b: : Copy one client user partition from another : if [ $# != 3 ]; then echo Usage: $0 from_ndl to_ndl hostname exit fi from=$1 to=$2 hostname=$3 mkdir /ndcopy.from /ndcopy.to /etc/mount -r $from /ndcopy.from /etc/mount $to /ndcopy.to cd /ndcopy.from : : This will take a while : Tar cant handle dev entries, ignore these errors : tar cf - [a-c]* [e-z]* | (cd /ndcopy.to; tar xfp -) mkdir /ndcopy.to/dev cd /ndcopy.to/dev cp /ndcopy.from/dev/MAKEDEV* . MAKEDEV std nd pty0 cg : : Copy /etc/hosts and edit the hostname in /etc/rc.local : cd /ndcopy.to/etc cp /etc/hosts hosts /etc/setup.files/fixhostname $hostname cd / /etc/umount $from /etc/umount $to rmdir /ndcopy.from rmdir /ndcopy.to sync : DONE b[MlK   b|b|b| : : Make 1st diskless user : Copy it from the server : if [ $# != 3 ]; then echo Usage: $0 to_ndl pub_partition hostname exit fi to_ndl=$1 pub_part=$2 hostname=$3 : : Copy all the files from the server to the client : Skip the /dev and /pub directories : Tar cannot copy special files : mkdir /x /etc/mount $to_ndl /x cd / tar cf - [a-c]* [e-o]* [q-w]* | (cd /x; tar xfp -) mkdir /x/dev cd /x/dev cp /dev/MAKEDEV* . MAKEDEV std nd pty0 cg cd /x : : Diskless only patches : Ensure that public binaries are accessable ASAP after boot : mkdir pub pub/bin cp /bin/sh pub/bin echo "/etc/mount -r /dev/ndp0 /pub" | cat - /.profile- >.profile echo "/etc/mount -r /dev/ndp0 /pub" | cat - /etc/rc- >etc/rc rm /.profile- /etc/rc- cat <etc/fstab /dev/nd0:/:rw:1:1 /dev/ndp0:/pub:xx:1:1 END rm vmunix ln -s /pub/vmunix vmunix : : Copy the /etc/hosts file and fix the hostname in /etc/rc.local : cd etc cp /etc/hosts . mv syslog syslog.server /etc/setup.files/fixhostname $hostname : : Finish up : cd / sync /etc/umount $to_ndl rmdir /x b[PlKӁ b|b|b|c : : Edit rc.local and put in a real hostname : if [ $# != 1 ]; then echo Usage: $0 hostname exit 1 fi ed - rc.local < /etc/fstab <.profile cp etc/rc etc/rc- echo "/etc/mount $pub_part /pub" | cat - etc/rc- >etc/rc sync : : Setup symbolic links from root to pub, hold your breath : mv bin bin- bin-/ln -s /pub/bin bin sync mv bin-/sh /tmp rm -rf bin- rm -rf lib ln -s /pub/lib lib dd if=/pub/usr/mdec/bootnd of=$pub_part bs=1b count=15 seek=1 2> /dev/null sync : : Setup private usr files : cd /pub/usr tar cf - adm crash preserve spool tmp | (cd /usr; tar xfp -) mkdir /usr/local sync : : Symlink to pub/usr : cd / for i in bin dict games hosts include lib ucb do ln -s /pub/usr/$i /usr/$i done sync b[]lK bNbAbA.b[_Kl$ =b[bbx/* arreg.h 4.2 83/06/14 */ /* * Copyright (C) 1983 by Sun Microsystems, Inc. * * Header file for Archive tape driver. * * This file contains definitions of the control bits for the * Sun Archive interface board, the commands which the Archive * will accept, and the format of its status information. */ /* * ardevice defines the hardware interface. * * The Sun Archive interface occupies 8 bytes of Multibus I/O space. * 4 of those bytes are unused (the high-order half of each word). * The remainder are registers. The registers at offset 3 and 5 are * read/write and the writeable bits retain their settings in reads. * Register 1 is the data port and either writes to the 8 data lines, * or reads from them, depending on the tape controller DIRC signal. * The register at offset 7 is not really a register. A write to it * will pretend that the last byte read/written in Burst mode was ack-ed * by the tape drive, thus regaining CPU access to the control register * (which is also interlocked in Burst mode, so you can't turn off Burst * mode until after the ack of the final byte). Reads from offset 7 have * no effect. */ struct ardevice { u_char :8; u_char ardata; /* Data byte for I/O */ u_char :8; u_char arrdyie :1; /* Enable interrupt on arrdyedge */ u_char arexcie :1; /* Enable interrupt on arexc */ u_char arcatch :1; /* Notice leading edge of arrdy */ u_char arburst :1; /* Use burst mode(auto xfer/ack) */ u_char arxfer :1; /* XFER wire to ctlr if !arburst */ u_char arreset :1; /* RESET wire to controller */ u_char arreq :1; /* REQUEST wire to controller */ u_char aronline :1; /* ONLINE wire to controller */ u_char :8; u_char armempar :1; /* Enables parity check on MB mem */ u_char :1; /* unused */ u_char arintr :1; /* Board is now requesting interrupt */ u_char arrdyedge:1; /* A leading edge of Ready was seen since the last time arcatch was set. */ u_char arack :1; /* ACK wire from controller */ u_char arexc :1; /* EXCEPTION wire from controller */ u_char ardirc :1; /* DIRC wire from controller */ u_char arrdy :1; /* READY wire from controller */ u_char :8; u_char arunwedge; /* Write to here unwedges Burst */ }; /* * The following are commands that can be written to the data port while * appropriately toggling REQUEST and READY. */ #define ARCMD_LED ((u_char)0x10) /* Light the LED on the unit */ #define ARCMD_REWIND ((u_char)0x21) /* Rewind tape */ #define ARCMD_ERASE ((u_char)0x22) /* Erase entire tape, BOT to EOT */ #define ARCMD_TENSION ((u_char)0x24) /* Retension tape */ #define ARCMD_WRDATA ((u_char)0x40) /* Write data */ #define ARCMD_WREOF ((u_char)0x60) /* Write EOF */ #define ARCMD_RDDATA ((u_char)0x80) /* Read data */ #define ARCMD_RDEOF ((u_char)0xA0) /* Read EOF */ #define ARCMD_RDSTAT ((u_char)0xC0) /* Read status */ /* * This struct defines the 6 status bytes returned by the Archive during * a Read Status arcommand (AR_rdstat). */ struct arstatus { unsigned AnyEx0 :1; /* Logical-OR of the next 7 bits */ unsigned NoCart :1; /* No fully inserted cartridge */ unsigned NoDrive :1; /* Drive not connected to ctrlr */ unsigned WriteProt :1; /* Cart is write protected */ unsigned EndOfMedium :1; /* End of last track reached on wr */ unsigned HardErr :1; /* Hard(unrecoverable) I/O error */ unsigned GotWrongBlock :1; /* Ctrlr sent us wrong bad block */ unsigned FileMark :1; /* We just read a File Mark */ unsigned AnyEx1 :1; /* Logical-OR if the next 7 bits */ unsigned InvalidCmd :1; /* We sent a bad command to ctrlr */ unsigned NoData :1; /* No data block, blank tape */ unsigned GettingFlakey :1; /* >= 8 retries on some block */ unsigned BOT :1; /* Cartridge is at BOT */ unsigned :1; unsigned :1; unsigned GotReset :1; /* Ctrlr reset since last Status */ unsigned short SoftErrs; /* # soft errors (R or W) since last time we looked */ unsigned short TapeStops; /* # times tape stopped 'cuz CPU didn't keep up (since last time) */ }; /* * Drive status bits. */ #define ARCH_BITS\ "\20\17NoCart\16NoDrive\15WriteProt\14EndMedium\13HardErr\12WrongBlock\ \11FileMark\7InvCmd\6NoData\5Flaking\4BOT\0034\0022\1GotReset" /* * Printf %b string for bits in control/status registers (packed into a short, * as returned by IOCTL MTIOCGET) */ #define ARCH_CTRL_BITS \ "\20\20EnaReady\17EnaExcep\16CatchReady\15Burst\14Xfer\13Reset\12Request\ \11Online\6Interrupt\5EdgeReady\4Ack\3Exception\2Dirc\1Ready" /* * Control register bits. * Note that the long that you pass must be passed as * *(long *)(2+(char *)araddr) */ #define ARCH_LONG_CTRL_BITS \ "\20\30EnaReady\27EnaExcep\26CatchReady\25Burst\24Xfer\23Reset\22Request\ \21Online\6Interrupt\5EdgeReady\4Ack\3Exception\2Dirc\1Ready" /* * Block size of the Archive tape unit. Don't depend on it. */ #define AR_BSIZE 512 #define AR_BSHIFT 9 /* log2(AR_BSIZE) */ b[eLli{$ 1b\ Wbx/* basics.h 1.1 83/02/11 */ /* Copyright Sun Microsystems 1983. All rights reserved */ /* * Overview: Defines basic types used by window system */ #define bool unsigned #define coord short #define TRUE 1 #define FALSE 0 #define maxShort(a,b) (((a) > (b)) ? (a) : (b)) #define minShort(a,b) (((a) < (b)) ? (a) : (b)) #define WIN_SYS_DEBUG #define USER_DEBUG /* Scrolling related definitions */ #define Direction int #define UnSorted 0 #define TopToBottom 1 #define BottomToTop 2 #define LeftToRight 3 #define RightToLeft 4 struct vertex {coord x, y}; b[gMlioM$ $b] Xbx4/* cgreg.h 1.1 82/11/01 */ /* * Register definitions for Sun Color Board */ #define CGSIZE (16*1024) /* 16K of address space */ # define GR_bd_sel CGXBase /* Select Color Board */ # define GR_x_select 0x0800 /* Access a column in the frame buffer */ # define GR_y_select 0x0000 /* Access a row in the frame buffer */ # define GR_y_fudge 0x0200 /* Bit 9 not used at all */ # define GR_update 0x2000 /* Update frame buffer if this bit set */ # define GR_x_rhaddr 0x1b80 /* Location to read X address bits A9-A8. Data put into D1-D0. */ # define GR_x_rladdr 0x1b00 /* Location to read X address bits A7-A0. Data put into D7-D0. */ # define GR_y_rhaddr 0x1bc0 /* Location to read Y address bits A9-A8. */ # define GR_y_rladdr 0x1b40 /* Location to read Y address bits A7-A0. */ # define GR_set0 0x0000 /* Address Register pair 0. */ # define GR_set1 0x0400 /* Address Register pair 1. */ # define GR_red_cmap 0x1000 /* Address to select Red Color Map */ # define GR_grn_cmap 0x1100 /* Addr for Green Color Map */ # define GR_blu_cmap 0x1200 /* Addr for Blue Color Map */ # define GR_sr_select 0x1800 /* Addr to select status register */ # define GR_cr_select 0x1900 /* Addr to select mask (color) register */ # define GR_fr_select 0x1a00 /* Addr to select function register */ /* The following are pointers to the mask(color), status, and function regs. */ # define GR_creg (u_char *)(GR_bd_sel + GR_cr_select) # define GR_mask (u_char *)(GR_bd_sel + GR_cr_select) # define GR_sreg (u_char *)(GR_bd_sel + GR_sr_select) # define GR_freg (u_char *)(GR_bd_sel + GR_fr_select) /* These assignments are for bits in the Status Register */ # define GRW0_cplane 0x00 /* Select CMap Plane number zero for R/W */ # define GRW1_cplane 0x01 /* Select CMap Plane number one for R/W */ # define GRW2_cplane 0x02 /* Select CMap Plane number two for R/W */ # define GRW3_cplane 0x03 /* Select CMap Plane number three for R/W */ # define GRV0_cplane 0x04 /* Select CMap Plane number zero for video */ # define GRV1_cplane 0x05 /* Select CMap Plane number one for video */ # define GRV2_cplane 0x06 /* Select CMap Plane number two for video */ # define GRV3_cplane 0x07 /* Select CMap Plane number three for video */ # define GR_inten 0x10 /* Enable Interrupt to start at start of next vertical retrace. Must clear bit to clear interrupts. */ # define GR_paint 0x20 /* Enable Writing five pixels in parallel */ # define GR_disp_on 0x40 /* Enable Video Display */ # define GR_vretrace 0x80 /* Unused on write. On read, true if monitor in vertical retrace. */ /* This define returns true if the board is in vertical retrace */ # define GR_retrace (*GR_sreg & GR_vretrace) /* The following are function register encodings */ # define GR_copy 0xCC /* Copy data reg to Frame buffer */ # define GR_copy_invert 0x33 /* Copy inverted data reg to FB */ # define GR_wr_creg 0xF0 /* Copy color reg to Frame buffer */ # define GR_wr_mask 0xF0 /* Copy mask to Frame buffer */ # define GRinv_wr_creg 0x0F /* Copy inverted Creg to FB */ # define GRinv_wr_mask 0x0F /* Copy inverted Mask to FB */ # define GR_ram_invert 0x55 /* 'Invert' color in Frame buffer */ # define GR_cr_and_dr 0xC0 /* Bitwise and of color and data regs */ # define GR_clear 0x00 /* Clear frame buffer */ # define GR_cr_xor_fb 0x5A /* Xor frame buffer data and Creg */ b[lNliI$ sb_ ZbxLT/* dsdreg.h 1.1 83/03/31 */ /* * The DSD controller has only one io register, write only */ struct dsddevice { u_char dsd_rxx; /* Not used! Exists to fill Multibus word */ u_char dsd_r0; /* This one is actually used */ }; /* * Values written to DSD I/O space register */ #define DSD_RESET 0x02 #define DSD_START 0x01 #define DSD_CLEAR 0x100 typedef struct { u_short swl_lo; u_short swl_hi; } swlong_t; swlong_t swlong(); /* * The WUB is in Multibus memory at an address * which is equal to 16 times the Multibus I/O * address */ struct dsdwub { /* WUB: Wake-Up Block */ u_short dsw_reserved: 13; /* reserved */ u_short dsw_extdiag : 1; /* extended diagnostics */ u_short dsw_linaddr : 1; /* linear addressing */ u_short dsw_emul : 1; /* iSBC215 emulation, must be 1 */ swlong_t dsw_ccbp; /* pointer to CCB */ }; /* value to write to dsw_ext for extended status and linear addressing */ #define DSD_OPTIONS 7 #define DSD_BUSY 0xFF /* dsc_busy */ #define DSD_STATUS_POSTED 0xFF /* status has been posted */ /* * The controller knows about a bunch of parameter blocks which are * linked together in Multibus memory. Several of them are used * nearly all the time. I have put those together in one big block. * There is little to be gained from separaing them. */ struct dsdccb { /* CCB: Channel Control Block */ u_char dsd_busy; /* busy flag */ u_char dsd_01h; /* 0x01 (?) */ swlong_t dsd_cibp; /* pointer to CIB */ u_short dsd_reserved0; /* reserved */ u_char dsd_busy2; /* not used, but must be present */ u_char dsd_01h1; /* yet another magic number */ swlong_t dsd_cpp; /* an unused pointer */ u_short dsd_04h; /* more magic, supposedly not used */ /* CIB: Controller Invocation Block */ u_char dsd_sumerr : 1; /* Summary error */ u_char dsd_harderr: 1; /* Hard error */ u_char dsd_unit : 2; /* unit number */ u_char dsd_dtype : 1; /* drive type 0=winnie 1=floppy */ u_char dsd_mchange: 1; /* media change detected */ u_char dsd_seeked : 1; /* seek completed */ u_char dsd_done : 1; /* operation completed */ u_char : 8; /* reserved */ u_char dsd_stsema; /* status semaphore */ u_char dsd_cmsema; /* command semaphore (unused) */ long dsd_handle; /* reserved, but CCB points here (!) */ swlong_t dsd_iopbp; /* pointer to IOPB */ long dsd_reserved1; /* reserved */ /* Error Status buffer */ u_char dsd_error[13]; /* the 13 bytes have some significance, but the only one that */ /* is really interesting is the extended error byte exterr */ u_char dsd_exterr; /* abbreviated error number */ }; #define DSDCCBSZ sizeof(struct dsdccb) struct dsdiopb { /* IOPB: I/O Parameter Block */ long dsi_reserved2; /* reserved */ swlong_t dsi_xcount; /* actual transfer count */ u_short dsi_device; /* device type */ u_char dsi_cmd; /* command */ u_char : 3; /* reserved */ u_char dsi_vol : 1; /* 0=fixed, 1=removable */ u_char : 2; /* reserved */ u_char dsi_unit : 2; /* unit # */ u_char dsi_diagmod; /* diagnostic modifier, usually 0 */ u_char : 5;/* reserved */ u_char dsi_deldata : 1;/* allow deleted data (?) */ u_char dsi_noretry : 1;/* inhibit retries */ u_char dsi_nointr : 1;/* inhibit interrupts */ u_short dsi_cylinder; /* cylinder number */ u_char dsi_sector; /* sector number */ u_char dsi_head; /* head number */ swlong_t dsi_bufp; /* pointer to data */ swlong_t dsi_count; /* transfer count */ swlong_t dsi_gap; /* general addr ptr (unused) */ }; #define IOPBSIZE (sizeof(struct dsdiopb)) struct dsdinit { /* IOPB extension for initialization */ u_short dsx_ncyl; /* # of cylinders */ u_char dsx_rheads; /* # of removable heads */ u_char dsx_fheads; /* # of fixed heads */ u_char dsx_bpslo; /* bytes/sector (low byte) */ u_char dsx_nsect; /* sectors / track */ u_char dsx_acyl; /* # of alt cyls */ u_char dsx_bpshi; /* bytes/sector (hi byte) */ }; struct dsdfmt { /* format parameter block */ u_char dsf_fill1; /* fill byte 1 */ u_char dsf_type; /* type of track */ u_char dsf_fill3; /* fill byte 3 */ u_char dsf_fill2; /* fill byte 2 */ u_char dsf_intrlv; /* interleave */ u_char dsf_fill4; /* fill byte 4 */ }; struct dsdbad { /* format defective track block */ u_char dsb_acyllo; /* alt cyl low byte */ u_char dsb_type; /* type of track, 0x80 for bad track */ u_char dsb_ahead; /* alt head */ u_char dsb_acylhi; /* alt cyl high byte */ u_char dsb_intrlv; /* interleave */ u_char dsb_0x00; /* magic number 0 */ }; /* track type codes for above type fields */ #define DSD_NORMAL 0x00 #define DSD_ALTERNATE 0x40 #define DSD_DEFECTIVE 0x80 /* dsp_device */ #define DSD_WINCH 0x0000 #define DSD_FLOPPY 0x0001 #define DSD_TAPE 0x0002 /* commands */ #define DSD_INIT 0x00 #define DSD_STATUS 0x01 #define DSD_FORMAT 0x02 #define DSD_READ_ID 0x03 #define DSD_READ 0x04 #define DSD_VERIFY 0x05 #define DSD_WRITE 0x06 #define DSD_WRITE_BUF 0x07 #define DSD_SEEK 0x08 #define DSD_RESTORE 0x0F /* really a diagnostic command */ /* * For the DSD controller, the restore command just performs a * seek to track 0. There is no explicit command for this, * so the diagnostic command with the appropriate modifier is * used instead. Subcode 02 on the diagnostic command * means seek to track 0. The seek command with track 0 as the * destination is not exactly what is wanted, since it returns * immediately. */ #define DSD_REST_MOD 0x02 /* diagnostic modifier */ b[sOliM$ ?b` \bxx/* ipreg.h 1.6 83/02/15 */ /* * I/O space registers for Interphase disk controllers * (Note byte swapping) */ struct ipdevice { u_char ip_r1, ip_r0; u_char ip_r3, ip_r2; }; /* bits written to R0 */ #define IP_GO 0x01 #define IP_CLRINT 0x02 /* bits read from R0 */ #define IP_BUSY 0x01 #define IP_COMPLETE 0x02 /* * Format of IOPB in Multibus memory * Brain damage due to byte-swapping * iopb0 for 2180, 2880 * iopb1 for 2181 */ struct iopb0 { u_char i0_status; /* 01 - status of command */ u_char i0_cmd; /* 00 - command code */ u_char i0_unit_cylhi; /* 03 - unit(4 bits) & hi-order cyl(4 bits) */ u_char i0_error; /* 02 - error code */ u_char i0_sector; /* 05 - sector number */ u_char i0_cylinder; /* 04 - low-order cylinder */ u_char i0_buf_xmb; /* 07 - high-order buffer address */ u_char i0_secnt; /* 06 - sector count */ u_char i0_buf_lsb; /* 09 - low-order buffer address */ u_char i0_buf_msb; /* 08 - mid-order buffer address */ u_char i0_ioaddr; /* 0b - controller I/O address */ u_char i0_head; /* 0a - head number */ u_char i0_nxt_xmb; /* 0d - high-order next IOPB addr */ u_char i0_burstlen; /* 0c - DMA burst length */ u_char i0_nxt_lsb; /* 0f - low-order next IOPB addr */ u_char i0_nxt_msb; /* 0e - mid-order next IOPB addr */ u_char i0_seg_lsb; /* 11 - 8086 segment low-order (0 for us) */ u_char i0_seg_msb; /* 10 - 8086 segment high-order (0 for us) */ }; struct iopb1 { u_char i1_cmdopt; /* 01 - command options */ u_char i1_cmd; /* 00 - command code */ u_char i1_error; /* 03 - error code */ u_char i1_status; /* 02 - status of command */ u_char i1_head; /* 05 - head number */ u_char i1_unit; /* 04 - unit number */ u_char i1_cyl_lsb; /* 07 - cyl low byte */ u_char i1_cyl_msb; /* 06 - cyl hi byte */ u_char i1_sect_lsb; /* 09 - sector low byte */ u_char i1_sect_msb; /* 08 - sector hi byte */ u_char i1_secnt_lsb; /* 0b - # sectors low byte */ u_char i1_secnt_msb; /* 0a - # sectors hi byte */ u_char i1_buf_xmb; /* 0d - high-order buffer address */ u_char i1_burstlen; /* 0c - DMA burst length */ u_char i1_buf_lsb; /* 0f - low-order buffer address */ u_char i1_buf_msb; /* 0e - mid-order buffer address */ u_char i1_ioadd_lsb; /* 11 - I/O address low byte */ u_char i1_ioadd_msb; /* 10 - I/O address hi byte */ u_char i1_seg_lsb; /* 13 - 8086 segment low-order (0 for us) */ u_char i1_seg_msb; /* 12 - 8086 segment high-order (0 for us) */ u_char i1_nxt_xmb; /* 15 - high-order next IOPB addr */ u_char i1_unused; /* 14 - reserved */ u_char i1_nxt_lsb; /* 17 - low-order next IOPB addr */ u_char i1_nxt_msb; /* 16 - mid-order next IOPB addr */ }; #define IPIOPBSZ (MAX(sizeof (struct iopb0), sizeof (struct iopb1))) #define IP_BUS 0x20 /* 0 => 8 bit bus, 0x20 => 16 bit bus */ #define IP1_CMDOPT 0x11 /* 16 bit bus for 2181 */ #define IP_REL 0 /* absolute addressing */ #define IP0_BURSTLEN 16 /* # bus cycles at a time */ /* * The blood of countless hours of exasperation lies in the following constant. * Do not lightly muck with it! */ #define IP1_BURSTLEN 0x40 /* # bus cycles at a time */ /* Command codes for i_cmd */ #define IP_READ 0x81 #define IP_WRITE 0x82 #define IP_VERIFY 0x83 #define IP_FORMAT 0x84 #define IP_MAP 0x85 #define IP_SWITCH 0x86 /* read switches */ #define IP_INIT 0x87 /* not in 2180 */ #define IP_RESTORE 0x89 #define IP_SEEK 0x8A #define IP_ZERO 0x8B #define IP_SPINDWN 0x8C /* ANSI only */ #define IP_RESET 0x8F /* SMD only */ /* Status codes for i_status */ #define IP_OK 0x80 #define IP_DBUSY 0x81 #define IP_ERROR 0x82 /* * Unit Initialization Block * Not used for SMD-2180 */ struct uib { u_char uib_nsect; /* 1 - # sectors per track */ u_char uib_nhead; /* 0 - # heads per cyl */ u_short uib_secsize; /* 2,3 - sector size */ u_char uib_gap2; /* 5 - size of gap 2 */ u_char uib_gap1; /* 4 - size of gap 1 */ u_char uib_retry; /* 7 - # of retries */ u_char uib_intrlv; /* 6 - interleave factor */ u_char uib_reseek; /* 9 - # of restores */ u_char uib_ecc; /* 8 - ECC enable */ u_char uib_incrh; /* 11 - incr by head enable */ u_char uib_movebad; /* 10 - move bad data enable */ /* Following fields for 2181 only */ u_char uib_istatus; /* 13 - interrupt on status change */ u_char uib_dualport; /* 12 - dual port drive */ u_char uib_reserve1; /* 15 - reserved */ u_char uib_skew; /* 14 - spiral skew factor */ u_short uib_reserve2; /* 16,17 - reserved */ }; b[yPliI$ gba ]bx/* mbvar.h 4.5 83/01/06 */ /* * This file contains definitions related to the kernel structures * for dealing with the Multibus. * * The Multibus has an mb_hd structure. * Each Multibus controller which is not a device has an mb_ctlr structure. * Each Multibus device has an mb_device structure. */ #ifndef LOCORE /* * The Multibus structure. * * At boot time * we determine the devices attached to the Multibus * * During normal operation, resources are allocated and returned * to the structures here. * * When Multibus resources are needed and not available, or if a device * which can tolerate no other Multibus activity gets on the bus, * then device drivers may have to wait to get to the bus and are * queued here. */ struct mb_hd { struct mb_ctlr *mh_actf; /* head of queue to transfer */ struct mb_ctlr *mh_actl; /* tail of queue to transfer */ struct mb_ctlr *mh_cactf; /* head of queue to copy */ struct mb_ctlr *mh_cactl; /* tail of queue to copy */ struct mb_driver *mh_intr[8]; /* linked list of interrupt routines */ short mh_users; /* transient use count */ short mh_musers; /* use count of Multibus buffering */ short mh_xclu; /* a bus hog is using the Multibus */ }; /* * Per-controller structure. * (E.g. one for each disk and tape controller) * * If a controller has devices attached, then there are * cross-referenced mb_drive structures. * This structure is the one which is queued in Multibus resource wait, * and saves the information about Multibus resources which are used. * The queue of devices waiting to transfer is also attached here. */ struct mb_ctlr { struct mb_driver *mc_driver; short mc_ctlr; /* controller index in driver */ short mc_alive; /* controller exists */ caddr_t mc_addr; /* address of device in i/o space */ int mc_intpri; /* interrupt priority level */ struct mb_hd *mc_hd; caddr_t mc_baddr; /* address of active buffer */ caddr_t mc_mbaddr; /* Multibus address of active buffer */ int mc_blen; /* length of active buffer */ char mc_rw; /* READ or WRITE */ struct buf mc_tab; /* queue of devices for this controller */ struct mb_ctlr *mc_actf; /* link in transfer queue */ }; /* * Per ``device'' structure. * (A controller has devices or uses and releases Multibus memory). * (Everything else is a ``device''.) * * If a controller has many drives attached, then there will * be several mb_device structures associated with a single mb_ctlr * structure. * * This structure contains all the information necessary to run a Multibus * device such as a serial line interface. It also contains information * for slaves of Multibus controllers as to which device on the slave * this is. A flags field here can also be given in the system specification * and is used to tell which mux lines are hard wired or other device * specific parameters. */ struct mb_device { struct mb_driver *md_driver; short md_unit; /* unit number on the system */ short md_ctlr; /* mass ctlr number; -1 if none */ short md_slave; /* slave on controller */ caddr_t md_addr; /* address of device in i/o space */ int md_intpri; /* interrupt priority */ short md_dk; /* if init 1 set to number for iostat */ int md_flags; /* parameter from system specification */ short md_alive; /* device exists */ short md_type; /* driver specific type information */ caddr_t md_physaddr; /* phys addr, for standalone (dump) code */ /* this is the forward link in a list of devices on a controller */ struct mb_device *md_forw; /* if the device is connected to a controller, this is the controller */ struct mb_ctlr *md_mc; struct mb_hd *md_hd; }; /* * Per-driver structure. * * Each Multibus driver defines entries for a set of routines * as well as an array of types which are acceptable to it. * These are used at boot time by the configuration program. */ struct mb_driver { int (*mdr_probe)(); /* see if a driver is really there */ int (*mdr_slave)(); /* see if a slave is there */ int (*mdr_attach)(); /* setup driver for a slave */ int (*mdr_go)(); /* routine to start transfer */ int (*mdr_done)(); /* routine to finish transfer */ int (*mdr_intr)(); /* interrupt routine */ u_long *mdr_ioaddr; /* device csr addresses */ u_long *mdr_maddr; /* device memory address */ int mdr_size; /* amount of memory space needed */ char *mdr_dname; /* name of a device */ struct mb_device **mdr_dinfo; /* backpointers to mbdinit structs */ char *mdr_cname; /* name of a controller */ struct mb_ctlr **mdr_cinfo; /* backpointers to mbcinit structs */ short mdr_flags; /* want exclusive use of Multibus */ struct mb_driver *mdr_link; /* interrupt routine linked list */ }; /* Driver flags */ #define MDR_XCLU 01 /* needs exclusive use of bus */ #define MDR_DMA 02 /* must have buffer in Multibus mem */ #define MDR_SWAB 04 /* Multibus buffer must be swabbed */ #define MDR_OBIO 010 /* device in on-board I/O space */ #endif /* Convert interrupt prio to SR */ #define pritospl(n) (SR_SMODE|((n)<<8)) /* Maximum interrupt priority used by Multibus DMA */ #define SPLMB 4 #define IOPBMEM 4 /* 4 pages for IOPB crud */ #define MAXMBBUFMEM 40 /* max # of pages for physio buffer space */ #define MINMBBUFMEM 17 /* min # of pages - 2 2180 track sizess */ #ifndef LOCORE #ifdef KERNEL /* * Multibus related kernel variables */ extern struct mb_hd mb_hd; /* * Mbcinit and mbdinit initialize the mass storage controller and * device tables specifying possible devices. */ extern struct mb_ctlr mbcinit[]; extern struct mb_device mbdinit[]; /* * Multibus I/O space is mapped by MBIOmap * into virtual address mbio[]. */ extern char mbio[]; /* mb device addr space */ extern struct pte MBIOmap[]; /* mb device addr pte's */ /* * Definitions for Multibus memory allocation * IOPB space is always mapped into virtual address iopbs[] */ struct map *mbmemmap; #define MBMEMMAPSIZE 32 int mbmemall(); struct map *iopbmap; #define IOPBMAPSIZE 64 extern char iopbs[IOPBMEM*NBPG]; struct map *mbbufmap; #define MBBUFMAPSIZE 32 extern char mbbufspace[MAXMBBUFMEM*NBPG]; int physmbmem; /* total physical multibus memory pages */ int mbbufmem; /* # of pages of Multibus buffer memory */ #endif KERNEL #endif !LOCORE b[Qli{$ bb _bx/* mouse.h 4.2 82/12/17 */ /* * Mouse info passed by system to user * X and Y are in absolute, infinite mouse coordinates * Clamping, scaling, and movement must be done by user */ struct mouseinfo { long mi_x; /* X */ long mi_y; /* Y */ int mi_buttons; /* # of buttons in queue */ }; /* * Mouse buffer shared in memory between user and system * Established by mmap system call */ struct mousebuf { int mb_size; /* size (in mouseinfo units) of buffer */ int mb_off; /* current offset in buffer */ struct mouseinfo mb_info[1]; /* however many samples */ }; #define MIOCGPOS _IOR(m, 0, struct mouseinfo) /* get mouse info */ #define MIOCGBUFS _IOR(m, 1, int) /* get mouse buffer size */ #define MIOCSBUFS _IOW(m, 2, int) /* set mouse buffer size */ b[Rliuځ$ Fbc `bxV/* msreg.h 4.4 83/01/04 */ /* * Hardware mouse registers */ union mousedata { u_short m_reg; #ifndef OLDMOUSE /* structs used in 4 ms 3 sample cycle mouse tracking */ struct butreg { /* button sample structure */ char kbd; /* kybd bits of parallel port */ u_short butflags:4; /* if 1000B then but sample */ u_short buttons:3; /* left-middle-right, 1 is on */ /* Note: encoding dif from old */ u_short power:1; /* always 1 because is +5 volts */ } m_but; struct deltareg { /* delta sample structure */ char kbd; /* kybd bits of parallel port */ char delta; /* delta in 2's comp /* this definition of delta replaces the 2 lines below: * u_short delta:7; * u_short power:1; always 1 because is +5 volts */ } m_delta; #else struct mousereg { char m_kbd; /* keyboard bits */ u_short m_ydel:2; /* y delta gray code */ u_short m_xdel:2; /* x delta gray code */ u_short m_buttons:2; /* button info */ u_short m_toggle:1; /* toggle bit */ } m_mouse; #endif }; #ifdef KERNEL extern union mousedata Mouse; #endif /* * Software mouse registers */ struct ms_softc { int ms_xloc; /* X location */ int ms_yloc; /* Y location */ u_char ms_lastbutt; /* last buttons */ struct mousebuf *ms_buf; /* buffer address or NULL */ int ms_bufsize; /* buffer size (in pages) */ #ifdef OLDMOUSE short ms_xvel; /* X velocity */ short ms_yvel; /* Y velocity */ short ms_xaccel; /* X acceleration */ short ms_yaccel; /* Y acceleration */ u_char ms_lasttoggle; /* last toggle bit */ u_char ms_lastxdel; /* last x delta (gray) */ u_char ms_lastydel; /* last y delta (gray) */ short ms_numident; /* # identical samples */ #endif }; #ifdef KERNEL extern struct ms_softc ms_softc; #endif #define MS_NUMSTOP 30 /* Stop mouse after n identical samples */ #define MS_MAXBUFS 20 /* Max # of pages for mouse buffer */ b[Sliu2$ `bd abx/* octreg.h 4.1 83/04/02 */ /* * Octal Serial Card device registers */ struct device { u_char octstat; /* status register */ u_char octdata; /* data buffer */ u_char octcmd; /* command register */ u_char octmode; /* mode register */ }; /* * Registers and bits */ /* bits in mode register 1 */ #define OCT_ONESB 0x40 /* one stop bit */ #define OCT_ONEHSB 0x80 /* one and a half stop bits */ #define OCT_TWOSB 0xc0 /* two stop bits */ #define OCT_EPAR 0x20 /* even parity */ #define OCT_PENABLE 0x10 /* parity enable */ #define OCT_BITS6 0x04 /* 6 bit characters */ #define OCT_BITS7 0x08 /* 7 bit characters */ #define OCT_BITS8 0x0c /* 8 bit characters */ #define OCT_SYNC 0x00 /* synchronous clock */ #define OCT_X1_CLK 0x01 /* asynch 1X clock */ #define OCT_X16_CLK 0x01 /* asynch 16X clock */ #define OCT_X64_CLK 0x01 /* asynch 64X clock */ /* bits in mode register 2 */ #define OCT_MR2_INIT 0x30 /* internal RX and TX clocks */ /* bits in command register */ #define OCT_RTS 0x20 /* request to send */ #define OCT_RESET 0x10 /* reset error */ #define OCT_BREAK 0x08 /* force break */ #define OCT_RXEN 0x04 /* receiver enable */ #define OCT_DTR 0x02 /* data terminal ready */ #define OCT_TXEN 0x01 /* transmitter enable */ /* flags for modem-control */ #define OCT_ON (OCT_DTR|OCT_RTS) #define OCT_OFF OCT_RTS /* bits in status register */ #define OCT_DSR 0x80 /* data set ready */ #define OCT_CD 0x40 /* carrier detect */ #define OCT_FE 0x20 /* framing error */ #define OCT_DO 0x10 /* data overrun */ #define OCT_PE 0x08 /* parity error */ #define OCT_DONE 0x02 /* receiver has character */ #define OCT_READY 0x01 /* transmitter ready */ /* bits in dm lsr, copied from dh.c */ #define DML_DSR 0000400 /* data set ready, not a real DM bit */ #define DML_RNG 0000200 /* ring */ #define DML_CAR 0000100 /* carrier detect */ #define DML_CTS 0000040 /* clear to send */ #define DML_SR 0000020 /* secondary receive */ #define DML_ST 0000010 /* secondary transmit */ #define DML_RTS 0000004 /* request to send */ #define DML_DTR 0000002 /* data terminal ready */ #define DML_LE 0000001 /* line enable */ b[Tlr be cbx/* %M% %I% %E% */ /* Copyright Sun Microsystems 1983. All rights reserved */ /* * Overview: Defines the interface to the geometric object * called a Rect which is a rectangle. */ /* Includes */ #ifdef KERNEL #include "../sundev/basics.h" #else #include #endif /* Rect Types */ typedef struct { coord left, top; short width, height; } Rect ; extern Rect nullRect; /* Rect Geometry macros */ #define rectRight(rect) ((rect)->left+(rect)->width-1) #define rectBottom(rect) ((rect)->top+(rect)->height-1) #define printRect(rect) printf("[left: %d, top: %d, width: %d, height: %d]", \ (rect)->left, (rect)->top, (rect)->width, (rect)->height) #define adjustRectByMargin(r,m) {(r)->left-=m;(r)->top-=m; \ (r)->width+=m+m;(r)->height+=m+m;} #define constructRect(r,x,y,w,h) {(r)->left=x;(r)->top=y; \ (r)->width=w;(r)->height=h;} #define copyRect(r1,r2) {(r2)->left=(r1)->left;(r2)->top=(r1)->top; \ (r2)->width=(r1)->width;(r2)->height=(r1)->height;} /* Predicates */ #define bvEqualRects(r1,r2) ((r1)->left==(r2)->left && \ (r1)->width==(r2)->width && \ (r1)->top==(r2)->top && \ (r1)->height==(r2)->height) #define bvNullRect(r) ((r)->width == 0 || (r)->height == 0) #define bvRectIncludesPoint(r,x,y) ( x >= (r)->left && y >= (r)->top && \ x<(r)->left+(r)->width && \ y<(r)->top+(r)->height ) #define bvRectIncludesRect(r1, r2) ((r1)->left <= (r2)->left && \ (r1)->top <= (r2)->top && \ (r1)->left+(r1)->width >= \ (r2)->left+(r2)->width && \ (r1)->top+(r1)->height >= \ (r2)->top+(r2)->height ) #define bvRectsIntersect(r1,r2) ((r1)->left<(r2)->left+(r2)->width && \ (r1)->top<(r2)->top+(r2)->height && \ (r2)->left<(r1)->left+(r1)->width && \ (r2)->top<(r1)->top+(r1)->height ) bool bvVectorIntersectsRect(); /* (Rect *r; vertex *v1, *v2) * returns TRUE if modified v1 & v2 are * visible and thus should be displayed. * clips vector described by vertices v1, v2 * to r, using Cohen-Sutherland algorithm */ /* Rect geometry manipulations */ Rect boundingRect(); /*(Rect *r1, *r2) bounding Rect returned */ rectIntersection(); /* (Rect *r1, *r2, *r) * Modifies r to be intersection of r1 & r2 */ /* Embedded Rect Transformations */ rectChildToParent(); /* (coord xChildInParent, yChildInParent; * Rect *rectWrtChild) * Modifies Rect so is x, y relative to * parent instead of self */ rectParentToChild(); /* (coord xChildInParent, yChildInParent; * Rect *rectWrtParent) * Modifies Rect so is x, y relative to * self instead of parent */ b[Ulo bf dbx /* %M% %I% %E% */ /* Copyright Sun Microsystems 1983. All rights reserved */ /* * Overview: Defines the interface to the data structure called * a RectList which is a list of rectangles. */ /* Includes */ #ifdef KERNEL #include "../sundev/rect.h" #else #include #endif /* RectList data structures */ typedef struct RectNode { struct RectNode *next; /* Pointer to next RectNode */ Rect rect; } RectNode; typedef struct { coord xOff, yOff; /* Offset to apply to each rect in list including bound */ RectNode *head; /* Pointer to first RectNode */ RectNode *tail; /* Pointer to last RectNode */ Rect bound; /* Describes bounding rect of all rects in list */ } RectList ; /* RectList constants */ extern RectNode nullRNode; extern RectList nullRList; /* RectList geometry predicates and functions bool bvEmptyRectList(); /* (RectList *rl) * returns TRUE if rl covers no area */ bool bvRLIncludesPoint(); /* (RectList *rl; coord x, y) * returns whether any rectangle in rl * contains point (x, y) */ intersectRLs(); /* (RectList *rl1, *rl2, *rl) * Frees rl, then makes it contain * intersection of rl1 and rl2. */ sortRL(); /* (RList *rl1, *rl; Direction direction) * Used to order rl1 when about to scroll * (Diagonal scrolling not supported yet). */ unionRLs(); /* Like intersectRLs but does union */ difRLs(); /* Like intersectRLs but does rl1-rl2 */ /* RectList with Rect geometry predicates and functions */ bool bvRectEqualsRL(); /* (Rect *r; RectList *rl) * (bvEqualRects((r),&((rl)->bound) && * (rl)->head==(rl)->tail) */ bool bvRectInRLBound(); /* (Rect *r; RectList *rl) * bvRectsIntersect(r,&rl->bound) */ rectIntersectRL(); /* (Rect *r; RectList *rl1, *rl) * Like intersectRLs but with a rectangle */ rectUnionRL(); /* Like rectIntersectRL but does union*/ rectDifRL(); /* Like rectIntersectRL but does rl1-rl*/ /* RectList initialization functions */ initRLWithRect(); /* (Rect *r; RectList *rl) * assumes that rl is uninitialized. * offsets set to 0 */ setRectList(); /* (RectList *rlFrom, *rlTo) * simply sets, doesn't copy list */ /* Embedded RectList Transformations */ passToChildARL(); /* (coord xChildInParent, yChildInParent; * RectList *rlWrtParent) * Modifies parent relative rl offset so it's * relative to its own coordinate space. */ passToParentARL(); /* (coord xChildInParent, yChildInParent; * RectList *rlWrtChild) * Modifies self relative rl offset so it's * relative to its parent's coordinate space. */ /* RectList List Memory Management functions */ copyRectList(); /* (RectList *rl1, *rl) * Copies rl1 to rl unless rl1==rl. */ freeRectList(); /* (RectList *rl) * Frees up storage for list and sets * to nullRectList */ /* RectList Offset Adjustment functions */ Rect offsetRectAdjust(); /* (RectList *rl, Rect *r) * returns rect computed by addingi * the offsets in rl to r */ offsetCoordAdjust(); /* (RectList *rl, coord *x, *y) * subt the offsets in rl from x and y */ normalizeRectList(); /* (RList *rl) do offsetRectAdjust on * each rect in rl and set offsets to 0 */ /* Debugging Utilities printRectList(); /* (RectList *rl; char *tag) attach tag to * front of formatted rl printout on std out */ b[Vlin]$ bh fbx8/* sureg.h 4.2 83/04/02 */ /* * Sun-1 on-board UARTS. */ #ifndef LOCORE struct device { u_char subuf; /* character buffer */ u_char sudum1; u_char sucsr; /* control/status register */ u_char sudum2; }; #else #define SUBUF 0 /* subuf offset */ #define SUCSR 2 /* sucsr offset */ #define SUSIZE 4 /* sizeof (struct device) for locore.s */ #endif #define BIGBUFFER /* use bigbuffer input polling */ #define SUADDR 0x600000 /* fixed address of device */ /* * Registers and bits */ /* bits in RR0 */ #define SURR0_DONE 0x01 /* receive buffer full */ #define SURR0_READY 0x04 /* transmit buffer empty */ #define SURR0_CD 0x08 /* carrier detect */ #define SURR0_CTS 0x20 /* CTS input */ #define SURR0_BREAK 0x80 /* received break detected */ /* bits in RR1 */ #define SURR1_ALL_SENT 0x01 /* all transmitter buffers empty */ #define SURR1_PE 0x10 /* parity error */ #define SURR1_DO 0x20 /* data overrun */ #define SURR1_FE 0x40 /* framing error */ /* bits in WR0 */ #define SUWR0_RESET_STATUS 0x10 /* reset status bit changes */ #define SUWR0_RESET_ALL 0x18 /* reset entire UART */ #define SUWR0_RESET_TXINT 0x28 /* reset transmitter interrupt */ #define SUWR0_RESET_ERRORS 0x30 /* reset read character errors */ #define SUWR0_CLR_INTR 0x38 /* clear interrupt */ /* bits in WR1 */ #define SUWR1_MIE 0x01 /* modem status change intr enable */ #define SUWR1_TIE 0x02 /* transmitter interrupt enable */ #define SUWR1_STAT_AFF_VECT 0x04 /* status affects vector */ #define SUWR1_RIE 0x10 /* receiver interrupt enable */ #ifdef BIGBUFFER #define SUWR1_INIT (SUWR1_MIE|SUWR1_TIE) #else #define SUWR1_INIT (SUWR1_MIE|SUWR1_TIE|SUWR1_RIE) #endif /* bits in WR2 (channel A only) */ #define SUWR2_BOTH_INTR 0x00 /* both channels interrupt */ #define SUWR2_A_DMA_B_INTR 0x01 /* channel A does DMA, B interrupts */ #define SUWR2_BOTH_DMA 0x02 /* both channels do DMA */ #define SUWR2_RX_HIGH_PRI 0x04 /* receiver pri > transmitter pri */ #define SUWR2_8085_INTR_1 0x00 /* 8085 mode 1 interrupt */ #define SUWR2_8085_INTR_2 0x08 /* 8085 mode 2 interrupt */ #define SUWR2_8086_INTR 0x10 /* 8086 interrupt mode */ #define SUWR2_INIT (SUWR2_BOTH_INTR|SUWR2_8086_INTR|SUWR2_RX_HIGH_PRI) /* bits in WR3 */ #define SUWR3_RXENABLE 0x01 /* receiver enable */ #define SUWR3_AUTO_ENABLE 0x20 /* auto-enable receiver/transmitter */ #define SUWR3_RX_6 0x80 /* receive 6 bit characters */ #define SUWR3_RX_7 0x40 /* receive 7 bit characters */ #define SUWR3_RX_8 0xC0 /* receive 8 bit characters */ #define SUWR3_INIT (SUWR3_RXENABLE|SUWR3_AUTO_ENABLE) /* bits in WR4 */ #define SUWR4_PARITY_ENABLE 0x01 /* parity enable */ #define SUWR4_PARITY_EVEN 0x02 /* even parity */ #define SUWR4_1_STOP 0x04 /* 1 stop bit */ #define SUWR4_1_5_STOP 0x08 /* 1.5 stop bits */ #define SUWR4_2_STOP 0x0C /* 2 stop bits */ #define SUWR4_X16_CLK 0x40 /* clock is 16x */ /* bits in WR5 */ #define SUWR5_RTS 0x02 /* RTS output */ #define SUWR5_TXENABLE 0x08 /* transmitter enable */ #define SUWR5_BREAK 0x10 /* send break */ #define SUWR5_TX_6 0x40 /* transmit 6 bit characters */ #define SUWR5_TX_7 0x20 /* transmit 7 bit characters */ #define SUWR5_TX_8 0x60 /* transmit 8 bit characters */ #define SUWR5_DTR 0x80 /* DTR output */ #define SU_ON (SUWR5_DTR|SUWR5_RTS) #define SU_OFF 0 /* bits in dm lsr, copied from dh.c */ #define DML_DSR 0000400 /* data set ready, not a real DM bit */ #define DML_RNG 0000200 /* ring */ #define DML_CAR 0000100 /* carrier detect */ #define DML_CTS 0000040 /* clear to send */ #define DML_SR 0000020 /* secondary receive */ #define DML_ST 0000010 /* secondary transmit */ #define DML_RTS 0000004 /* request to send */ #define DML_DTR 0000002 /* data terminal ready */ #define DML_LE 0000001 /* line enable */ b[WliL$ kbi gbxd/* tmreg.h 4.3 82/12/28 */ /* * IOPB Definitions for Computer Products Corp. TapeMaster */ struct addr86 { u_short a_offset; u_short a_base; }; typedef struct addr86 ptr86_t; typedef unsigned bit; /* * The wire-wrapped configured System Configuration Pointer: * This is the same for all controllers since it is used only * to initialize the controller. */ #define TM_SCPADDR 0x1106 /* History! */ /* * System Configuration Pointer * At a jumpered address (low nibble 6) */ struct tmscp { char tmscb_busx, tmscb_bus; /* 8/16 bit bus flag */ ptr86_t tmscb_ptr; /* pointer to configuration block */ }; /* Definitions for tmscb_bus */ #define TMSCB_BUS8 0 /* 8 bit bus */ #define TMSCB_BUS16 1 /* 16 bit bus */ /* * System Configuration Block * Statically located between controller resets */ struct tmscb { char tmscb_03x, tmscb_03; /* constant 0x03 */ ptr86_t tmccb_ptr; /* pointer to channel control block */ }; #define TMSCB_CONS 0x03 /* random constant for SCB */ /* * Channel Control Block * Statically located between controller resets */ struct tmccb { char tmccb_gate, tmccb_ccw; /* interrupt control */ ptr86_t tmtpb_ptr; /* pointer to tape parm block */ }; /* definitions for ccb_gate */ #define TMG_OPEN 0x00 /* open - ctlr available */ #define TMG_CLOSED 0xFF /* closed - ctlr active or alloc */ /* definitions for ccb_ccw */ #define TMC_NORMAL 0x11 /* normal command */ #define TMC_CLRINT 0x09 /* clear active interrupt */ /* * Tape Status Structure - one word */ struct tmstat { bit tms_entered:1; /* tpb entered */ bit tms_compl : 1; /* tpb complete */ bit tms_retry : 1; /* tpb was retried */ bit tms_error : 5; /* error code */ /* byte */ bit tms_eof : 1; /* filemark */ bit tms_online: 1; /* on line */ bit tms_load : 1; /* at load point */ bit tms_eot : 1; /* end of tape */ bit tms_ready : 1; /* ready */ bit tms_fbusy : 1; /* fmt busy */ bit tms_prot : 1; /* wrt protected */ bit : 1; /* unused */ /* byte */ }; #define TMS_BITS "\2PROT\3BUSY\4RDY\5EOT\6BOT\7ONL\10EOF" /* Tape error codes (tms_error) */ #define E_NOERROR 0 /* normal completion */ #define E_EOT 0x09 /* end of file on read */ #define E_BADTAPE 0x0A /* bad spot on tape */ #define E_OVERRUN 0x0B /* Bus over/under run */ #define E_PARITY 0x0D /* Read parity error */ #define E_SHORTREC 0x0F /* short record on read; error on write */ #define E_EOF 0x15 /* end of file on read */ /* * Tape Parameter Block * Dynamically located via CCB */ struct tpb { short tm_cmd; /* command word(byte) */ short tm_cmd2; /* zero command word */ struct { bit tmc_width : 1; /* bus width */ bit : 2; /* unused */ bit tmc_cont : 1; /* continuous movement */ bit tmc_speed : 1; /* slow or stream */ bit tmc_rev : 1; /* reverse */ bit : 1; /* unused */ bit tmc_bank : 1; /* bank select */ /* byte */ bit tmc_lock : 1; /* bus lock */ bit tmc_link : 1; /* tpb link */ bit tmc_intr : 1; /* want interrupt */ bit tmc_mail : 1; /* mailbox intr */ bit tmc_tape : 2; /* tape select */ bit : 2; /* unused */ /* byte */ } tm_ctl; /* control word */ u_short tm_count; /* return count */ u_short tm_bsize; /* buffer size */ u_short tm_rcount; /* real size / overrun */ ptr86_t tm_baddr; /* buffer address */ struct tmstat tm_stat; /* tape status */ ptr86_t tm_intrlink; /* intr/link addr */ }; /* * Interesting tape commands (tm_cmd) */ #define TM_CONFIG 0x00 /* Configure controller */ #define TM_REWIND 0x04 /* Rewind (overlapped) */ #define TM_NOP 0x20 /* NOP - for clearing intrs */ #define TM_STATUS 0x28 /* Drive Status */ #define TM_READ 0x2C /* Read to MB memory */ #define TM_WRITE 0x30 /* Write to MB memory */ #define TM_REWINDX 0x34 /* Rewind (non-overlapped) */ #define TM_UNLOAD 0x38 /* Unload or go offline */ #define TM_WEOF 0x40 /* Write file mark (EOF) */ #define TM_SEARCH 0x44 /* search multiple filemarks */ #define TM_SPACE 0x48 /* move over tape record */ #define TM_ERASE 0x4C /* Erase fixed length */ #define TM_SPACEF 0x70 /* move over tape record till EOF */ /* * Tape directions (tmc_rev) */ #define TM_DIRBIT 1 #define TM_FORWARD 0 #define TM_REVERSE 1 /* * Definition for Multibus I/O space registers * These are byte swapped relative to documentation */ struct tmdevice { char tmdev_reset; /* Write resets */ char tmdev_attn; /* Write wakes up ctlr */ }; /* * Data which must be present for each controller * in Multibus memory. */ struct tm_mbinfo { struct tmscb tmb_scb; /* System Conf Block */ struct tmccb tmb_ccb; /* Channel Control Block */ struct tpb tmb_tpb; /* Tape Parameter Block */ }; #define b_repcnt b_bcount #define b_command b_resid b[Xl}+ bj ibx #define NVP 1 b[Yliu$ bk jbx|/* vpreg.h 1.2 83/01/20 */ /* * Registers for Ikon 10071-5 Multibus/Versatec interface * Only low byte of each word is used. (16 words total) * Warning - read bits are not identical to written bits. */ struct vpdevice { u_short vp_status; /* 00: mode(w) and status(r) */ u_short vp_cmd; /* 02: special command bits (w) */ u_short vp_pioout; /* 04: PIO output data (w) */ u_short vp_hiaddr; /* 06: hi word of Multibus DMA address (w) */ u_short vp_icad0; /* 08: ad0 of 8259 interrupt controller */ u_short vp_icad1; /* 0A: ad1 of 8259 interrupt controller */ /* The rest of the fields are for the 8237 DMA controller */ u_short vp_addr; /* 0C: DMA word address */ u_short vp_wc; /* 0E: DMA word count */ u_short vp_dmacsr; /* 10: command and status */ u_short vp_dmareq; /* 12: request */ u_short vp_smb; /* 14: single mask bit */ u_short vp_mode; /* 16: dma mode */ u_short vp_clrff; /* 18: clear first/last flip-flop */ u_short vp_clear; /* 1A: DMA master clear */ u_short vp_clrmask; /* 1C: clear mask register */ u_short vp_allmask; /* 1E: all mask bits */ }; /* vp_status bits (read) */ #define VP_IS8237 0x80 /* 1 if 8237 (sanity checker) */ #define VP_REDY 0x40 /* printer ready */ #define VP_DRDY 0x20 /* printer and interface ready */ #define VP_IRDY 0x10 /* interface ready */ #define VP_PRINT 0x08 /* print mode */ #define VP_NOSPP 0x04 /* not in SPP mode */ #define VP_ONLINE 0x02 /* printer online */ #define VP_NOPAPER 0x01 /* printer out of paper */ /* vp_status bits (written) */ #define VP_PLOT 0x02 /* enter plot mode */ #define VP_SPP 0x01 /* enter SPP mode */ /* vp_cmd bits */ #define VP_RESET 0x10 /* reset the plotter and interface */ #define VP_CLEAR 0x08 /* clear the plotter */ #define VP_FF 0x04 /* form feed to plotter */ #define VP_EOT 0x02 /* EOT to plotter */ #define VP_TERM 0x01 /* line terminate to plotter */ #define VP_DMAMODE 0x47 /* magic for vp_mode */ #define VP_ICPOLL 0x0C #define VP_ICEOI 0x20 b[Zli$ &Qbm lbx~ /* winio.h 1.1 83/02/11 */ /* Copyright Sun Microsystems 1983. All rights reserved */ /* * Sunwindow io definitions that are shared between the kernel and user. */ /* IOCTL call definitions: */ #define WINLOCKOUT _IOWR(g, 40, struct winLock) /* Copy in *winLock->rect (Window relative) that is used for cursor removal. Copy out *winLock->clippingID which is sequence number of exposed RectList. Lock screen for updates. May block. Time limit used to avoid hangups. */ #define WINUNLOCKOUT _IO(g, 41) /* Unlock screen from updates */ #define WINGETINPUT _IOWR(g, 42, struct input) /* *input copied in and input.mouse.buttons and input.keyboard.down is encoded with state/transition bits. The call waits until one of any specified states (button/key is up/down) exist or until one of any specified transition (button/key goes up/down) occurs. *input copied out when return. */ #define WINSETMOUSE _IOW(g, 43, struct mouse) /* Copy in *mouse. Set mouse position relative to window. */ #define WINSETPOINTER _IOW(g, 44, struct pointer_c) /* Copy in *pointer_c. Use pointer_c.shape[] or system provided pointer_c.type if not equal to USR_SHAPE. */ #define WINGETPOINTER _IOR(g, 45, struct pointer_c) /* Copy out *pointer_c. pointer_c.shape[] holds image for system types too. */ #define WINCREATE _IOWR(g, 46, struct winNew) /* Copy in *winNew and set up the window generated on the open call. Copy out winNew cause holds winID of new window. */ #define WINGETSIZE _IOWR(g, 47, struct winSize) /* Copy in *winSize.winID and copy out *winSize.rect which is window's height and width relative to parent. */ #define WINLOCKTREE _IO(g, 48) /* Lock tree for updates. Need not lock screen because new clipping not computed until WINUNLOCKTREE. Every ioctl call between this and WINUNLOCKTREE is blocked when non- locking Window tries to do something. Time limit used to avoid hangups. */ #define WINGRABINPUT _IO(g, 49) /* All actions directed to calling window. Used during window management user interface actions. Time limit used to avoid hangups by window with lock. */ #define WINRELEASEINPUT _IO(g, 50) /* Opposite of WINGRABINPUT. */ #define WINGETLINK _IOWR(g, 51, struct winLink) /* Copy in *winLink.winID and *winLink.which and copy out the link in *winLink.winID. */ #define WININSERT _IOW(g, 52, WinID) /* Copy in *winID and insert it (and its subtree) in the clipping tree (not done on open) of its parent. */ #define WINREMOVE _IOW(g, 53, WinID) /* Copy in *winID and remove a window (and its subtree) from the clipping tree (done on close if not done explicitely) */ #define WINCHANGESIZE _IOW(g, 54, struct winSize) /* Copy in *winSize.winID and *winSize.rect to get parent relative new rect */ #define WINADJUSTSCREEN _IOW(g, 55, struct screenInfo) /* Copy in *screenInfo to screen indicated by *screenInfo.screen. Use for changing neighbors position. */ #define WINUNLOCKTREE _IO(g, 59) /* Unlock tree from updates. Causes new clipping to be generated and affected Windows to be notified with SIGWINCH. */ #define WINGETINPARMS _IOR(g, 60, struct winInParms) /* Copy out *winInParms.mask. */ #define WINSETINPARMS _IOW(g, 61, struct winInParms) /* Copy in *winInParms.mask. */ #define WINGETEXPOSEDRL _IOWR(g, 62, struct winClip) /* Copy in *winClip.sizeInBytes and if enough room then copy out RectList that contains the clipping of the window. If not enough bytes then sizeInBytes will be alterred to specify how many needed. */ #define WINGETDAMAGEDRL _IOWR(g, 63, struct winClip) /* Like WINGETEXPOSEDRL but used during fixup when receive SIGWINCH. */ #define WINDONEDAMAGED _IO(g, 64) /* Call after finished fixing up for WINGETDAMAGEDRL. Call even if chose to ignore fixup list. */ #define WINFINDINTERSECT _IOWR(g, 65, struct winIntersect) /* Copy in winIntersect and determine which window is being pointed at, winID relative. */ #define WINGETOUTMGR _IOR(g, 66, int) /* Copy out int which is the pid of who is signalled for SIGWINCH. */ #define WINSETOUTMGR _IOW(g, 67, int) /* Copy in int which is the pid of who is signalled for SIGWINCH. */ #define WINSETSAVEDRECT _IOW(g, 68, struct winSize) /* Copy in winSize and set saved rect of winSize->winID to winSize->rect (parent relative). */ #define WINTOGGLERECTS _IOW(g, 69, WinID) /* Copy in winID and swap its current rect and saved rect. Will cause repaint. */ #define WINPRINT _IOW(g, 70, WinID) /* Copy in winID and print the windows data structure on the console. Used for debugging. */ #define WINDESTROY _IOW(g, 71, WinID) /* Copy in winID and destroy the window by killing its process and cleaning up tree. */ #define WINSETLINK _IOW(g, 72, struct winLink) /* Copy in *winLink.winID and *winLink.which and change the link in *winLink.winID to be winLink.winIDSet. */ #define WINS /* Used to differentiate between gfx and win world */ #define NWIN 32 /* Number of window will support-total for each screen */ #define NSCR 1 /* Number of screens will support */ /* Barrow some signals until get own */ #include #define SIGWINCH 28 /* Note: Get officially registered. */ /* Windows in this process changed size or clipping. Get damaged rl and fix up each window. Check to see if window size changed, if you care, by comparing your cached window size with current window size.*/ typedef int WinID; /* Kernel internal identifier of window */ struct winLock { int clippingID; /* clipping ID that must match current held */ Rect rect; /* window coordinates of area that may write */ }; #define CLIPPING_UNDEFINED 0 /* Means that clipping has not been set yet */ struct winClip { int sizeInBytes; int clippingID; coord screenOffsetX; /* Screen relative (used when paint) */ coord screenOffsetY; /* Screen relative (used when paint) */ char *block; /* Block of bytes into which the RectList will be copied. */ /* The RectList is self relative. */ }; struct winInParms { /* User setable input options */ unsigned mask; /* TBD about input mask */ }; struct winIntersect { WinID winID; coord x, y; }; #define RESIZE 1 #define DAMAGED_RL 2 struct winNew { WinID winID; WinID parent; WinID olderSib; WinID youngerSib; Rect rect; }; struct winSize { WinID winID; Rect rect; /* Rect is parent relative */ }; struct winLink { WinID winID; short which; WinID winIDSet; }; #define ENCLOSING_LINK 0 #define PARENT_LINK 0 #define COVERED_LINK 1 #define OLDERSIB_LINK 1 #define COVERING_LINK 2 #define YOUNGERSIB_LINK 2 #define BOTTOM_KID_LINK 3 #define OLDESTCHILD_LINK 3 #define TOP_KID_LINK 4 #define YOUNGESTCHILD_LINK 4 #define NULL_LINK 1024 struct keyboard{ short down; /* 1 is went down and 0 is went up on return & what class of state/transition will except on call. */ char c; /* Character invoked */ }; struct mouse{ short x, y, buttons; }; struct input { struct mouse mouse; struct keyboard keyboard; }; /* * Button names -- Bred, Bgreen, Bblue or Bleft, Bmiddle, Bright or B1, B2, B3 * Brange is a pseudo button set when the mouse leaves the window */ #define M_TRACKALLMOUSE 0x10000 #define Bred 4 #define Bgreen 2 #define Bblue 1 #define Bleft 4 #define Bmiddle 2 #define Bright 1 #define B1 4 #define B2 2 #define B3 1 #define Brange 8 /* * state/transition bits used in WINGETINPUT */ #define DOWN1 B1 #define DOWN2 B2 #define DOWN3 B3 #define OUT Brange #define UP1 (DOWN1<<4) #define UP2 (DOWN2<<4) #define UP3 (DOWN3<<4) #define IN (OUT<<4) #define TDOWN1 (DOWN1<<8) #define TDOWN2 (DOWN2<<8) #define TDOWN3 (DOWN3<<8) #define TOUT (OUT<<8) #define TUP1 (UP1<<8) #define TUP2 (UP2<<8) #define TUP3 (UP3<<8) #define TIN (IN<<8) #define NCURSOR 16 /* # of shorts in pointer shape */ #define DEFAULT_SHAPE 0 /* text arrow pointer shape */ #define USR_SHAPE 1 /* user supplied pointer shape */ #define BLANK_SHAPE 2 /* blank pointer shape */ #define WAIT_SHAPE 3 /* universal "wait because processing" pointer shape */ struct pointer_c { short type; /* Index of system shape to use as pointer_c */ coord xHot, yHot; /* Hot spot on user shape. */ short shape[NCURSOR]; /* User shape to use as pointer_c */ }; /* BEGIN CLEAN */ /* * Screen creation, inquiry and deletion. * * A screen is a piece of a viewsurface holding a tree of * windows. For now, think of just one screen per surface. * Screens are named with small integers, e.g. 0 is the b/w display, * 1 is the color display. * * To make use of the window system you should first make a ``root'' * window which covers the viewsurface and then make this the * root window for the screen with the call: * ioctl(win, WINNEWSCREEN, &screenInfo); * This call also specifies the relationship of this screen to * other screens by naming the screens which are above/left/etc * of this screen. This will allow the mouse to be moved from screen * to screen (someday). * * The call * ioctl(win, WINGETSCREEN, &screenInfo); * returns information about a specified screen. * * The call * ioctl(win, WINAXESCREEN, &screenInfo); * destroys the screen specified in screenInfo and does other * appropriately horrible things. This is permitted only to * if win is the root window of the screen. */ #define WINNEWSCREEN _IOWR(g, 57, struct screenInfo) #define WINGETSCREEN _IOWR(g, 56, struct screenInfo) #define WINAXESCREEN _IO(g, 58) typedef int Screen; #define NORTH 0 #define EAST 1 #define SOUTH 2 #define WEST 3 #define NEIGHBORS 4 struct screenInfo { Screen screen; /* screen identifier */ int *device; /* device virtual address XXX */ WinID rootWin; /* window id for root window */ Rect rect; /* location in world coordinates */ int type; /* screen type */ Screen neighbors[NEIGHBORS]; /* adjacent screen, or -1 */ }; b[[liI$ bn nbx/* wintree.h 1.1 83/02/11 */ /* Copyright Sun Microsystems 1983. All rights reserved */ /* * Kernel screen and window tree data structures */ /* * Per-viewsurface structure. * * This structure records physical attributes: whether the device * for the surface is present, its type (color, b/w, etc), * the physical addresses of the device, and the location of the * other screens in the system relative to this one (for multiplexing * a single mouse for several screens.) * * Each screen has an associated window tree for clipping, attached * to the screen starting at a root window. If the cursor is on this * screen, then the window in which the cursor is located is given. * The window to which input is directed is also given here!?! */ #define SCR_MEMORY 0 /* raster in memory */ #define SCR_SUN1_BW 1 /* sun-1 1024*800 b/w frame buffer */ #define SCR_SUN1_COLOR 2 /* sun-1 460*640 color frame buffer */ struct ScreenData { short flags; #define SF_PRESENT 0x01 /* the screen exists */ #define SF_LOCKED_DISPLAY 0x02 /* the display is locked */ #define SF_LOCKED_DATA 0x04 /* the tree data structure is locked */ #define SF_DELAYCURSOR 0x08 /* synch. for cursoring */ int pa, va; /* physical, virtual addresses */ Rect rect; /* offset relative to upper left */ int nopen; /* how many windows open */ struct WinSys *rootWin; /* root window for screen */ struct WinSys *inputOwner; /* window to which input is going */ int type; /* SCREEN_BW, SCREEN_GREY, etc */ struct WinSys *parentInvalid; /* rlInvalid is relative to this */ RectList rlInvalid; /* Accumulated damaged rl */ Screen neighbors[NEIGHBORS]; /* where are other screens? */ }; struct WinSys { short flags; #define WF_OPEN 0x01 /* device is open */ #define WF_LOCKED_DISPLAY 0x02 /* locked display */ #define WF_LOCKED_DATA 0x04 /* locked tree data structure */ #define WF_INSTALLED 0x08 /* installed in a tree */ #define WF_WANTMOUSE 0x10 /* wants the mouse */ #define WF_SIZECHANGED 0x20 /* size changed */ #define WF_RCOLL 0x40 /* select collided */ #define WF_NBIO 0x80 /* non-blocking i/o wanted */ #define WF_ROOTWINDOW 0x100 /* root window of screen */ struct WinSys *link[5]; #define WL_PARENT 0 #define WL_OLDERSIB 1 #define WL_YOUNGERSIB 2 #define WL_OLDESTCHILD 3 #define WL_YOUNGESTCHILD 4 #define NWINLINKS 5 #define ENCLOSING link[0] #define COVERED link[1] #define COVERING link[2] #define BOTTOM_KID link[3] #define TOP_KID link[4] Rect rect; /* parent relative... used when computing rlExposed */ Rect rectSaved; /* used for icon/normal toggle */ coord screenOffsetX; /* screen relative (used when paint) */ coord screenOffsetY; /* screen relative (used when paint) */ int pid; /* pid that will signal to */ int clippingID; /* incarnation of information */ /* All RectList's are self relative; use screenOffset's when paint */ RectList rlExposed; /* for normal clipping */ RectList rlExposedOld; /* for saving bits (wmgr) */ RectList rlFixup; /* for fixing damage (user) */ unsigned int mask; /* input mask */ #define M_CHANGEMASK(old, new) \ ((new)|((7&~(new))<<4)|(((new)&~(old))<<8)|(((old)&~(new))<<12)) struct clist input; /* input queue */ struct proc *rsel; /* process selecting */ short cx, cy; /* cursor position */ int transition; /* mouse event being waited for */ int oldbuttons; /* mouse buttons on last event */ struct pointer_c cursor; /* per-window cursor shape */ }; typedef struct WinSys WinSys; typedef struct ScreenData ScreenData; WinSys wins[NWIN*NSCR]; ScreenData screens[NSCR]; /******* Error codes *******/ #define WIN_OK 0 #define WIN_TABLE_FULL 1 #define WIN_PARAM_BAD 2 #define WIN_NULL_PARENT 3 #define WIN_TREE_BAD 4 #define WIN_UNKNOWN_ERR 5 #define WIN_INDEX_BAD 6 #define WIN_PTR_BAD 7 #define WIN_RLINVALID_NOT_NULL 8 #define WIN_SIG_BAD 9 #define WIN_LAST_ERR 9 postWinErr(); /* (int) */ /* Pass in error code and will post error message. */ /********* World Conversion Utilities *********/ WinSys * ptFromIndex(); /* (int index) */ int indexFromPt(); /* (*WinSys) */ /********* Temp externally used Utilities *********/ getScreenRelativeRect(); /* (*WinSys; *Rect) */ getScreenRelativeRL(); /* (*WinSys; *RectList) */ /********* WinSys basics *********/ initWin(); /* (*WinSys) */ copyWin(); /* (*WinSys winFrom, winTo) */ installWin(); /* (*WinSys) */ /* Determine parent from given windows link. */ destroyWin(); /* (*WinSys) */ /* Destroyes node and all children. */ /********* WinSys features *********/ WinSys * intersectedWin(); /* (*WinSys; coord x, y) */ /* Finds the window that contains x, y in the given window's coordinate space. */ setClipping(); /* (*WinSys) */ /* Only clipping for this window and above need change */ /********* Screen Basics *********/ WinSys * createScr(); /* (*screenInfo) returns the root */ /* This call locks the screen. Caller then must unlockScreen(root); */ destroyScr(); /* (*WinSys) the root */ /********* Debugging stuff *********/ printWin(); /* (*WinSys, *tag) */ #define LOCKPRI 28 #define MOUSEPRI 27 struct winmouse { int x, y; int oldx, oldy; int buttons; int stillticks; } winmouse; #define MOUSETIMO (hz/20) WinSys *inputGrabber; /* Debugging switches toggled by ioctl calls */ int printAll; /* if true then print every printf message */ #define unit(dev) (minor(dev)/NWIN) /* which unit is this dev? */ #define dwindow(dev) (minor(dev)%NWIN) /* which window is this? */ WinSys *findRoot(); b[\l: $ <bob5bx /* xyreg.h 1.6 83/06/27 */ /* * Xylogics 440/450 declarations */ /* * I/O space registers - byte accesses only because of 450 */ struct xydevice { /* I/O space registers (at EE40) */ u_char xy_iopbrel[2]; /* 1,0 - IOPB relocation */ u_char xy_iopboff[2]; /* 3,2 - IOPB offset */ u_char xy_resupd; /* 5 - reset/update */ u_char xy_csr; /* 4 - controller status register */ }; /* * xy_csr bits */ #define XY_GO 0x80 /* w - start operation */ #define XY_BUSY 0x80 /* r - operation in progress */ #define XY_ERROR 0x40 /* r - error occurred / w450 - clear error */ #define XY_DBLERR 0x20 /* r - double error */ #define XY_INTR 0x10 /* r - interrupting / w450 - clear interrupt */ #define XY_ADDR24 0x08 /* r450 - addressing mode */ #define XY_ATTN 0x04 /* w450 - attention request */ #define XY_ACK 0x02 /* r450 - attention acknowledge */ #define XY_DREADY 0x01 /* r - drive ready */ /* * IOPB - in real memory so we can use bit fields */ struct xyiopb { /* Byte 1 */ u_char : 1; u_char xy_intrall : 1; /* interrupt on all iopbs (450) */ u_char xy_intrerr : 1; /* interrupt on error */ u_char xy_reserve : 1; /* reserve dual port drive (450) */ u_char xy_recal : 1; /* recalibrate on seek errors (450) */ u_char xy_enabext : 1; /* enable extensions (450) */ u_char xy_eccmode : 2; /* ECC actions */ /* Byte 0 */ u_char xy_autoup : 1; /* auto update of IOPB */ u_char xy_reloc : 1; /* use relocation */ u_char xy_chain : 1; /* command chaining */ u_char xy_ie : 1; /* interrupt enable */ u_char xy_cmd : 4; /* command */ /* Byte 3 */ u_char xy_errno; /* error number */ /* Byte 2 */ u_char xy_iserr : 1; /* error indicator */ u_char : 2; u_char xy_ctype : 3; /* controller type */ u_char : 1; u_char xy_complete: 1; /* completion code valid (450) */ /* Byte 5 */ u_char xy_drive : 2; /* drive type */ u_char : 4; u_char xy_unit : 2; /* unit number */ /* Byte 4 */ u_char xy_bytebus : 1; /* use byte transfers */ u_char xy_intrlv : 4; /* interleave - 1 (450) */ u_char xy_throttle: 3; /* throttle control */ u_char xy_sector; /* 7: sector number */ u_char xy_head; /* 6: head number */ u_short xy_cylinder; /* 9,8: cylinder number */ u_short xy_nsect; /* b,a: sector count */ #define xy_status xy_nsect /* low byte is status */ u_short xy_bufoff; /* d,c: buffer offset */ u_short xy_bufrel; /* f,e: buffer offset */ u_char : 8; /* 11: reserved */ u_char xy_bhead; /* 10: base head (450) */ u_short xy_nxtoff; /* 13,12: next iopb offset */ u_short xy_eccpatt; /* 15,14: ECC pattern */ u_short xy_eccaddr; /* 17,16: ECC address */ }; /* commands */ #define XY_NOP 0 #define XY_WRITE 1 #define XY_READ 2 #define XY_SLIP 4 #define XY_SEEK 5 #define XY_RESET 6 #define XY_FORMAT 7 #define XY_READALL 8 #define XY_STATUS 9 #define XY_WRITEALL 10 #define XY_INIT 11 #define XY_TEST 12 /* controller types */ #define XYC_440 0 #define XYC_450 1 #define XYC_472 2 /* xy_status bits */ #define XY_ONCYL 0x80 /* true if zero */ #define XY_READY 0x40 /* true if zero */ #define XY_WRPOT 0x20 #define XY_RSVRD 0x10 #define XY_SKERR 0x08 #define XY_FAULT 0x04 /* xy_throttle value */ #define XY_THROTTLE 4 /* 32 words/transfer */ #define NXYDRIVE 4 /* 4 possible drive types */ /* * Layout for Read and Write of header, data, and ECC */ struct xyrec { u_short xyr_cyl; /* 1,0: cyl #, byte swapped */ u_char xyr_sector; /* 3: sector number */ /* Byte 2 */ u_char xyr_drive : 2; /* drive type */ u_char : 1; u_char xyr_head : 5; /* head number */ char xyr_data[512]; /* data */ u_long xyr_ecc; /* ECC value */ }; b[]li{_$ @b, bx/* af.h 4.3 82/03/30 */ /* * Address family routines, * used in handling generic sockaddr structures. * * Hash routine is called * af_hash(addr, h); * struct sockaddr *addr; struct afhash *h; * producing an afhash structure for addr. * * Netmatch routine is called * af_netmatch(addr1, addr2); * where addr1 and addr2 are sockaddr *. Returns 1 if network * values match, 0 otherwise. */ struct afswitch { int (*af_hash)(); int (*af_netmatch)(); }; struct afhash { u_int afh_hosthash; u_int afh_nethash; }; #ifdef KERNEL struct afswitch afswitch[]; #endif b[^liK$ ?b. bx$,/* if.h 4.18 83/04/08 */ /* * Structures defining a network interface, providing a packet * transport mechanism (ala level 0 of the PUP protocols). * * Each interface accepts output datagrams of a specified maximum * length, and provides higher level routines with input datagrams * received from its medium. * * Output occurs when the routine if_output is called, with three parameters: * (*ifp->if_output)(ifp, m, dst) * Here m is the mbuf chain to be sent and dst is the destination address. * The output routine encapsulates the supplied datagram if necessary, * and then transmits it on its medium. * * On input, each interface unwraps the data received by it, and either * places it on the input queue of a internetwork datagram routine * and posts the associated software interrupt, or passes the datagram to a raw * packet input routine. * * Routines exist for locating interfaces by their addresses * or for locating a interface on a certain network, as well as more general * routing and gateway routines maintaining information used to locate * interfaces. These routines live in the files if.c and route.c */ /* * Structure defining a queue for a network interface. * * (Would like to call this struct ``if'', but C isn't PL/1.) * * EVENTUALLY PURGE if_net AND if_host FROM STRUCTURE */ struct ifnet { char *if_name; /* name, e.g. ``en'' or ``lo'' */ short if_unit; /* sub-unit for lower level driver */ short if_mtu; /* maximum transmission unit */ int if_net; /* network number of interface */ short if_flags; /* up/down, broadcast, etc. */ short if_timer; /* time 'til if_watchdog called */ int if_host[2]; /* local net host number */ struct sockaddr if_addr; /* address of interface */ union { struct sockaddr ifu_broadaddr; struct sockaddr ifu_dstaddr; } if_ifu; #define if_broadaddr if_ifu.ifu_broadaddr /* broadcast address */ #define if_dstaddr if_ifu.ifu_dstaddr /* other end of p-to-p link */ struct ifqueue { struct mbuf *ifq_head; struct mbuf *ifq_tail; int ifq_len; int ifq_maxlen; int ifq_drops; } if_snd; /* output queue */ /* procedure handles */ int (*if_init)(); /* init routine */ int (*if_output)(); /* output routine */ int (*if_reset)(); /* bus reset routine */ int (*if_watchdog)(); /* timer routine */ /* generic interface statistics */ int if_ipackets; /* packets received on interface */ int if_ierrors; /* input errors on interface */ int if_opackets; /* packets sent on interface */ int if_oerrors; /* output errors on interface */ int if_collisions; /* collisions on csma interfaces */ /* end statistics */ struct ifnet *if_next; }; #define IFF_UP 0x1 /* interface is up */ #define IFF_BROADCAST 0x2 /* broadcast address valid */ #define IFF_DEBUG 0x4 /* turn on debugging */ #define IFF_ROUTE 0x8 /* routing entry installed */ #define IFF_POINTOPOINT 0x10 /* interface is point-to-point link */ /* * Output queues (ifp->if_snd) and internetwork datagram level (pup level 1) * input routines have queues of messages stored on ifqueue structures * (defined above). Entries are added to and deleted from these structures * by these macros, which should be called with ipl raised to splimp(). */ #define IF_QFULL(ifq) ((ifq)->ifq_len >= (ifq)->ifq_maxlen) #define IF_DROP(ifq) ((ifq)->ifq_drops++) #define IF_ENQUEUE(ifq, m) { \ (m)->m_act = 0; \ if ((ifq)->ifq_tail == 0) \ (ifq)->ifq_head = m; \ else \ (ifq)->ifq_tail->m_act = m; \ (ifq)->ifq_tail = m; \ (ifq)->ifq_len++; \ } #define IF_PREPEND(ifq, m) { \ (m)->m_act = (ifq)->ifq_head; \ if ((ifq)->ifq_tail == 0) \ (ifq)->ifq_tail = (m); \ (ifq)->ifq_head = (m); \ (ifq)->ifq_len++; \ } #define IF_DEQUEUE(ifq, m) { \ (m) = (ifq)->ifq_head; \ if (m) { \ if (((ifq)->ifq_head = (m)->m_act) == 0) \ (ifq)->ifq_tail = 0; \ (m)->m_act = 0; \ (ifq)->ifq_len--; \ } \ } #define IFQ_MAXLEN 50 #define IFNET_SLOWHZ 1 /* granularity is 1 second */ /* * Interface request structure used by socket * ioctl's SIOCSIFxxxx (set interface parameter) * and SIOCGIFxxxx (get parameter). */ struct ifreq { char ifr_name[16]; /* name of interface (e.g. "ec0") */ union { struct sockaddr ifru_addr; struct sockaddr ifru_dstaddr; short ifru_flags; } ifr_ifru; #define ifr_addr ifr_ifru.ifru_addr /* address */ #define ifr_dstaddr ifr_ifru.ifru_dstaddr /* other end of p-to-p link */ #define ifr_flags ifr_ifru.ifru_flags /* flags */ }; /* * Structure used in SIOCGIFCONF request. * Used to retrieve interface configuration * for machine (useful for programs which * must know all networks accessible). */ struct ifconf { int ifc_len; /* size of associated buffer */ union { caddr_t ifcu_buf; struct ifreq *ifcu_req; } ifc_ifcu; #define ifc_buf ifc_ifcu.ifcu_buf /* buffer address */ #define ifc_req ifc_ifcu.ifcu_req /* array of structures returned */ }; #ifdef KERNEL #ifdef INET struct ifqueue ipintrq; /* ip packet input queue */ #endif struct ifqueue rawintrq; /* raw packet input queue */ struct ifnet *ifnet; struct ifnet *if_ifwithaddr(), *if_ifwithnet(), *if_ifwithaf(); struct ifnet *if_ifonnetof(); struct in_addr if_makeaddr(); #endif b[_liy4$ )b/ bx./* netisr.h 4.3 83/01/17 */ /* * The networking code runs off software interrupts. * * You can switch into the network by doing splnet() and return by splx(). * The software interrupt level for the network is higher than the software * level for the clock (so you can enter the network in routines called * at timeout time). */ #if sun #include "../sun/sir.h" #define setsoftnet() siron(SIR_NET) #else /* #include "../vax/mtpr.h" */ #define setsoftnet() mtpr(SIRR, 12) #endif /* * Each ``pup-level-1'' input queue has a bit in a ``netisr'' status * word which is used to de-multiplex a single software * interrupt used for scheduling the network code to calls * on the lowest level routine of each protocol. */ #define NETISR_RAW 0 /* same as AF_UNSPEC */ #define NETISR_IP 2 /* same as AF_INET */ #define NETISR_NS 6 /* same as AF_NS */ #define NETISR_ND 7 /* network disk protocol */ #define schednetisr(anisr) { netisr |= 1<<(anisr); setsoftnet(); } #ifndef LOCORE #ifdef KERNEL int netisr; /* scheduling bits for network */ #endif #endif b[`lixˁ$ ib0 bxP/* raw_cb.h 4.4 82/04/10 */ /* * Raw protocol interface control block. Used * to tie a socket to the generic raw interface. */ struct rawcb { struct rawcb *rcb_next; /* doubly linked list */ struct rawcb *rcb_prev; struct socket *rcb_socket; /* back pointer to socket */ struct sockaddr rcb_faddr; /* destination address */ struct sockaddr rcb_laddr; /* socket's address */ caddr_t rcb_pcb; /* protocol specific stuff */ short rcb_flags; }; /* * Since we can't interpret canonical addresses, * we mark an address present in the flags field. */ #define RAW_LADDR 01 #define RAW_FADDR 02 #define sotorawcb(so) ((struct rawcb *)(so)->so_pcb) /* * Nominal space allocated to a raw socket. */ #define RAWSNDQ 2048 #define RAWRCVQ 2048 /* * Format of raw interface header prepended by * raw_input after call from protocol specific * input routine. */ struct raw_header { struct sockproto raw_proto; /* format of packet */ struct sockaddr raw_dst; /* dst address for rawintr */ struct sockaddr raw_src; /* src address for sbappendaddr */ }; #ifdef KERNEL struct rawcb rawcb; /* head of list */ #endif b[aliv$  b1 bxR/* route.h 4.8 82/06/12 */ /* * Kernel resident routing tables. * * The routing tables are initialized at boot time by * making entries for all directly connected interfaces. * Routing daemons can thereafter update the routing tables. * * TODO: * keep statistics */ /* * A route consists of a destination address and a reference * to a routing entry. These are often held by protocols * in their control blocks, e.g. inpcb. */ struct route { struct rtentry *ro_rt; struct sockaddr ro_dst; #ifdef notdef caddr_t ro_pcb; /* not used yet */ #endif }; #ifdef KERNEL /* * The route ``routetoif'' is a special atom passed to the output routines * to implement the SO_DONTROUTE option. */ struct route routetoif; #endif /* * We distinguish between routes to hosts and routes to networks, * preferring the former if available. For each route we infer * the interface to use from the gateway address supplied when * the route was entered. Routes that forward packets through * gateways are marked so that the output routines know to address the * gateway rather than the ultimate destination. */ struct rtentry { u_long rt_hash; /* to speed lookups */ struct sockaddr rt_dst; /* key */ struct sockaddr rt_gateway; /* value */ short rt_flags; /* up/down?, host/net */ short rt_refcnt; /* # held references */ u_long rt_use; /* raw # packets forwarded */ struct ifnet *rt_ifp; /* the answer: interface to use */ }; #ifdef KERNEL #define RTHASHSIZ 7 struct mbuf *rthost[RTHASHSIZ]; struct mbuf *rtnet[RTHASHSIZ]; #endif #define RTF_UP 0x1 /* route useable */ #define RTF_GATEWAY 0x2 /* destination is a gateway */ #define RTF_HOST 0x4 /* host entry (net otherwise) */ #define RTFREE(rt) \ if ((rt)->rt_refcnt == 1) \ rtfree(rt); \ else \ (rt)->rt_refcnt--; b[bliuB$ b3 bxh/* if_ether.h 1.3 83/04/11 */ /* * Structure of a 10Mb/s Ethernet header. */ struct ether_header { u_char ether_dhost[6]; u_char ether_shost[6]; u_short ether_type; }; #define ETHERPUP_PUPTYPE 0x0400 /* PUP protocol */ #define ETHERPUP_IPTYPE 0x0800 /* IP protocol */ #define ETHERPUP_ARPTYPE 0x0806 /* Addr. resolution protocol */ /* * The ETHERPUP_NTRAILER packet types starting at ETHERPUP_TRAIL have * (type-ETHERPUP_TRAIL)*512 bytes of data followed * by a PUP type (as given above) and then the (variable-length) header. */ #define ETHERPUP_TRAIL 0x1000 /* Trailer PUP */ #define ETHERPUP_NTRAILER 16 #define ETHERMTU 1500 #define ETHERMIN (60-14) /* * Ethernet Address Resolution Protocol. * * See RFC 826 for protocol description. Structure below is adapted * to resolving internet addresses. Field names used correspond to * RFC 826. */ struct ether_arp { u_short arp_hrd; /* format of hardware address */ #define ARPHRD_ETHER 1 /* ethernet hardware address */ u_short arp_pro; /* format of proto. address (ETHERPUP_IPTYPE) */ u_char arp_hln; /* length of hardware address (6) */ u_char arp_pln; /* length of protocol address (4) */ u_short arp_op; #define ARPOP_REQUEST 1 /* request to resolve address */ #define ARPOP_REPLY 2 /* response to previous request */ u_char arp_sha[6]; /* sender hardware address */ u_char arp_spa[4]; /* sender protocol address */ u_char arp_tha[6]; /* target hardware address */ u_char arp_tpa[4]; /* target protocol address */ }; /* * Structure shared between the ethernet driver modules and * the address resolution code. For example, each ec_softc or il_softc * begins with this structure. */ struct arpcom { struct ifnet ac_if; /* network-visible interface */ u_char ac_enaddr[6]; /* ethernet hardware address */ struct arpcom *ac_ac; /* link to next ether driver */ }; #ifdef KERNEL u_char etherbroadcastaddr[6]; /* 6 bytes of 0xFF */ struct in_addr arpmyaddr(); struct arptab *arptnew(); #endif b[cliq$ b4 bx/* in.h 4.20 83/01/17 */ /* * Constants and structures defined by the internet system, * Per RFC 790, September 1981. */ /* * Protocols */ #define IPPROTO_ICMP 1 /* control message protocol */ #define IPPROTO_GGP 2 /* gateway^2 (deprecated) */ #define IPPROTO_TCP 6 /* tcp */ #define IPPROTO_PUP 12 /* pup */ #define IPPROTO_UDP 17 /* user datagram protocol */ #define IPPROTO_ND 77 /* UNOFFICIAL net disk proto */ #define IPPROTO_RAW 255 /* raw IP packet */ #define IPPROTO_MAX 256 /* * Port/socket numbers: network standard functions */ #define IPPORT_ECHO 7 #define IPPORT_DISCARD 9 #define IPPORT_SYSTAT 11 #define IPPORT_DAYTIME 13 #define IPPORT_NETSTAT 15 #define IPPORT_FTP 21 #define IPPORT_TELNET 23 #define IPPORT_SMTP 25 #define IPPORT_TIMESERVER 37 #define IPPORT_NAMESERVER 42 #define IPPORT_WHOIS 43 #define IPPORT_MTP 57 /* * Port/socket numbers: host specific functions */ #define IPPORT_TFTP 69 #define IPPORT_RJE 77 #define IPPORT_FINGER 79 #define IPPORT_TTYLINK 87 #define IPPORT_SUPDUP 95 /* * UNIX TCP sockets */ #define IPPORT_EXECSERVER 512 #define IPPORT_LOGINSERVER 513 #define IPPORT_CMDSERVER 514 #define IPPORT_EFSSERVER 520 /* * UNIX UDP sockets */ #define IPPORT_BIFFUDP 512 #define IPPORT_WHOSERVER 513 #define IPPORT_ROUTESERVER 520 /* 520+1 also used */ /* * Ports < IPPORT_RESERVED are reserved for * privileged processes (e.g. root). */ #define IPPORT_RESERVED 1024 /* * Link numbers */ #define IMPLINK_IP 155 #define IMPLINK_LOWEXPER 156 #define IMPLINK_HIGHEXPER 158 /* * Internet address (old style... should be updated) */ struct in_addr { union { struct { u_char s_b1,s_b2,s_b3,s_b4; } S_un_b; struct { u_short s_w1,s_w2; } S_un_w; u_long S_addr; } S_un; #define s_addr S_un.S_addr /* can be used for most tcp & ip code */ #define s_host S_un.S_un_b.s_b2 /* host on imp */ #define s_net S_un.S_un_b.s_b1 /* network */ #define s_imp S_un.S_un_w.s_w2 /* imp */ #define s_impno S_un.S_un_b.s_b4 /* imp # */ #define s_lh S_un.S_un_b.s_b3 /* logical host */ }; /* * Definitions of bits in internet address integers. */ #define IN_CLASSA(i) ((((long)(i))&0x80000000)==0) #define IN_CLASSA_NET 0xff000000 #define IN_CLASSA_NSHIFT 24 #define IN_CLASSA_HOST 0x00ffffff #define IN_CLASSB(i) ((((long)(i))&0xc0000000)==0x80000000) #define IN_CLASSB_NET 0xffff0000 #define IN_CLASSB_NSHIFT 16 #define IN_CLASSB_HOST 0x0000ffff #define IN_CLASSC(i) ((((long)(i))&0xc0000000)==0xc0000000) #define IN_CLASSC_NET 0xffffff00 #define IN_CLASSC_NSHIFT 8 #define IN_CLASSC_HOST 0x000000ff #define INADDR_ANY 0x00000000 /* * Socket address, internet style. */ struct sockaddr_in { short sin_family; u_short sin_port; struct in_addr sin_addr; char sin_zero[8]; }; #if !defined(vax) /* * Macros for number representation conversion. */ #define ntohl(x) (x) #define ntohs(x) (x) #define htonl(x) (x) #define htons(x) (x) #endif #ifdef KERNEL extern struct domain inetdomain; extern struct protosw inetsw[]; #endif b[dliyy$ b5 !bx/* in_pcb.h 4.5 82/10/20 */ /* * Common structure pcb for internet protocol implementation. * Here are stored pointers to local and foreign host table * entries, local and foreign socket numbers, and pointers * up (to a socket structure) and down (to a protocol-specific) * control block. */ struct inpcb { struct inpcb *inp_next,*inp_prev; /* pointers to other pcb's */ struct inpcb *inp_head; /* pointer back to chain of inpcb's for this protocol */ struct in_addr inp_faddr; /* foreign host table entry */ u_short inp_fport; /* foreign port */ struct in_addr inp_laddr; /* local host table entry */ u_short inp_lport; /* local port */ struct socket *inp_socket; /* back pointer to socket */ caddr_t inp_ppcb; /* pointer to per-protocol pcb */ struct route inp_route; /* placeholder for routing entry */ }; #define INPLOOKUP_WILDCARD 1 #define INPLOOKUP_SETLOCAL 2 #define sotoinpcb(so) ((struct inpcb *)(so)->so_pcb) #ifdef KERNEL struct inpcb *in_pcblookup(); #endif b[elizC$ b6 #bx/* in_systm.h 4.14 82/10/09 */ /* * Miscellaneous internetwork * definitions for kernel. */ #ifndef LOCORE /* * Network types. * * Internally the system keeps counters in the headers with the bytes * swapped so that VAX instructions will work on them. It reverses * the bytes before transmission at each protocol level. The n_ types * represent the types with the bytes in ``high-ender'' order. */ typedef u_short n_short; /* short as received from the net */ typedef u_long n_long; /* long as received from the net */ typedef u_long n_time; /* ms since 00:00 GMT, byte rev */ #endif #ifndef LOCORE #ifdef KERNEL n_time iptime(); #endif #endif b[flis$ b7 $bx/* ip.h 1.11 82/12/28 */ /* * Definitions for internet protocol version 4. * Per RFC 791, September 1981. */ #define IPVERSION 4 /* * Structure of an internet header, naked of options. * * We declare ip_len and ip_off to be short, rather than u_short * pragmatically since otherwise unsigned comparisons can result * against negative integers quite easily, and fail in subtle ways. */ struct ip { #ifdef vax u_char ip_hl:4, /* header length */ ip_v:4; /* version */ #endif #ifdef sun u_char ip_v:4, /* version */ ip_hl:4; /* header length */ #endif u_char ip_tos; /* type of service */ short ip_len; /* total length */ u_short ip_id; /* identification */ short ip_off; /* fragment offset field */ #define IP_DF 0x4000 /* dont fragment flag */ #define IP_MF 0x2000 /* more fragments flag */ u_char ip_ttl; /* time to live */ u_char ip_p; /* protocol */ u_short ip_sum; /* checksum */ struct in_addr ip_src,ip_dst; /* source and dest address */ }; /* * Definitions for options. */ #define IPOPT_COPIED(o) ((o)&0x80) #define IPOPT_CLASS(o) ((o)&0x40) #define IPOPT_NUMBER(o) ((o)&0x3f) #define IPOPT_CONTROL 0x00 #define IPOPT_RESERVED1 0x10 #define IPOPT_DEBMEAS 0x20 #define IPOPT_RESERVED2 0x30 #define IPOPT_EOL 0 /* end of option list */ #define IPOPT_NOP 1 /* no operation */ #define IPOPT_RR 7 /* record packet route */ #define IPOPT_TS 68 /* timestamp */ #define IPOPT_SECURITY 130 /* provide s,c,h,tcc */ #define IPOPT_LSRR 131 /* loose source route */ #define IPOPT_SATID 136 /* satnet id */ #define IPOPT_SSRR 137 /* strict source route */ /* * Time stamp option structure. */ struct ip_timestamp { u_char ipt_code; /* IPOPT_TS */ u_char ipt_len; /* size of structure (variable) */ u_char ipt_ptr; /* index of current entry */ u_char ipt_flg:4, /* flags, see below */ ipt_oflw:4; /* overflow counter */ union { n_long ipt_time[1]; struct ipt_ta { struct in_addr ipt_addr; n_long ipt_time; } ipt_ta[1]; } }; /* flag bits for ipt_flg */ #define IPOPT_TS_TSONLY 0 /* timestamps only */ #define IPOPT_TS_TSANDADDR 1 /* timestamps and addresses */ #define IPOPT_TS_PRESPEC 2 /* specified modules only */ /* bits for security (not byte swapped) */ #define IPOPT_SECUR_UNCLASS 0x0000 #define IPOPT_SECUR_CONFID 0xf135 #define IPOPT_SECUR_EFTO 0x789a #define IPOPT_SECUR_MMMM 0xbc4d #define IPOPT_SECUR_RESTR 0xaf13 #define IPOPT_SECUR_SECRET 0xd788 #define IPOPT_SECUR_TOPSECRET 0x6bc5 /* * Internet implementation parameters. */ #define MAXTTL 255 /* maximum time to live (seconds) */ #define IPFRAGTTL 15 /* time to live for frag chains */ #define IPTTLDEC 5 /* subtracted when forwarding */ b[glir$ rb8 &bx/* ip_icmp.h 4.5 82/04/25 */ /* * Interface Control Message Protocol Definitions. * Per RFC 792, September 1981. */ /* * Structure of an icmp header. */ struct icmp { u_char icmp_type; /* type of message, see below */ u_char icmp_code; /* type sub code */ u_short icmp_cksum; /* ones complement cksum of struct */ union { u_char ih_pptr; /* ICMP_PARAMPROB */ struct in_addr ih_gwaddr; /* ICMP_REDIRECT */ struct ih_idseq { n_short icd_id; n_short icd_seq; } ih_idseq; int ih_void; } icmp_hun; #define icmp_pptr icmp_hun.ih_pptr #define icmp_gwaddr icmp_hun.ih_gwaddr #define icmp_id icmp_hun.ih_idseq.icd_id #define icmp_seq icmp_hun.ih_idseq.icd_seq #define icmp_void icmp_hun.ih_void union { struct id_ts { n_time its_otime; n_time its_rtime; n_time its_ttime; } id_ts; struct id_ip { struct ip idi_ip; /* options and then 64 bits of data */ } id_ip; } icmp_dun; #define icmp_otime icmp_dun.id_ts.its_otime #define icmp_rtime icmp_dun.id_ts.its_rtime #define icmp_ttime icmp_dun.id_ts.its_ttime #define icmp_ip icmp_dun.id_ip.idi_ip }; /* * Lower bounds on packet lengths for various types. * For the error advice packets must first insure that the * packet is large enought to contain the returned ip header. * Only then can we do the check to see if 64 bits of packet * data have been returned, since we need to check the returned * ip header length. */ #define ICMP_MINLEN 8 /* abs minimum */ #define ICMP_TSLEN (8 + 3 * sizeof (n_time)) /* timestamp */ #define ICMP_ADVLENMIN (8 + sizeof (struct ip) + 8) /* min */ #define ICMP_ADVLEN(p) (8 + ((p)->icmp_ip.ip_hl << 2) + 8) /* N.B.: must separately check that ip_hl >= 5 */ /* * Definition of type and code field values. */ #define ICMP_ECHOREPLY 0 /* echo reply */ #define ICMP_UNREACH 3 /* dest unreachable, codes: */ #define ICMP_UNREACH_NET 0 /* bad net */ #define ICMP_UNREACH_HOST 1 /* bad host */ #define ICMP_UNREACH_PROTOCOL 2 /* bad protocol */ #define ICMP_UNREACH_PORT 3 /* bad port */ #define ICMP_UNREACH_NEEDFRAG 4 /* IP_DF caused drop */ #define ICMP_UNREACH_SRCFAIL 5 /* src route failed */ #define ICMP_SOURCEQUENCH 4 /* packet lost, slow down */ #define ICMP_REDIRECT 5 /* shorter route, codes: */ #define ICMP_REDIRECT_NET 0 /* for network */ #define ICMP_REDIRECT_HOST 1 /* for host */ #define ICMP_REDIRECT_TOSNET 2 /* for tos and net */ #define ICMP_REDIRECT_TOSHOST 3 /* for tos and host */ #define ICMP_ECHO 8 /* echo service */ #define ICMP_TIMXCEED 11 /* time exceeded, code: */ #define ICMP_TIMXCEED_INTRANS 0 /* ttl==0 in transit */ #define ICMP_TIMXCEED_REASS 1 /* ttl==0 in reass */ #define ICMP_PARAMPROB 12 /* ip header bad */ #define ICMP_TSTAMP 13 /* timestamp request */ #define ICMP_TSTAMPREPLY 14 /* timestamp reply */ #define ICMP_IREQ 15 /* information request */ #define ICMP_IREQREPLY 16 /* information reply */ b[hliu$ b9 'bxj/* ip_var.h 4.9 83/03/04 */ /* * Overlay for ip header used by other protocols (tcp, udp). */ struct ipovly { caddr_t ih_next, ih_prev; /* for protocol sequence q's */ u_char ih_x1; /* (unused) */ u_char ih_pr; /* protocol */ short ih_len; /* protocol length */ struct in_addr ih_src; /* source internet address */ struct in_addr ih_dst; /* destination internet address */ }; /* * Ip reassembly queue structure. Each fragment * being reassembled is attached to one of these structures. * They are timed out after ipq_ttl drops to 0, and may also * be reclaimed if memory becomes tight. */ struct ipq { struct ipq *next,*prev; /* to other reass headers */ u_char ipq_ttl; /* time for reass q to live */ u_char ipq_p; /* protocol of this fragment */ u_short ipq_id; /* sequence id for reassembly */ struct ipasfrag *ipq_next,*ipq_prev; /* to ip headers of fragments */ struct in_addr ipq_src,ipq_dst; }; /* * Ip header, when holding a fragment. * * Note: ipf_next must be at same offset as ipq_next above */ struct ipasfrag { #ifdef vax u_char ip_hl:4, ip_v:4; #endif #ifdef sun u_char ip_v:4, ip_hl:4; #endif u_char ipf_mff; /* copied from (ip_off&IP_MF) */ short ip_len; u_short ip_id; short ip_off; u_char ip_ttl; u_char ip_p; u_short ip_sum; struct ipasfrag *ipf_next; /* next fragment */ struct ipasfrag *ipf_prev; /* previous fragment */ }; struct ipstat { int ips_badsum; /* checksum bad */ int ips_tooshort; /* packet too short */ int ips_toosmall; /* not enough data */ int ips_badhlen; /* ip header length < data size */ int ips_badlen; /* ip length < ip header length */ }; #ifdef KERNEL struct ipstat ipstat; struct ipq ipq; /* ip reass. queue */ u_short ip_id; /* ip packet ctr, for ids */ #endif b[ili{r$ b: )bx/* tcp.h 1.23 82/12/28 */ typedef u_long tcp_seq; /* * TCP header. * Per RFC 793, September, 1981. */ struct tcphdr { u_short th_sport; /* source port */ u_short th_dport; /* destination port */ tcp_seq th_seq; /* sequence number */ tcp_seq th_ack; /* acknowledgement number */ #ifdef vax u_char th_x2:4, /* (unused) */ th_off:4; /* data offset */ #endif #ifdef sun u_char th_off:4, /* data offset */ th_x2:4; /* (unused) */ #endif u_char th_flags; #define TH_FIN 0x01 #define TH_SYN 0x02 #define TH_RST 0x04 #define TH_PUSH 0x08 #define TH_ACK 0x10 #define TH_URG 0x20 u_short th_win; /* window */ u_short th_sum; /* checksum */ u_short th_urp; /* urgent pointer */ }; #define TCPOPT_EOL 0 #define TCPOPT_NOP 1 #define TCPOPT_MAXSEG 2 b[jli|$ b; *bx/* tcp_debug.h 4.2 82/03/24 */ struct tcp_debug { n_time td_time; short td_act; short td_ostate; caddr_t td_tcb; struct tcpiphdr td_ti; short td_req; struct tcpcb td_cb; }; #define TA_INPUT 0 #define TA_OUTPUT 1 #define TA_USER 2 #define TA_RESPOND 3 #define TA_DROP 4 #ifdef TANAMES char *tanames[] = { "input", "output", "user", "respond", "drop" }; #endif #define TCP_NDEBUG 100 struct tcp_debug tcp_debug[TCP_NDEBUG]; int tcp_debx; b[kliv$ b< ,bx/* tcp_fsm.h 4.12 81/12/21 */ /* * TCP FSM state definitions. * Per RFC793, September, 1981. */ #define TCP_NSTATES 11 #define TCPS_CLOSED 0 /* closed */ #define TCPS_LISTEN 1 /* listening for connection */ #define TCPS_SYN_SENT 2 /* active, have sent syn */ #define TCPS_SYN_RECEIVED 3 /* have send and received syn */ /* states < TCPS_ESTABLISHED are those where connections not established */ #define TCPS_ESTABLISHED 4 /* established */ #define TCPS_CLOSE_WAIT 5 /* rcvd fin, waiting for close */ /* states > TCPS_CLOSE_WAIT are those where user has closed */ #define TCPS_FIN_WAIT_1 6 /* have closed, sent fin */ #define TCPS_CLOSING 7 /* closed xchd FIN; await FIN ACK */ #define TCPS_LAST_ACK 8 /* had fin and close; await FIN ACK */ /* states > TCPS_CLOSE_WAIT && < TCPS_FIN_WAIT_2 await ACK of FIN */ #define TCPS_FIN_WAIT_2 9 /* have closed, fin is acked */ #define TCPS_TIME_WAIT 10 /* in 2*msl quiet wait after close */ #define TCPS_HAVERCVDSYN(s) ((s) >= TCPS_SYN_RECEIVED) #define TCPS_HAVERCVDFIN(s) ((s) >= TCPS_TIME_WAIT) #ifdef TCPOUTFLAGS /* * Flags used when sending segments in tcp_output. * Basic flags (TH_RST,TH_ACK,TH_SYN,TH_FIN) are totally * determined by state, with the proviso that TH_FIN is sent only * if all data queued for output is included in the segment. */ u_char tcp_outflags[TCP_NSTATES] = { TH_RST|TH_ACK, 0, TH_SYN, TH_SYN|TH_ACK, TH_ACK, TH_ACK, TH_FIN|TH_ACK, TH_FIN|TH_ACK, TH_FIN|TH_ACK, TH_ACK, TH_ACK, }; #endif #ifdef KPROF int tcp_acounts[TCP_NSTATES][PRU_NREQ]; #endif #ifdef TCPSTATES char *tcpstates[] = { "CLOSED", "LISTEN", "SYN_SENT", "SYN_RCVD", "ESTABLISHED", "CLOSE_WAIT", "FIN_WAIT_1", "CLOSING", "LAST_ACK", "FIN_WAIT_2", "TIME_WAIT", }; #endif b[llizE$  b= -bx/* tcp_seq.h 4.1 81/11/29 */ /* * TCP sequence numbers are 32 bit integers operated * on with modular arithmetic. These macros can be * used to compare such integers. */ #define SEQ_LT(a,b) ((int)((a)-(b)) < 0) #define SEQ_LEQ(a,b) ((int)((a)-(b)) <= 0) #define SEQ_GT(a,b) ((int)((a)-(b)) > 0) #define SEQ_GEQ(a,b) ((int)((a)-(b)) >= 0) /* * Macros to initialize tcp sequence numbers for * send and receive from initial send and receive * sequence numbers. */ #define tcp_rcvseqinit(tp) \ (tp)->rcv_nxt = (tp)->irs + 1 #define tcp_sendseqinit(tp) \ (tp)->snd_una = (tp)->snd_nxt = (tp)->snd_max = (tp)->snd_up = \ (tp)->iss #define TCP_ISSINCR 128 /* increment for tcp_iss each second */ #ifdef KERNEL tcp_seq tcp_iss; /* tcp initial send seq # */ #endif b[mlin$ b> .bx/* tcp_timer.h 4.9 82/12/20 */ /* * Definitions of the TCP timers. These timers are counted * down PR_SLOWHZ times a second. */ #define TCPT_NTIMERS 4 #define TCPT_REXMT 0 /* retransmit */ #define TCPT_PERSIST 1 /* retransmit persistance */ #define TCPT_KEEP 2 /* keep alive */ #define TCPT_2MSL 3 /* 2*msl quiet time timer */ /* * The TCPT_REXMT timer is used to force retransmissions. * The TCP has the TCPT_REXMT timer set whenever segments * have been sent for which ACKs are expected but not yet * received. If an ACK is received which advances tp->snd_una, * then the retransmit timer is cleared (if there are no more * outstanding segments) or reset to the base value (if there * are more ACKs expected). Whenever the retransmit timer goes off, * we retransmit all unacknowledged segments, and do an exponential * backoff on the retransmit timer. * * The TCPT_PERSIST timer is used to keep window size information * flowing even if the window goes shut. If all previous transmissions * have been acknowledged (so that there are no retransmissions in progress), * and the window is shut, then we start the TCPT_PERSIST timer, and at * intervals send a single byte into the peers window to force him to update * our window information. We do this at most as often as TCPT_PERSMIN * time intervals, but no more frequently than the current estimate of * round-trip packet time. The TCPT_PERSIST timer is cleared whenever * we receive a window update from the peer. * * The TCPT_KEEP timer is used to keep connections alive. If an * connection is idle (no segments received) for TCPTV_KEEP amount of time, * but not yet established, then we drop the connection. If the connection * is established, then we force the peer to send us a segment by sending: * * This segment is (deliberately) outside the window, and should elicit * an ack segment in response from the peer. If, despite the TCPT_KEEP * initiated segments we cannot elicit a response from a peer in TCPT_MAXIDLE * amount of time, then we drop the connection. */ #define TCP_TTL 15 /* time to live for TCP segs */ /* * Time constants. */ #define TCPTV_MSL ( 30*PR_SLOWHZ) /* max seg lifetime */ #define TCPTV_SRTTBASE ( 1*PR_SLOWHZ) /* base roundtrip time */ #define TCPTV_KEEP ( 45*PR_SLOWHZ) /* keep alive - 45 secs */ #define TCPTV_PERSMIN ( 5*PR_SLOWHZ) /* retransmit persistance */ #define TCPTV_MAXIDLE ( 8*TCPTV_KEEP) /* maximum allowable idle time before drop conn */ #define TCPTV_MIN ( 1*PR_SLOWHZ) /* minimum allowable value */ #define TCPTV_MAX ( 30*PR_SLOWHZ) /* maximum allowable value */ #define TCP_LINGERTIME 120 /* linger at most 2 minutes */ #define TCP_MAXRXTSHIFT 10 /* maximum retransmits */ #ifdef TCPTIMERS char *tcptimers[] = { "REXMT", "PERSIST", "KEEP", "2MSL" }; #endif /* * Retransmission smoothing constants. * Smoothed round trip time is updated by * tp->t_srtt = (tcp_alpha * tp->t_srtt) + ((1 - tcp_alpha) * tp->t_rtt) * each time a new value of tp->t_rtt is available. The initial * retransmit timeout is then based on * tp->t_timer[TCPT_REXMT] = tcp_beta * tp->t_srtt; * limited, however to be at least TCPTV_REXMTLO and at most TCPTV_REXMTHI. */ float tcp_alpha, tcp_beta; /* * Initial values of tcp_alpha and tcp_beta. * These are conservative: averaging over a long * period of time, and allowing for large individual deviations from * tp->t_srtt. */ #define TCP_ALPHA 0.9 #define TCP_BETA 2.0 /* * Force a time value to be in a certain range. */ #define TCPT_RANGESET(tv, value, tvmin, tvmax) { \ (tv) = (value); \ if ((tv) < (tvmin)) \ (tv) = (tvmin); \ if ((tv) > (tvmax)) \ (tv) = (tvmax); \ } b[nlirց$ ;b? 0bx/* tcp_var.h 4.18 83/01/17 */ /* * Kernel variables for tcp. */ /* * Tcp control block, one per tcp; fields: */ struct tcpcb { struct tcpiphdr *seg_next; /* sequencing queue */ struct tcpiphdr *seg_prev; short t_state; /* state of this connection */ short t_timer[TCPT_NTIMERS]; /* tcp timers */ short t_rxtshift; /* log(2) of rexmt exp. backoff */ struct mbuf *t_tcpopt; /* tcp options */ struct mbuf *t_ipopt; /* ip options */ short t_maxseg; /* maximum segment size */ char t_force; /* 1 if forcing out a byte */ u_char t_flags; #define TF_ACKNOW 0x01 /* ack peer immediately */ #define TF_DELACK 0x02 /* ack, but try to delay it */ #define TF_DONTKEEP 0x04 /* don't use keep-alives */ #define TF_NOOPT 0x08 /* don't use tcp options */ struct tcpiphdr *t_template; /* skeletal packet for transmit */ struct inpcb *t_inpcb; /* back pointer to internet pcb */ /* * The following fields are used as in the protocol specification. * See RFC783, Dec. 1981, page 21. */ /* send sequence variables */ tcp_seq snd_una; /* send unacknowledged */ tcp_seq snd_nxt; /* send next */ tcp_seq snd_up; /* send urgent pointer */ tcp_seq snd_wl1; /* window update seg seq number */ tcp_seq snd_wl2; /* window update seg ack number */ tcp_seq iss; /* initial send sequence number */ u_short snd_wnd; /* send window */ /* receive sequence variables */ short rcv_wnd; /* receive window */ tcp_seq rcv_nxt; /* receive next */ tcp_seq rcv_up; /* receive urgent pointer */ tcp_seq irs; /* initial receive sequence number */ /* * Additional variables for this implementation. */ /* receive variables */ tcp_seq rcv_adv; /* advertised window */ /* retransmit variables */ tcp_seq snd_max; /* highest sequence number sent used to recognize retransmits */ /* transmit timing stuff */ short t_idle; /* inactivity time */ short t_rtt; /* round trip time */ tcp_seq t_rtseq; /* sequence number being timed */ float t_srtt; /* smoothed round-trip time */ /* out-of-band data */ char t_oobflags; /* have some */ char t_iobc; /* input character */ #define TCPOOB_HAVEDATA 0x01 }; #define intotcpcb(ip) ((struct tcpcb *)(ip)->inp_ppcb) #define sototcpcb(so) (intotcpcb(sotoinpcb(so))) struct tcpstat { int tcps_badsum; int tcps_badoff; int tcps_hdrops; int tcps_badsegs; int tcps_unack; }; #ifdef KERNEL struct inpcb tcb; /* head of queue of active tcpcb's */ struct tcpstat tcpstat; /* tcp statistics */ struct tcpiphdr *tcp_template(); struct tcpcb *tcp_close(), *tcp_drop(); struct tcpcb *tcp_timers(), *tcp_disconnect(), *tcp_usrclosed(); #endif b[oliz$ b@ 2bx/* tcpip.h 4.1 81/11/29 */ /* * Tcp+ip header, after ip options removed. */ struct tcpiphdr { struct ipovly ti_i; /* overlaid ip structure */ struct tcphdr ti_t; /* tcp header */ }; #define ti_next ti_i.ih_next #define ti_prev ti_i.ih_prev #define ti_x1 ti_i.ih_x1 #define ti_pr ti_i.ih_pr #define ti_len ti_i.ih_len #define ti_src ti_i.ih_src #define ti_dst ti_i.ih_dst #define ti_sport ti_t.th_sport #define ti_dport ti_t.th_dport #define ti_seq ti_t.th_seq #define ti_ack ti_t.th_ack #define ti_x2 ti_t.th_x2 #define ti_off ti_t.th_off #define ti_flags ti_t.th_flags #define ti_win ti_t.th_win #define ti_sum ti_t.th_sum #define ti_urp ti_t.th_urp b[pli{$ bA 3bx/* udp.h 4.3 81/11/18 */ /* * Udp protocol header. * Per RFC 768, September, 1981. */ struct udphdr { u_short uh_sport; /* source port */ u_short uh_dport; /* destination port */ short uh_ulen; /* udp length */ u_short uh_sum; /* udp checksum */ }; b[qlizQ$ bB 4bx</* udp_var.h 4.3 81/11/18 */ /* * UDP kernel structures and variables. */ struct udpiphdr { struct ipovly ui_i; /* overlaid ip structure */ struct udphdr ui_u; /* udp header */ }; #define ui_next ui_i.ih_next #define ui_prev ui_i.ih_prev #define ui_x1 ui_i.ih_x1 #define ui_pr ui_i.ih_pr #define ui_len ui_i.ih_len #define ui_src ui_i.ih_src #define ui_dst ui_i.ih_dst #define ui_sport ui_u.uh_sport #define ui_dport ui_u.uh_dport #define ui_ulen ui_u.uh_ulen #define ui_sum ui_u.uh_sum struct udpstat { int udps_hdrops; int udps_badsum; int udps_badlen; }; #ifdef KERNEL struct inpcb udb; struct udpstat udpstat; #endif b[rlitt$ b| }bx=/* in_proto.c 5.4 83/01/17 */ #include "../h/param.h" #include "../h/socket.h" #include "../h/protosw.h" #include "../h/domain.h" #include "../h/mbuf.h" #include "../netinet/in.h" #include "../netinet/in_systm.h" /* * TCP/IP protocol family: IP, ICMP, UDP, TCP. */ int ip_output(); int ip_init(),ip_slowtimo(),ip_drain(); int icmp_input(); int udp_input(),udp_ctlinput(); int udp_usrreq(); int udp_init(); int tcp_input(),tcp_ctlinput(); int tcp_usrreq(); int tcp_init(),tcp_fasttimo(),tcp_slowtimo(),tcp_drain(); int rip_input(),rip_output(); extern int raw_usrreq(); /* * IMP protocol family: raw interface. * Using the raw interface entry to get the timer routine * in is a kludge. */ #include "imp.h" #if NIMP > 0 int rimp_output(), hostslowtimo(); #endif /* * Network disk protocol: runs on top of IP */ #include "nd.h" #if NND > 0 int nd_input(), nd_slowtimo(), nd_init(); #endif struct protosw inetsw[] = { { 0, PF_INET, 0, 0, 0, ip_output, 0, 0, 0, ip_init, 0, ip_slowtimo, ip_drain, }, { 0, PF_INET, IPPROTO_ICMP, 0, icmp_input, 0, 0, 0, 0, 0, 0, 0, 0, }, { SOCK_DGRAM, PF_INET, IPPROTO_UDP, PR_ATOMIC|PR_ADDR, udp_input, 0, udp_ctlinput, 0, udp_usrreq, udp_init, 0, 0, 0, }, { SOCK_STREAM, PF_INET, IPPROTO_TCP, PR_CONNREQUIRED|PR_WANTRCVD, tcp_input, 0, tcp_ctlinput, 0, tcp_usrreq, tcp_init, tcp_fasttimo, tcp_slowtimo, tcp_drain, }, { SOCK_RAW, PF_INET, IPPROTO_RAW, PR_ATOMIC|PR_ADDR, rip_input, rip_output, 0, 0, raw_usrreq, 0, 0, 0, 0, }, #if NND > 0 { 0, PF_INET, IPPROTO_ND, 0, nd_input, 0, 0, 0, 0, nd_init, 0, nd_slowtimo, 0, }, #endif }; struct domain inetdomain = { AF_INET, "internet", inetsw, &inetsw[sizeof(inetsw)/sizeof(inetsw[0])] }; #if NIMP > 0 struct protosw impsw[] = { { SOCK_RAW, PF_IMPLINK, 0, PR_ATOMIC|PR_ADDR, 0, rimp_output, 0, 0, raw_usrreq, 0, 0, hostslowtimo, 0, }, }; struct domain impdomain = { AF_IMPLINK, "imp", impsw, &impsw[sizeof (impsw)/sizeof(impsw[0])] }; #endif b[sĺ$ 2bbb? XxNV n B"n #PN^NuNVBN^Nu@@@ @PPPP @$@(@,@0@4@8@<@@@D@H@L@P@T@)8 BOV_j r_mclrefcnt_null_hash_inet_netmatch_null_netmatch_afswitch_nmbclusters_mfree_mclfree_inet_hash_mbstatb[tlI*$ 2bbblt(0  NV.*n 9#BHmNPJgB`p*nN^NuNVH0*n0-H(@)m 2R,L0N^NuNVH0*n(m2BB-B-||Bm8Bm:B-B- B +|+|+|+|B$+|(B-0B-1|6Bm8B-B-0.+@<|,gJgHy0NX.<B@`,fJg S,gJfJgHTHyENP,gJgHyjNX,gJgHyNX| Sn.<B@`Jg S,gJf$JgHyNX`BB`,HxHx0.H/a JfB-pL0N^NuNVH00. H. *@Jg/. 0. H/HyN lJ-fT0. /Hy`20. H/HUaPJf00. /Hy` /-. ,. 0H*@Jg/0H/HyN J-o0gB-J-g0HxHx0H/a HxHx0H/a `B-HxHx 0H/a J-gHxHx0H/a -gnHxHx0H/a ||`JHxB0H/ar HxHx0H/a^ HxHx0H/aJ ||B-J-l B m2B-JgHyNXL N^NuNVH00. H(@Jg /./. 0. H/HyNJ,lp`A*HN, g&@HxHUaPJg/NXp`* /NX;n +n+n (B$HUa`XN, fHxHUa6PJgp`./NXHUNX. @g HUNXB L0N^NuNVH0*n0-H-@-@@(@B N-@ f .gv .ghSJlZJgHyNXHxHyaTPJgR;| n|1 n!m LHUN`LJ f )M B` l!M )MJg/9HUHy9N nJ(6g/.aX/.NXL0N^NuNVH0.. *@J-6fDHy^NX`2/HytNP`6JgHTHU/HyNB-J-l9|Jg(0,H///,$/,/, HTHyN|1+l L fHAg@Ag8JnHyNXRJg/9HyNPHTN`Aff|1-l(B$ f+| 0,@0+l ( . @/HUaP@6 -6f|6`Af4J-g.B-` g0/,/, NPB()l(` ,$ng f ,r Ь$+@ - $f4+l$|1 f-||`$-|`JgHT/- /,$HyN9|`"J-6g(mLfJfL0N^NuNV.*n-m-m2 g f  f-| +m+n Jg@/-$/-(/. . r @//. .r @/HyGN g g fHUa^X` gv  fH`h  f -| `R  f -| `< g0  g$p`j g g gJg/. . r @//. .r @/HyN|`B*nN^NuNVH0B*|J-g (m2,fR mB`BJfHTHyNP`HUa&X@6J-6gJLg/avXpL0N^NuNVH8*n(m2&mL-|,g gJg$/- -r @/HyN +m+| `HyNXHUaXJg-g^| - R+@p-1 g g gp-1/Hy NPB-17|`-g-f/-@DPZ@`P@@@P@ @P$@*P8@>P`OPvOP|P)POPx@@@@@\P@@@@@@@@@@@@@@@@@@@@@@ @@@ dV(19CLT^hnv 8@ "8h",4<@DMV]8gpwrBH ! )7>GOYbktz ,@( %-7?G_nbuf_arstrategy_arprobe_arsleep_rootdev_linesw_ar_softc_uprintf_printf_mbbufmem_bclnlist_mpid_nswdev_arintproc_file_armachine_mbmemmap_runin_ardebug_blkclr_pokec_arstart_bswlist_nchrdev_setjmp_arstart_cmd_arattach_kmapwnt_arinit_buffermap_panicstr_nswap_geterror_noproc_swdevt_aropen_physmem_biodone_dmmax_ardriver_rablock_sleep_arstatename_buffers_boothowto_arcommand_arclose_argdev_nfile_spl3_armaxbufs_buf_physio_runout_dumpdev_selwait_zdmap_nblkdev_arreadldivt_cdevsw_rasizeDiagRet_ar_stat_bits_dmmin_updlock_runrun_bufpages_bufhash_minphys_ar_cmds_splx_cpu_arintr_wakeup_maxmem_araddrs_swbuf_swapdev_u_arwrite_fileNFILE_physmbmem_wantin_panic_iopbmap_dumplo_hand_bfreelist_arioctl_dmtext_nswbuf_ardinfo_arphys_mbbufmap_bdevsw_curprib[ ul4$ bbb@1NV#aNBN^NuNVH0HyHyNP-@JfHyNX(|`"-l n-hJf .X @-PgB e n ( r //9NP-@fHyNX .r -@Hy n ( r / .r / .r / ./N` .Ю @JfZ .-@0,H//. n PNP-@Jf6Jg(/. n ( r //9N B`/.Jg <` </0,H/ n/(,HyN-l Jo m/.HyNPJg`f/.HyNP/./.aPJg` .ЮЮ @Sl9|)|)n nJ0g (02,HЁ @ *|` fJmf0-lg m?f/.HU n hNPJg;|;l+|(+n Jmg l;yR`;|+L$ nJ(g ((2-HЁ @ 0-H/0,H/ n/(,0-H//($HyN nJg HU hNX,Jff-Tf*|`Jmfv mfl-m n-hJf .X @-PgD n0(4-@BJg -n` e n ( r //9NP-@fHyNX .r -@Hy n ( r / .r / .r / ./N` .Ю @JfZ .-@0-H//. n PNP-@Jf6Jg(/. n ( r //9N B`/.Jg <=`Jg <B` <H/0-H/ n/($Hy.N-mJo m/.HyMNPJg`X/.Hy`NP/./.aPJf Jg` .ЮЮ @Sl+|(;|+n ;| nJ(g ((2-HЁ @ nJg HU hNX,-UfxHy/.NPL0N^NuNVH8*n . @(P` g0&L(l6fB6f . @ `'M6L8N^Nuno mem for mbconfigout of kernelmap for devices%s%d at %s %x mbmemmbiobad priority (%d) pri %d %s%d at %s%d slave %d out of kernelmap for devices%s%d at %s %x obiombmemmbiobad priority (%d) pri %d KP5PKP0>P6YPF@LSPTdPVP P@SP"P8P"0P@DPVPP@@@P@P@PPHPzPHPZPZPZPH@NPPVP P"@(SP:"P~8P0PDPVPP @@"@:@@Pd@jP@PHP$ PJHPzHP $-5?IOXajt|tt@  )08BKU`it} #t(1:BJPZcl6sx4$$.5 ?HPYa_nbuf_klseql_rootdev_desscan_mbdinit_printf_mbbufmem_bclnlist_mpid_rmalloc_cp_time_swapmap_wmemfree_nswdev_sum_mbmemmap_runin_freemem_rate_dk_time_rmfree_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_configure_physmem_saferss_usrpt_maxslp_multprog_rablock_swptstat_avefree30_buffers_boothowto_dk_xfer_argdev_klout_buf_dk_seek_nscan_mapin_deficit_tk_nout_runout_kltxt_setconf_dumpdev_selwait_Usrptmap_nblkdev_rasizeDiagRet_forkstat_nswapmap_memall_cnt_updlock_klsdist_tk_nin_runrun_mbio_bufpages_bufhash_minfree_mb_hd_cpu_addintr_cold_klin_maxmem_argmap_swbuf_swapdev_physmbmem_wantin_panic_iopbmap_total_kernelmap_lotsfree_dumplo_zmemall_dkn_hand_bfreelist_nswbuf_dk_busy_mbbufmap_mbmap_mbconfig_dk_mspw_curpri_mbcinit_dk_wdsb[vlΗ$ 2bbbXLHX(NVH8*nHx3HmNPJfnBHmNPJf\A((H&MBHSNPJfDHx\HTNPJf2HTNXHx3HTNPHTNX f <@`BL8N^NuNV.0. . l$  @Jg  @ PJhfp` . fp`B..N^NuNVH0BB  @*Pg.Jmg((m p,gp,g|,R m L0N^NuNVH 0.  @ P*h @ mp` Ю  @0?. L N^Nu@cgP(P@PRP`PnPxP2P2P2Pr2P @ @$@0@42P ",6<@HNU^hov@"~+4H;DLT \fmv\ $,6>F_nbuf_rootdev_linesw_peekc_mbbufmem_bclnlist_mpid_qs_nswdev_file_nproc_whichqs_mbmemmap_runin_pokec_bswlist_nchrdev_cgintr_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_dmmax_rablock_buffers_boothowto_argdev_nfile_buf_procNPROC_runout_dumpdev_pidhash_selwait_zdmap_nblkdev_cdevsw_rasizeDiagRet_cgdriver_dmmin_cgprobe_updlock_runrun_bufpages_bufhash_cpu_cginfo_maxmem_cgmmap_swbuf_swapdev_fileNFILE_proc_physmbmem_wantin_iopbmap_dumplo_cgstd_hand_bfreelist_cgopen_nswbuf_dmtext_mbbufmap_bdevsw_curprib[wl^$ cbbb[|8NV#x <"9N333 "3 333"N^NuNV#N^NuNVN^NuNVN^Nu P PP P" PZPt P ! +/9jGLR^dboxR_lbolt_avenrun_hostnamelen_hostname_tz_boottime_setsoftclock_scb_tick_clknomouseldivt_resettodr_clkrate_sirmask_hz_startrtclock_inittodr_hostid_timeb[xl$ Bbbb`&P;PP UPPPP $P(:P,GP0P4HP<P@;PDPHOPPHPTHPXP\HPdgPh;PlPpPx9P|;PPkP8PFPdPPP;P;PPP#P%P PNPaPmP;PPPPHP P;P)PtP|P;P;PvPHP;P ;PwPsPHP;P ;P(P,@P0&P4;P8MP<`P@lPDHPH;PPPTHPXP\P`PdKPhXPlHPp;PxP|HP7PEPHPPP;P;PPHP;P;PPJPHPHP;PHPHP:PGPcPPPHP;PPHPP;P>PP P HP;PPHP HP$HP(HP,HP0HP4HP8HP@HPDHPHHPLHPPHPTHPXHP\HP`HPhHPlHPp{PtPxP|!P+P;P;PQPPHPPPPHPWPHPHPPPzPP;PHPHPHPHPHPPyPHPHPHPHPHPHPHPHP HP9P;PbPP P$HP(;P0P4HP8HP<HP@HPDHPHHPLHPPHPXHP\HP`HPdHPhHPlHPpHPtHPxHPHPHPgP;PP4PAPHP;PPHP P2P(PrPVPhPHPZPPHP P1P'PqPVP;PHPZPuPHPHPHPHP HPHPHPHP HP$HP(HP,HP0HP4HP8HP<HP@;PHHPLHPPHPTHPXHP\HP`HPdHPh;PpHPtHPxHP|HPHPHPHPHPHPPHP *6BNZfox ",5 >FNW_hqy@ !(09AJQZenw '~09H@IR\dlt| &.6>GMT]foxZZ"+3;CLS[dlv~_nbuf_suread_ddstrategy_ndstrategy_swstrategy_xystrategy_arstrategy_tmstrategy_ipstrategy_ptcopen_ptsopen_xyioctl_syopen_rootdev_linesw_msclose_tmclose_bclnlist_mpid_ntext_qs_nswdev_file_nproc_msread_swread_tmread_whichqs_xyopen_runin_inodeNINODE_rootdir_octclose_suwrite_ttlowat_cnmmap_tmdump_octopen_ipopen_ptcread_ptsread_syread_bswlist_suioctl_nchrdev_kmapwnt_buffermap_panicstr_nswap_ptcclose_ptsclose_acctbuf_ndwrite_noproc_swdevt_vpopen_cnopen_ddopen_aropen_nulldev_physmem_dmmax_xyread_rablock_mmmmap_ndioctl_inode_buffers_boothowto_vpclose_cnclose_arclose_nodev_argdev_swwrite_tmwrite_nfile_ipread_octread_xydump_buf_su_tty_procNPROC_tthiwat_runout_ipdump_ptyioctl_msioctl_tmioctl_dumpdev_pt_tty_ninode_pidhash_selwait_zdmap_nblkdev_ipwrite_octwrite_ddread_arread_cnread_cdevsw_rasize_ndopen_ptsstop_dmmin_updlock_dddump_ipioctl_octioctl_runrun_bufpages_bufhash_ptcwrite_ptswrite_mmwrite_sywrite_ptcselect_syselect_mmread_maxmem_cgmmap_msmmap_suopen_syioctl_text_swbuf_swapdev_suclose_ddwrite_arwrite_vpwrite_cnwrite_fileNFILE_proc_ndread_textNTEXT_wantin_mstty_octreset_seltrue_dumplo_cons_hand_nddump_bfreelist_ddioctl_cgopen_msopen_arioctl_vpioctl_cnioctl_tmopen_dmtext_nswbuf_oct_tty_acctp_mem_no_xywrite_bdevsw_ttselect_curprib[!yl$ bbb lNV.*|B4+|$ ->fF y 8 HUNX+| :| HmHG+|>HxBHzN ->g Jygp`"HU0. H/-EH( @ PNP*nN^NuNVHy9EH( @ PNXHyNXN^NuNV/. Hy9EH( @ PNPN^NuNV/. Hy9EH( @ PNPN^NuNVH *| ->gN,`HU/-EH( @ PNP y N. f -> gB g6/9 y NXJf">HU-EH( @ PNX/NXHxBHzLN L N^NuNVH *nB ->!fTJgL y ,Jf ># f m  maB`4-H @0H"-o` 9rN/BHzN `JoHmNX. g~ -: fr /HUHyN >`l ->@g>HmNXJ,gh ->//-,NPB,>`B/ y NXJgR >#-H @0H"-otL N^NuNVH0*|~(|B`H -: gB`HxHmNP.Jg( Ї n/HTHmN ܇JnJo4(|`R e/9 T/Hy y \N Jf4HmNX. /HUHyN >`Jo N-@>-H @0H"-nJ ->@g>HmNXJ,g$ ->//-,NPB,>/.NXL0N^NuNVH0*|/././. HU-EH( @ PN-@Jm .`/././. HUN-@Jl . kg kgp`^ n"y 8"B`N(|HxHy n/N Jgp`& є Ѭ Ѭ Ѭ Ѭ y @ `L0N^NuNV  mp`& y T Ю  @0?-@N^NuNVH..N, fHx y NX/ y NX/NXLN^NuNV. y N. g ..N^NuNV y T-PHx .p/NP .p/NXN^Nu`P@4jPbiPxWPP`P`PP`PP`P`PP`P`P*PD`PX.PpPPPPLPiPBPpPKPSP>PiPTPJPiP PP>3PnPP`P@CPP @@.@HTP^JPdiPKP.PPPP3PLP"`P@PncP@@kPH/PtLP4P'P #.8BLR\c:ks |  @'/7?IRY_ht} H'/7 ?EPW`hr{:  !Z'-8AJRZdlu_nbuf_q_to_b_rootdev_lineswEXC_ADRERR_ttyclose_mbbufmem_bclnlist_mpidEXC_TRACE_lbolt_cnpoll_nswdevUSERCODE_mbmemmap_avenrun_hostnamelen_runin_ttlowat_cnmmap_consout_hostname_cnstart_tz_bswlist_nchrdev_cn_pendc_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_cngetc_cnopenEXC_RESET_physmem_dmmax_peek_rablockEXC_BOOTING_buffers_boothowto_cnclose_argdev_spl5_spl7_bufEXC_BREAK_tick_selwakeup_poke_runout_tthiwatEXC_ABORTEXC_EXIT_dumpdev_selwait_zdmap_nblkdev_cnreadldivtEXC_DOG_rasize_cdevswDiagRet_ndqbEXC_BUSERR_dmmin_updlock_runrun_bufpages_bufhash_ttrstrt_sirmask_splx_cpu_cnintrINITSPa_wakeup_cnputc_maxmem_hz_getc_swbuf_swapdev_u_cnwrite_physmbmem_hostid_wantinEXC_KCMD_time_iopbmap_dumplo_cons_hand_bfreelist_ttioctl_cnioctl_nswbuf_dmtext_mbbufmap_bdevsw_timeout_ttychars_copyin_curprib['zl<$ ?bbbDp!,NV .=@ .r=@A  @"|)" <)N^NuNVH0 . "HA""HABAЁ*@ . ! @ (@+nHx -R/NPJflHTHx/9N Jg*Hx./9NP+@ Jf>Hy#hNX`( . ! @ //. Hy#N B`|Hx./- NPHUHT/- a BmB`H .//. Hy#N /- Hx./9N B-`R l,<Sn m g;|JmgpL0N^NuNVH8*n(n &n k|T  @p0@r " /aX-@ @)P|| ;|A-H  @p0@r "./aX-@ @+P k|BSn k|L8N^NuNVpN^NuNVH<*n0-"(@0->&@0-H-@J!gHy#NXJ!f$Jf/9BHzN RHx/9NP$@fHy#NXL<N^NuNVH0*n(n HT "<>N/Hy$ N |@;lBBmF;lD;lH;lJ;lL;lP;lR;lNB lA . ." Ҁ"A"#hR`'J( ." Ҁ A 7m<'M4'm$8Hx/9NP-@JfHy$NXB+@`7|BBkFBkD7|HBkJ7|L7|NBkPBkRHxHSapPJgHTaX/Hy$9NP`B lj nBh/././.HTaJg/././. "<>N/aJgl/.HSaHPHxHSaP/.Hx/9N J+@fB l ." Ҁ AB ." Ҁ ABR`R`2 m4Jhmfp0-N-@p0-L"HA<N/Hy$KNPpL8N^NuNVH0*n(n . " Ҁ A "<>N.BlBBBHxHxB/.B/. HTHxHUa$Jg HUaX-@JgB .".ЁS"HAHABAЁ"& @HH".RmJgD .".ЁS"HAHABAЁ"' @HH".Rm8Jg .".ЁS"HAHABAЁ"( @//././Hy$rNB`p0-Br2-DЁ6mEB+@mMB+|J gHxBBBB/HSBHTav$`*BBHSBB "<>N/a*HSHx/9N `pL0N^NuNV.*nHxBBBB m p(/ -  /HxHUa$ m (-*nN^NuNV.*n mھg:B*nN^NuNVBn=|-n0.SnJ@gv n0nT`HUaXJf@/./.Hy$`"/./.Hy$`p0-//.Hy$N `~p0-".f mbp`dJngB`pN^NuNVH0 n*h .Ю @ P(h(  fp`B@ Bln ., , .+, ,   9nn#n . @p0@r "./aX-@ @)P .$r /aX-@ @)P  @p0@r " /aNX-@ @+P n h gB-J!g$/.( . # @/Hy%N n h|J(g /.aX`BL0N^NuNVH *n.< m f.,<Sn SJnHy%NX m|p` m| m p(L N^NuNVJ!g/. 0. H/Hy%)N 0. HrN-@"HA>>HABAЁ-@ @J8fp` nJ(@fB .Ю @B .Ю @!|R m n1|B nBhF n1|H nBhJ n1|LB/.a~PJg(/.Hy%ANP`Hy%XNXp` n|@Hx/9NP-@JgB l nBh n1nJBHx/.BHx0. H/aJJf/./. n h40(H/ ."<>N/aJgH/./.aPB/.aP m nBhJ/.Hx/9N B`R`2N^NuNV0. HrN"HA>>HABAЁ-@0. HrNЮ-@ nJ(@fp` n (N^NuNVH<*nJ!gHy%zNX0-. l "HA>>HABAЁ(@0-HrN" Ҁ&AJ,@f Af-m$ .nJgf +m(`0,LH" .N+@(p0,FГѭ(Ah$H l8 ( /NX,HUHRNPJf*HTalX ,8"*@J gJf /,8aX/N`HUNXL>HABAЁ*@J!g( . # @/0. H/Hy%N A(H m8 ( /NX` JgB`@HxHTNP f( N9n n,n.)n)n )n$HTaXJfHTNX @g HTNX L0N^NuNVH<*ng&m4$m80+HrFùAh(HJ gdJf0)|Jkm"0+Hrᡃ0+H @R g$BJ.f%L.` j2!L%L2)|L<N^NuNVH<*n`+k.&m.g(k gR60,"HA>>HABAЁ$@0-"-@-l$0,HrN" Ҁ-A ,"<N-@ n ($".l ` n ($-@ n r2*HNr2*LNѮ n!n n!l  n1n)l(HUa XL<N^NuNVH<*n m.$h 0*"HA>>HABAЁ&@0-"(@r2+L ,Nr2+L. o <` .0,Hl `0,H.+l r 㠰(l r ` *(+@(Af +,g +,gB @ HUNXL>HABAЁ(@Ah .gHy%NXr2,L +N-@r2,L +N-@r2,H .N-@r2,H .N-@p0,JѮp0,FѮAfD *"<N-@p,,-@ gL gBJg>-j `< -"<N-@ g -|`-|-m l40(H-@m4p".㠁 . @R -". Aѐ l40(H-@B/././././/./.HSa$L<N^NuNVH>HABAЁ(@)y0 n0(HrFùp*, n( *0("<N(f Hy& `JgHUaX-@HUaXЮS"HAHABAЁ"&-@0-Rm nHAmBm0- Rm n(HAm ""mHy&/.HS/aAfL ,,fBB,@ l4Jhm l40(H @ #b0+/Hy&"NP` ""mHy&1/.HS/ax0+HrN& "HA>>HABAЁ4 @ P0(H&BBBBB/BHxHUax$` ""mHy&9/.HS/a/.a`\ fAf ,,f g f0m`Bm٭ r ѭJmf Bm ;m /.NX""e L>HABAЁ-@ fJjo|HUaXL<N^NuNV n /($ n/(/. .# @/ n 0(HrNa/ n 0(HrN/Hy&?N`j&m.B6+k.B'l HTNX .f nJ(.gJ g /.arXJ.g6J6f.HUa`"N^NuNV.0. HrN. mp`@/. HyHx0. H/ "HA>>HABAЁ/HzN..N^NuNV.0. HrN. mp`>/. HyB0. H/ "HA>>HABAЁ/Hz N..N^NuNVH00. HrN"HA>>HABAЁ*@0. HrN" Ҁ(A . dgZ dgh dg@ &dg @dg$ @ dgt @&dgpL0N^NuNVH Hx/9NP*@f^pL N^NuNVH Hx/9NP*@fp`-n m8 ( n m4"n3h m80(" @"n3P n1|B`FAB"n <"Q2`NJf9HH` n <CB"Q2BHUabP` n !l`NJg n()h`NJg-np0-L-@ n-hr2-H N".N-@ n Ю-@".NJf .谮gp`b .Ю".Ҭn/.BHx/. n(//0. H/a,JfB .r /B n/Hx0. H/a`NJg-nr2-H Nr2-LN-@ n Ю-@p0-L-@ n-h-h .".NJf .谮f .Ю".Ҭnp0-H".N" .N-@p0-H".N" .N-@/.Hx@Hx/. n( //.0. H/aJfB .r /B/.Hx0. H/aJfnHx/././. n/0. H/aJfBB .r /B n`rnnnnn . Ю,`.B/. HU/. Hx0. H/a.Jf . Ѯ . mHUHx/9N `(|n . .@nB-B/.HU/. Hx0. H/an.HUHx/9N L N^NuNV.R*|`LJ-@g@ 90 m.HxBBBHx "<>N/a>|e/9BHzN *nN^NuNVH80. HrN"HA>>HABAЁ*@0. HrN" Ҁ(A m80("&@ m40(H-@J-@fp` .l Юop`r2-L .N-@r2-L .N-@r2-H .N-@r2-H .N-@p0-JѮp0-FѮ ѮHx/./././././. HxHSa$-@Jgp`BL8N^Nu8,*!&\&_&c&q&&&&&&&&&'''"'2'A'O']'k'y''''''(((4(P(^(l(z((((())/)=)H)U)\)d)i)p)v))?ddprobe: no ccb space ddc%d: can't get MBmem at %x to initialize controller ddc%d: Unknown controller type at mbio 0x%x ddattach ddattach: no space for iopb dd%d: <%s> ddattach: no space for disk label ddattach: err %x dd%d: can't get initialization memory dd%d: error %x reading label on head %d: %s dd%d: Corrupt label on head %d dd%d: Misplaced label on head %d dd%d: Unsupported phys partition # %d ddcmd: %s nointr=%d dd timeout ddopen: dev %d flag %X dd%d: unit not online ddopen: no buffer for disk label ddstratetgy ddcommand: dev=%d %s ddgo queueing error 1ddgo queueing error 2ddintr dd: intr from unknown unit ddintr: unexpected interrupt ddintr: bad bp faileddd%d: offline restoreretrydd%d%c: %s %s (%s) blk %d ddddcunknown errorunknown errorunknown errorRAM errorROM errorseek in progressIllegal format typeEnd of mediaIllegal sector sizeDiagnostic FaultNo indexInvalid commandSector not foundInvalid addressUnit not readyWrite protectunknown errorunknown errorunknown errorData ECC or CRC errorID ECC or CRC errorDrive faultCylinder address miscompareSeek errorData field not foundWrong type of data fieldDrive spinning too fastDrive spinning too slowRead/write controller errorunknown errorunknown errorunknown errorTape cartridge not in placeTape cartridge write protectedTape drive not on lineTape unrecoverable data errorNo data on tapeData Miscompare during diagnosticUnknown tape errorunknown errorinitializeerror statusformatread IDreadverifywritewrite from bufferseekrestore(@0@XPPf@rjP$PPPPP@ P@@ POP<ePH@N P`Pf)PPPP@@ P@^PsPP^P&P,P@@F PlPxWP@ P&P,P<@B P@ PPWP(P.)PlP P@@!P*PP PP2P8PNPZWPb@h PPWP @h@@@ P>PJWPdPj)P <@ L@ `@ f P @ @ @ P \@ b P @ @ P ;P P @ P @ P P P 0P <WP P )P ;P P ;P@@ PTPd;PlPmPAP0mP@9Pd;P|P@@@ PmP=PDP@PZpPPPHPnP~PP;PWPPPpPPPLPXPBPP`@fP;PP@PLPlPlPLP:WP~WPPCPP6@>@D PLPPv@@ P@PPWPP$PNPV}PnPlP@@8@@@P@@ P@@;PP6@>@xPPPPP;PPj@;P;P@ P9P4;PLhPrP~JP;PhPPJP ;P$P4;PPPPPeP(PP`PjwPPPPP;PPPP;P:PFlPZPfLPP)PP)P }P P (}P JP VWP nP vsP P ;P P ;P PP!.LP!BlP!VlP!jLP@@ @$@(@,@0@<@@PD@HPX@^@d@j@p@v@|@@@@@@@@@@@@@@@@@@@@@@@@ @@@@$@*@0@6@<@B@F@J@N@R@V@Z@^@b@f@@  8'!18AIPY bjsy|!J%+!4,:A KT]air@{ r"+6@PKTZb"&mr{<"H" # !*4>EN V^flvz *#^V "-6>FOU\epx~"" , _nbuf_ddstrategy_ddsize_ddprobe_dsdaddrs_suser_rootdev_linesw_rmget_uprintf_ddwatch_printf_dderrorfflti_mbbufmem_ddslave_bclnlist_mpid_lbolt_rmalloc_cp_time_swapmap_ddusegeom_swlong_ddunits_nswdev_ddcdriver_mbmemmapulmult_avenrun_hostnamelen_runin_dderrmsgfdivi_dddebug_ddgo_pokec_hostname_dk_time_ddstart_tz_rmfreefsinglei_bswlist_nchrdev_ddattach_boottime_kmapwnt_dddone_buffermap_panicstr_nswap_noproc_swdevt_ddopen_physmem_ddustart_biodone_dmmaxlmodt_rablock_sleep_dd_def_trk_buffers_boothowto_disksort_ddcommand_dk_xfer_spl0_argdev_dsderrors_buf_dk_seek_ddrstart_physio_tickulmodt_tk_nout_runout_bzero_ddctlrs_dumpdev_selwait_ddislabel_zdmap_nblkdev_ddreadldivt_mbgo_cdevsw_rasize_DSD_cmdlistDiagRetieeeused_ddwstart_nswapmap_dmmin_updlock_dddump_tk_nin_runrun_mbio_bufpages_bufhash_minphys_ddgetlabel_iopbs_ddcmduldivt_splx_cpu_ddintr_wakeup_ddintrkludge_maxmem_hz_argmap_swbuf_swapdev_u_mbdone_dduselabel_ddwrite_ddck_cksum_physmbmem_ddticks_hostid_wantin_ddcinfo_time_panic_iopbmap_kernelmap_dumplo_hand_bfreelist_ddioctl_dderrlvl_dmtext_nswbuf_ddwait_dddinfo_dk_busy_mbbufmap_mbmap_ddformat_bdevsw_biowait_timeout_dk_mspw_curpri_ddwakeup_dk_wdsb[8{l4$ bbb2tNVH *n . r".ЁЮ,BA 0rA"2(Ё*f `Jm R ~mpL N^Nu @(16@IPWbj_nbuf_bclnlist_bswlist_buffermap_buffers_buf_bufpages_bufhash_isbad_swbuf_bfreelist_nswbufb[:|l$ gbbbH<"Ba` H<"a&atLBFCa@ar, AKNux ,<.̂(ȃ⊄(΀ȁ∀NuJf F m F BJgk [ZNu<NuH|"a a L>NuBBvJjDBNu laBJf JkJCjDNu"<Nux JBk&Dm JfDD@`xS$Ąf.ȁ`$DBDm"BD`xSF„Ȁ BNuJBkNu&HCBBf<Jg$<` f4<`B<Jg<SB<BBNu8 m `$Jg PDf gkSDjDa "KNuJkSDJDn Dm"DRBDdRD Dl UNuBNu <NuUOH8$/&/(ȀjBCf (g< <B ㊰dB c?| `f?| LDNtoNqH?$/&/ UUŰcBCEHa.JGf(gzJFf `0 FglFDGQGmfJf` ^GkQJkցՀdRF Fm`FdFED@aaM "LNta4`(fFfJj$<B`$<B`H?$& /"/ *Ba^:G8<a,8<aᏄg$&<Fa`.HGODfJfJgRGSgNu8<@AaBCFgDgagDg*NuaJk(Fg$Jg `Jk8g4$<`>Jf Jj4XO`Gfl<$HBNFHB b $<JjTB`BBXO`^BփՂ\ ǖ[j ցՀ JD]NuH?$& /"/ *xa28SGGo <SFaF aNa~ "LNtH?$/&/ *グcBCa:,G EgJGgHL:/B:/ օӇ:/ օӇ:օӇ:/ ԅч: ԅчH@: ҅чH@6HCBAHAւчЁ$Fa "LNt*Gg<<a`.gSFjRF`N$<`BB`IEEE software "%+07@>C8KS@Ybjts|x. j@4H6 "&,5<<BhH M?Vb\.ck:rx>jBzNl (nSAVE03ffixiusetopffltid_nrcpisnanbackdmsignclrbotdiffd_2_xitbotzerofdivifdoubleisigned0dsigned0RESTMASKgeninfovflbotbignbothmiufld_packfsingleid_rcpgnshaddingd_unpki_packeswapdmexittopzerog_intendasf_rcpshsubusela_geninfi_unpkd_normf_packNSAVEDunpfcmpiieeeusedf_unpkfmulimsignCODESAVEMASKfsubigennanxit_2_dgotnanuselngenzeroextremassgna_ovflfaddisignffixisnormutopbigdrcpbigd_useld_extemexitasexitfloatflavorFETCH03gotcmpm_gennanfmodiffltisb[?}lZ$ bbbNV.*y`(JLg0-H/ mLNXJDf+yD*mpfa*nN^NuNV.*|` p*@Jf**nN^NuNV.*y`V n0-PfFHx T/HmN Jg60- gHx .T/Hm*N Jg *mpf *nN^NuNVH8*np0. eB`<  @&P(y`p0,fHlHUNPJf (lpf L8N^NuNVH ..*y` -g *mpf L N^NuNVH ..*y`p0-g *mpf L N^NuNV.*nm HmBNP*nN^NuNV.*y`&JmgSmfJXg0-H/ mXNX*mpf/9BHzN *nN^NuNVH8(n &L` 0m 9oRJfJfp`HH0-@B*y`* /HT/N Jf0-H".g*mpf` . s gT sg sg s g sg| sgp`A)P)h)h)h B`HxHUNPN-@A+P+h+h +h $/. mLNX/.NX`0- gA(`0- gpN-@A+P(+h,+h0+h 4`9m ``0,f*0- gN-@HUaX/.NX;l ` L8N^NuNVH<*n (y-UB-mA$H`gHxHn/N A&H`JgRe0,H0BA-P-h-h-h Hx /.HnN -@Jf   (lp nj .ؑ .L<N^Nu25P,@R5Pz5PPP P5PZ5P5PP5P/P&9Pv5PPP PT-P~PP-P5P6%P1PJ%0L>DKS_hu|r 6 (1<DJR[dks| _if_ifwithaf_rootdev_if_attach_if_rtinit_if_ifonnetof_mpid_lbolt_nswdev_pfctlinput_avenrun_hostnamelen_runin_afswitch_if_ifwithaddr_rawintrq_hostname_ifrequest_bcmp_tz_if_slowtimo_nchrdev_boottime_kmapwnt_panicstr_nswap_noproc_ipintrq_splimp_physmem_if_ifwithnet_rablock_boothowto_argdev_tick_runout_dumpdev_selwait_bcopy_ifinit_nblkdev_rasize_if_down_updlock_ifconf_runrun_splx_maxmem_hz_swapdev_copyout_hostid_wantin_time_ifnet_dumplo_ifqmaxlen_hand_timeout_curprib[C~l$ bbb\\0NV.*nHUNXJmHmNXJlB`p*nN^NuNVH0 n0(-@*@(h ;h*;|T~Sn .t-@A-HB n"nRRR m n(y/(x/(w/(v/(u/(t/ n0(H/HyN .-@ @0 nJgL n(wr n(xቀ n(y-@/ n/(NP`N-@ @ .X"@"+|L+| P+|THUNXL0N^NuNV. l8 . @*Pg Jmg/.HyNP/.a X*nN^NuNVH8 ."HAHABAЁ-@*@A(HJg /,NX+@/,NX+@A(&H6B/-NP-@ @'P;| . @ P-h N-@ .t-@ .-@B n"nRRR m nP nP nBh n1|~ nh nJ8g/.aDX/.NXHx/.NP/.NXHl/.NPL8N^NuNV0. -@"HAHABAЁ-@ . @ P-h nJhfx-h8Jg( n"n#h|8f nB< nB| nS@Jf nBh`4/. ./aP n0 00 n1|N^NuNVH(BB l ."HAHABAЁ*@ . @&PgjJkgd-k n0Jg g @gB Dg: gv gn g gHyNXR`N n0 n0 ./HUaP n0 n0R` n0 n0 ./HUajP n0@@` nP? ./HUa:P n0` n0?0 ./HUaP n0@@`( n0?0 n00`B ."HAHABAЁ*@ . @&PglJkgf-k JmgZ n0gRlR/.a`8 n0 f,00RRdBm;|~J8g /.aXR mP .L(N^NuNVH0 nR\ n 0H-@fv o o nR``N .-@ . T*@ m eh m d`p0- r -@ lA;P A0(-@ .Юn .Ю-@`BJg/././. a -@JgJg @X nYhp0- g g8/.NX`d(| , mR`/./.NP`( nB|Jf(` l!n|)nRL0N^NuNVH0 ."HAHABAЁ*@ . @ P(h Jm~f2Rh/.HyNPBm;|~J8g6/.aX`*~0-~F@HD9@p08L0N^NuNVH8 n0(*@(n B n0Jg f X @-PHnHnHTHUNJgh/.NXJfHy;BHTN -@ Ь @0(2,H.JgRJoN fD e: r -@YXl Ь @0 Ь @1lJgn(T`-|B`n .T&@HxHnHSN p0+ -@`F n0/ n0(H/HyN -|/`( n (PB-L |b d8HxBNP(@f -|7`( )| 9|`l Ь&@HxHSHnN 7n HxHkHmtN N-@ n"H (@Dm.RH-|7-L /.NX/. NX .`vB| nJ\ ecec%d: Ethernet address %x:%x:%x:%x:%x:%x ec%decintr: impossible valueec%d: send error ec%d: can't handle af%d mgetec.P.PL!Pb@ @ Pz/PP@@@PNP@ P4!PRiPb?P~/PNP+P8KPHPTPd5P!PNPr!PNP@]P*!P8NPOPPJP*P<P!PNP@ PZP 2!P tLP ?P \P @ @>P p@ v P P >P $>P .+P \KP hOP KP UP 6P `>P |OP +P BP @ ]P dP dP BP fP KP X+P bVP pRP zP dP VP KP >PHOP@ @@@(@,NP "-9DIT\fpv}  @>#-7@ GR\ck\ v 6*3:DMU\`fox &t/7>FOV^do w _nbuf_netisr_rootdev_m_get_if_attach_ectrailers_mclrefcnt_ipq_if_rtinit_printf_mbbufmem_bclnlist_mpid_lbolt_rtnet_nswdev_ecread_arpmyaddr_arpinput_mbmemmap_avenrun_hostnamelen_runin_ecget_ip_id_rawintrq_hostname_tz_ipstat_bswlist_nchrdev_arpattach_ecintr_ec_softc_boottime_kmapwnt_ecput_buffermap_panicstr_nswap_noproc_etherbroadcastaddr_ipintrq_splimp_physmem_ecstd_peek_if_makeaddr_rablock_buffers_nmbclusters_boothowto_argdev_arpwhohas_looutput_buf_tick_runout_ecdocoll_dumpdev_ecattach_selwait_bcopy_in_lnaof_nblkdev_rasize_mfree_ecdriver_ecprobe_updlock_runrun_bufpages_bufhash_routetoif_sirmask_splx_arpresolve_ecreset_ecinfo_m_freem_maxmem_hz_mbutl_swbuf_swapdev_loif_mclfree_physmbmem_hostid_wantin_time_ecstart_m_copy_panic_ecinit_iopbmap_ifnet_dumplo_hand_bfreelist_mbstat_nswbuf_m_more_mbbufmap_rthost_in_netof_ecoutput_curprib[KlW$ bbb l @0NV/.NXJlB` <N^NuNVH0 n0(v*@;h* ;| n+h n0(H @ P h 0(+@A(H8/-/-NP-@ @)PA((H8B/-NP-@ @)P;| +|JL+|*P+|THUNXL0N^NuNV. l8 . @*Pg Jmg/.Hy NP/.a X*nN^NuNVH8 ."HAvvHABAЁ*@ . @(P&l 7|B07@R m7|7mBkN, ,F7@m /.a$X/NXHxHUNPL8N^NuNVH<0. -@ @-P ."HAvvHABAЁ*@-m8Jg n+h|8fB< nB|S@JfBmt` n(h B$n` 0*HѮ$Rf .R-@9n$n`(0*HR-@ Ъ&@`9[SJf$Rf/.NX;|tL<N^NuNVH0BB . @ PJhg ."HAvvHABAЁ*@ . @ P(h p0, gRp0,-@p0,-@fR\N-@-ygH nJh gHy NX n1| SyRy n#B n!| `HxBNP-@/.NX .pfJf@ .PgR` . gRl .-@`p0,-@SJfJgN-@ nJh fHy NX n0( H @SP nBh n cB (Ј-@r  @Sf n #Ry n-P nB nB|#Ry/.NXp0,gp0,-@RJmtf` .W-@-@ o/.Hy NP` pobN-@-yg( .r  @RSy n#/.NXJgT . n!@` n!|  n1np0,-@p0,-@ m lr ".쒀Y-A n (ЈЁ-@ .r -@ n-@` n0T .SJfp0,-@p0,Y-@аg/./.Hy N n (Ј-@ nN .-@ .SJg@ n0T` n (Ј-@ .-@` n0T .SJfp0,-@ . f@-| n"H ( m"R/.NX`/.N` nB| nJf ` n h!n| n!n nR`Bmtp0,@gRh`RdJ8g /.aXR m .L0N^NuNVH0*n n0 f-h/.NX m -|`x Э @0(2-H.J gRJoN fD e: r -@YXm Э @0 Э @1mJgF*U`-|B`F n0/ n0(H/Hy N -|/`* n *PB-M |b d6HxBNP*@f -|7`p* +| ;|`YXm Э(@ n (@9nN-@ n"H (@Dm.RH-|7-M /.NX/. NX .`hB| nJPlPCPCPX2P@ @  P ^P P @P CP 8P Z@P@@@ @,@0&P  %,7 CvMX]hpz@"  l$-3@ tJS[dq| J   &/*9?DMV^elu~ _nbuf_pupproto_netisr_rootdev_m_get_if_attach_entrailers_en_softc_mclrefcnt_ipq_if_rtinit_printf_mbbufmem_bclnlist_mpid_rtnet_nswdev_mbmemmap_runin_ip_id_rawintrq_ipstat_bswlist_nchrdev_enattach_kmapwnt_buffermap_panicstr_nswap_noproc_ipintrq_splimp_enstd_physmem_peek_if_makeaddr_endriver_rablock_eninfo_buffers_nmbclusters_boothowto_argdev_pupsrc_buf_runout_enprobe_dumpdev_selwait_eninit_in_lnaof_nblkdev_rasizeDiagRet_enreset_mfree_updlock_runrun_bufpages_bufhash_routetoif_pupdst_sirmask_enoutput_splx_cpu_enstart_m_freem_maxmem_mbutl_swbuf_swapdev_mclfree_physmbmem_wantin_panic_ifnet_iopbmap_dumplo_hand_bfreelist_mbstat_nswbuf_m_more_rthost_mbbufmap_enintr_curprib[Rl$ 1bbbP`NVH0*n(y`g$(lzf+yz# MJzfa L0N^NuNVH/9BHzN R <oRB(|BJ,g.R,,r,gr`reHTahXR _mLN^NuNVH<*nHxBNP(@Jfp`9|*0,Hr|)A Ё$@A&HHxHRNPHxHSHyN 7| 45|||5|HxHjHmtN HxHjHmN HxHj/. N BnHnHTHU mPN L<N^NuNVH<@*n(n n (Ј$@J* fnJ*fhHxHTHj N HxHlHjN A%P Bj Hx/. NP5@ `HxHTHyN p` n/NX-@Jg n f(=| H-@Hn/. HyN `< mHHxHTHmtN .r@ .@ .@``N-@ n r n"HrN"HAPPHABAЁ&@B n gR m m˷f/.aX&@`HB+p+g$HxHTHkN /.NX`J g /+ NX'n /.HUaP/.NXBL<@N^NuNV.*nBT <T @"|X" <X*nN^NuNVH8*n n hmBA-P n (Ј(@ lf$-l-lHxHmtHlN Jg .԰fHy NXp, /p, /p, /p, /p, /p,/Hy@N lfHxHlHlN HxHlHlN HxHlHmtN HxHlHnN 9|A-HHx/HlN n1| BnHn/. HU mPN ` .r".ԳHrN"HAPPHABAЁ&@B gR m m˷gNHxHkHlN +J g,-k B =|A-PHn/.HU mPN .аf:f(Hna(X&@HxHkHlN + lgl/. NXL8N^NuNVH8*n(n lmz Ь&@J+ flp-@Jg/HTNPJfFHxHk HmN HxHkHm N B+Bk /.HTNP7@ L8N^NuNV.*nN-@J g /- NXB B-mB/.NX*nN^NuNVH0B n r n"HrN"HAPPHABAЁ*@(MBJ-g2p-c p--@(MR m*LHUa6X n*| L0N^Nuduplicate IP address!! sent from ethernet address: %x %x %x %x %x %x )P&)P.)PP9P\FPf:Pp:Px:P~/PP %P.@4(Pl(P(P(P(P (P(-P<@B(PX+PDFNV]fov~f(08>EMS [dmu_rootdev_m_get_mclrefcnt_printf_mpid_lbolt_nswdev_arpmyaddr_arpinput_avenrun_hostnamelen_runin_rawintrq_hostname_bcmp_tz_nchrdev_arpattach_boottime_kmapwnt_panicstr_nswap_noproc_etherbroadcastaddr_ipintrq_splimp_physmemlmodt_rablock_nmbclusters_boothowto_argdev_arpwhohas_looutput_tick_arptimer_runout_bzero_dumpdev_selwait_bcopy_arpcom_arpipin_in_lnaof_nblkdev_in_cksum_rasize_arptab_mfree_arptnew_updlock_runrun_arptfree_splx_arpresolve_m_freem_maxmem_hz_arpt_age_swapdev_loif_mclfree_hostid_wantin_time_ifnet_dumplo_hand_mbstat_ipcksum_timeout_curprib[Xlх$ jbbbtpNVH0*|*t;|+|A(H8B/-NP-@ @)P;| +|tPHUNXHxHUNPL0N^NuNV.N-@ nRd n0 f*| - m"R/. NX/.NXp7` n B|Jf* ` m!n |+n R nR\/.NXB`D/.NX n0/ n0(H/HywN /. NXp/*nN^Nulolo%d: can't handle af%d +P@4PL@VPdP|PP(P'PP &P'P.'PP@VPd(P  *5:BMSZbipzt!*29BJU^dmu~t _netisr_rootdev_if_attach_loattach_mclrefcnt_ipq_printf_if_rtinit_mpid_rtnet_nswdev_runin_ip_id_rawintrq_ipstat_nchrdev_kmapwnt_panicstr_nswap_noproc_ipintrq_splimp_physmem_if_makeaddr_rablock_nmbclusters_boothowto_argdev_looutput_runout_dumpdev_selwait_nblkdev_rasize_mfree_updlock_runrun_routetoif_sirmask_splx_m_freem_maxmem_swapdev_loif_mclfree_wantin_ifnet_dumplo_hand_mbstat_rthost_curprib[[l$ bbb3 NV.*n/-aX n !@ n *nN^NuNV n /(axX-@ n/(ahXfp`BN^NuNV l .r` .r` m .က -@-@A  @"|" <N^NuNV... f r` r`  g ..N^NuNV... f `"  f ` ..N^NuNV.*n0- fBHxHnNP=|B/-aP-@ @-P/. HmHnN *nN^Nu@@j PPJ"),8BLU\bov _mclrefcnt_rtinit_if_rtinit_rtnet_inet_netmatch_afswitch_rawintrq_ipintrq_if_makeaddr_nmbclusters_bzero_in_lnaof_mfree_routetoif_mclfree_inet_hash_ifnet_mbstat_rthost_in_netofb[]l$ sbbb_Xl(NVH0*n.. BB Э(@ fp܀A(H0-HS*S`0-H**Ul*Jo fv /HTNP܀  gp܀z`HyXNX r"Ё, r"Ё, F, `xp܀S R(@ /HTNP=@HxHnHnN p0.܀  gdp܀JglgTJmf*U`L0N^Nucksum: out of data jP@PPP+5<E MS_mclrefcnt_printf_ocsum_nmbclusters_in_cksum_mfree_mclfree_mbstat_swabb[_l$ bbbNV.HxBNP-@Jfp7`0 n (Ј*@+n +n/. HUNP n!MB*nN^NuNVH<*n(m&mBnJfp1`2JmfJgp` J g n (Ј$@ hfJg"p0*-@BjHRNXJg5n=jJngz=nB ndJygp `0,f$ l 0(g 0,f-|/.p0.//*B/9HSaJgp0`TA+PJnf>0+Rk @d7|=kBp0.//-B/9HSaJf;nBL<N^NuNV. n (Ј*@ hgp` Ugp/`JgJmfp1` nJf@/-NX/NX-@JfHxNX-@Jg .-@B n0(/Jg ` .X @/p0-//- n/(aJgp0`> nJf .X @ ."@"A . "@" n1mB*nN^NuNV nB nBh n h0(g/.aXN^NuNV n-h nB/.NX nJ g /( NX/.NX ./NXN^NuNVH0*n n (Ј(@1| n (Ј(@HxHTNP89mA)PL0N^NuNVH8*n N-@ n(P`*(T`& , fJg l1nP&L(THS nNXf/.NXL8N^NuNVH0-| n*P`Jg, -g&*Ugp0-nfBJfJgRJ gJ g - f0-ng `J gRJg .g .l(M-@Jf L0N^NuP@ Pr4P P0PD6P6P;PP$P&?P<,PH2P\P PP-P%3EKRZXfm| f %08@JQZcHjs{  "*4BOW__if_ifwithaf_rootdev_mclrefcnt_if_ifonnetof_in_pcbdisconnect_mpid_rtnet_nswdev_in_pcbbind_runin_if_ifwithaddr__insque_rawintrq_in_pcbdetach_m_free_in_setsockaddr_nchrdev_kmapwnt_panicstr_nswap_noproc_ipintrq_splimp_physmem_dmmax_rablock_in_pcbnotify_nmbclusters_boothowto_argdev_runout_m_getclr_bzero_dumpdev_selwait_zdmap_nblkdev_rasize_in_pcbconnect_mfree_dmmin_updlock_runrun_routetoif_rtfree_splx_maxmem_swapdev_u_mclfree__remque_wantin_ifnet_dumplo_zeroin_addr_hand_mbstat_dmtext_rthost_in_netof_in_pcblookup_in_pcballoc_curpri_sofreeb[clѧ$ bbbH(h Minternet PP$ P(P4P`PhPpPtPPPPP P PPPPPPP P @@@&1?MU^ht ' /;FP_rip_input_tcp_input_icmp_input_mclrefcnt_tcp_ctlinput_udp_ctlinput_inetsw_nd_init_udp_init_inetdomain_nd_slowtimo_tcp_slowtimo_ip_slowtimo_tcp_fasttimo_tcp_usrreq_udp_usrreq_nmbclusters_rip_output_ip_output_domains_tcp_init_ip_init_nd_input_udp_input_mfree_mclfree_mbstat_raw_usrreq_tcp_drain_ip_drainb[fl$ Xbbb`JNVH NN*y+y8Z;|40-4Hr WЭZ+@| |Hy/-NP#PA#TBy~`  @ R mB  @  "@"R m####+|FNNa2NN-@NN/.NXNaa(aBB09H/N -@JfHyNXHx ./HyN n/( NX |##NNNHx/.09H/N #/NXHx/.09H/N #/NXB | <C"Q | <C8"QN# 9"<N y1@4 y|BNXJg, y@ 9# y!@ZNB yB( y1|4BNXJgNN yP h=h H` y1|4NL N^NuNVH *|B+M+MR ?mL N^NuNVH0(|`)L)L )L)l(@e 9"9N-@ 9"9N-@B`P й*@;|BB B+y+| y!M#*HUNXRmBB-|`$R n (o# nJPfJfHyNX o, 9йS"9N"9N# 9"9N# 9"9N#BNXL0N^NuNVH *y# B`A@+H R@ 9SmB L N^NuNVH .9 .*G`*# 9SйeL N^Nuiinit/binit PVPyPvPTvP^_PfvPpvPvvPvPvPvPvPvPvPvPvPzPwPP/PRPP(kP0iPFPPPb@hP@QP{PP%P%PPxPnPPPP9PPPvP9PvP$SP0vP<SPHvPT P^ PdPxWP~yPyPCPyPPvPyP]P PyPyPCPBPPvPyP"3P:hPlPPgPPWPgPP6PEPPPPPPP"P(+P..P8PF+PN+PdPl@rP~P+P5P5PWP5PP+P+PPP+P"PPP"PHPtP#PP@PZP`PjmPvdPP !)1;DP\flsz~tt  !*@3<FObV0^isz6 *29BINU[cnw~H  '1t6=FNW_irz %+39@H$OZdlr}_nbuf_klseqllmult_rootdev_linesw_usetup_loattach_desscan_domaininit_setupclock_bclnlist_mpid_ntext_lbolt_qs_bswinit_swapmap_nswdev_nproc_sum_whichqs_roundrobin_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_hostname_tz_desfree_avefree_main_maxpgio_bswlist_nchrdev_boottime_kmapwnt_binit_bhinit_buffermap_panicstr_nswap_maxfree_noproc_swdevt_splimp_ecmap_physmem_mount_sched_cinit_dmmaxlmodt_saferss_maxslp_iunlock_multprog_rablock_swptstat_inode_avefree30_buffers_boothowto_argdev_icode_newproc_klout_buf_nscan_tick_swfree_procNPROC_deficit_runout_kltxt_dumpdev_ninode_pidhash_selwait_bcopy_ifinit_zdmap_firstfree_nblkdev_startupldivt_cdevsw_rasizeDiagRet_cmap_forkstat_pageout_cmhash_setredzone_nswapmap_cnt_dmmin_updlock_nclist_klsdist_runrun_bufpages_bufhash_ihinit_minfree_splx_cpu_cfreecount_schedpaging_klin_maxmem_argmap_hz_text_swbuf_swapdev_u_mbinit_schedcpu_proc_startrtclock_inittodr_hostid_textNTEXT_wantin_iget_brelse_time_panic_rqinit_total_kernelmap_lotsfree_dumplo_hand_cfreelist_ncmap_bfreelist_nswbuf_dmtext_mbmap_bdevsw_curpri_ecmx_mountfs_cfreeb[ml$ bbbP gPPP$P,P4P<PDQPLwPTUP\3Pd_Pl PtP|!P?P5PP(PPmP:PPPPiPPEPP8PPP ,PFPKP$P,P4P<>PDPL)PT4P\pPdPlPtIP|HP PPP PPP&PDPPJPP|PBPPsPPRP SP^PP$P,OP4P<%PDPLPT~P\hPdPlPt+P|#P"P=P-j `d -"<N-@ g -|`-| - @p0@r "--@ l00(H-@m4p".㠁 . @R -". Aѐ l00(H-@|:/././././././.HSa~ L<N^NuNVH/. HyB0. H/ "HA88HABAЁ/HzN..N^NuNVH00. HrN"HA88HABAЁ*@0. HrN" Ҁ(A . dg dg dg &dg @dg @ dg @&dgZp`-n m4 ( n m0"n3h m40(<( @"n3P n1|B`PAB"n <"Q2`NJf9HH` n <CB"Q2BHUaP` n !l`NJg n()h`NJg-nr2-H Nr2-LN-@ n Ю-@r2-L .NJf np0-L"(gp`p n (Ю".ҬnB (r / n(//Hx0. H/aJfB n (r /B n/Hx0. H/a`NJg-nr2-H Nr2-LN-@ n Ю-@r2-L .NJf( np0-L"(f n (Ю".Ҭn0-HL" (N-@0-HL" n (N-@ . n( -@B .r //. n/Hx`L0N^NuNV.R*|`LJ-@g@ 9, m.HxBBBHx "<8N/a8e/9BHzN *nN^NuNVH80. HrN"HA88HABAЁ*@0. HrN" Ҁ(A m40(<&@ m00(H-@J-@fp`: .l Юop` r2-L .Nr2-L-A m .-@r2-L .N-@r2-L .N-@r2-H .N-@r2-H .N-@p0-JѮp0-FѮ Ѯ/././././. .  @p0@r ". /HxHSa: HSaX-@ .Ѯr Ѯ JoJgJgp`BL8N^Nu@DHL:D"&T"''''''''( ($(&(2(>(S(e(((((() ) ))) )-)L)])z)))))**** *"*$*&*(***,*.*0*2*4*6*8*M*a*c*~*****++++0+G+X+i+z+++?+++++++++,,, ,,,'SMD-2180 SMD disk controller at mbio 0x%x ipc%d: Unknown controller type at mbio 0x%x ipprobe: no iopb space WDC-2880 ANSI disk controller at mbio 0x%x SMD-2181 SMD disk controller at mbio 0x%x ipattach: no space for disk label ip%d: <%s> ip%d: can't get initialization memory ip%d: error %x reading label on head %d: %s ip%d: initialization failed ip%d: Corrupt label on head %d ip%d: Misplaced label on head %d ip%d: Unsupported phys partition # %d ip%d: unit not online ipopen: no buffer for disk label ipgo queueing error 1ipgo queueing error 2ipint: bad bp failedip%d: offline restoreretryip%d%c: %s %s (%s) blk %d ipipcdisk not readyinvalid disk addressseek errorchecksum error -- data fieldinvalid command codeinvalid track in IOPBinvalid sector in command?bus timeoutwrite errordisk write protectedunit not selectedno address mark -- header fieldno data mark -- data fieldunit faultdata overrun timeoutsurface overrunid field error -- wrong sector readid field or ECC error???no sector pulsedata overrunno index pulse on write formatsector not foundid field error -- wrong headinvalid sync in data fieldinvalid sync in header fieldseek timeout errorbusy timeoutnot on-cylinder at beginning of a seekrtz timeoutformat overrun on data??????????????unit not initializeddisk busy executing?ANSI bus timeout -- type 1ANSI bus timeout -- type 2ANSI bus timeout -- type 3ANSI bus errorillegal commandillegal parametertime dependent command errorcommand rejectseek errormapped header errorunspecified seek errorread/write faultunknown error 4funknown error 50bytes/sector errorinterleave spec errorinvalid head addressunknown errorreadwriteverifyformatmapswitchinitrestoreseekrtzspindownreset #P8PJ|PP PGP^P^P^Pn^Pv@|P^P@P|P P@P^P@^P @Z#Pj~P|PjPPP|P P@P~PNP@ P"~P.NPb|Ph PdP P@@ P&!P8Pd#P|P P~PNP @P@~PLNP@@T@h@nP$~P0NP8@>PV~PbNPz|P P v@ |P @ @ ^P P^P h^P 0P ~P@P@P|P Pl~PxNP|P P0P~P0Pz~P0PdPeP6PVePf.P0P~PeP2P:P6PPgPPP@Pd~Pt#P0PNPPPf~Pv#PCPPP8#PV@\{Pv0P~P@{PCPdPdPCP0NPzNPP8PP`#P#PNPVPaP0~P8QPPP`@fPD@@@P@@P@@00PL~P@@qP#P<#PV0Pn~P@0P0P@P(.P0PbP~PAP0PbP4~P@APd0P|~P0P^P#PRP\pPPPPPCPPPPCP *dP FCP QP ~P QP ~P NP ~P jP!P!*0P!B~P!R0P!l#P!CP!CP!dP" dP"CP@@@ @$@(@,@8@<aP@@DVPT@Z@`@f@l@r@x@~@@@@@@@@@@@@@@@@@@@@@@@@@@@ @&@,@2@8@>@D@J@P@V@\@b@h@n@t@z@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@ @$@(@,@0@4@ @&.7 P@HNXbhox$"&  $@-x6?IR]gnvT}#v"z #" 2#,4:AJR!Za"js|H h JP(1:C MTZ_gox|D  :h &. 5;CNV^foy2_nbuf_ipstrategy_suser_rootdev_linesw_uprintf_islabel_printffflti_mbbufmem_bclnlist_mpid_lbolt_rmalloc_cp_time_ipwstart_swapmap_nswdev_cmdnames_ipcdriver_mbmemmapulmult_avenrun_hostnamelen_runinfdivi_ipdone_ipopen_pokec_hostname_dk_time_tz_rmfreefsinglei_bswlist_ipctlrs_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_ipint_swdevt_physmem_biodone_dmmaxlmodt_rablock_sleep_iperrlvl_buffers_boothowto_disksort_ipcommand_dk_xfer_ipgo_spl0_argdev_ipread_iperrors_simple_buf_dk_seek_physio_tickulmodt_tk_nout_runout_ipdump_bzero_ipaddrs_dumpdev_selwait_zdmap_nblkdev_ipwriteldivt_clrint_mbgo_ipticks_cdevsw_rasizeDiagRetieeeused_ipcinfo_nswapmap_usegeom_dmmin_updlock_ipioctl_tk_nin_runrun_mbio_bufpages_bufhash_ipdinfo_minphys_getlabeluldivt_splx_cpu_wakeup_maxmem_ipprobe_hz_argmap_swbuf_swapdev_ipwait_ipattach_u_mbdone_uselabel_ipwatch_ck_cksum_physmbmem_ipslave_hostid_wantin_time_ipustart_panic_iopbmap_kernelmap_ipunits_dumplo_ipcmd_hand_ipsize_bfreelist_dmtext_nswbuf_errmsg_dk_busy_mbbufmap_mbmap_bdevsw_biowait_timeout_dk_mspw_iprstart_ipstart_curpri_dk_wdsb[l$ bbb0$@NVH np.J0g/./. /.HylN n hm ( gHxBNP-@Jg  n1@ n0(Hr| n!A n (Ј*@B f nBn P/Hm/.N A-H0h n"H3h n n (Ј-@///.N n0(HЇ n1@ n| nߨ/.aX ./NXL N^NuNVH0 n (Ј(@0,H-@p-@J0g/./, HyN m\0. nh n .Ѩ n (Ј*@p0--@Bm/./.NP".g(/.HyNP /NX`J0gp-/p/HyN p-@ b@0;N""""";m $mxp-".e\J0gp-/HyNP fB`p--@p- @, @-PgHU .4 @HHЮ/ nN`B0.lHTa` ma^+@ +@` $mp-".e~A #NA#^HyZHyJHyF /N`@L0N^NuNV . @-P . @ ."@"A . "@"/.aXN^NuNVH0 .(@ np. Ь*@Bm n0(H/HTNP;@0lJ0g n/( /(HyN BBBHTNL0N^NuNV.N-@ 9"<QN$HBHBBBЂ$ 9"<NԀ-B/.NX .$.N^Nu icmp_error(%x, %d, %d) icmp_input from %x, len %d icmp: cksum %x icmp_input, type %d code %d deliver to protocol %d icmp_send dst %x src %x @.@4P\P'P'PX2P@@P)P@P&2P2@H@NP@@P0PP(@@@@@@4Pt)P@@P"P!P;PP;P *P1Ph +3Z<BIPXFbkx2 0(06AGOXahq{J4% -5AI_icmp_input_rootdev_m_get_mclrefcnt_printf_icmpdst_mpid_lbolt_rtnet_nswdev_icmproto_avenrun_hostnamelen_runin_icmp_send_inetsw_hostname_tz_icmp_reflect_nchrdev_iptime_boottime_kmapwnt_panicstr_nswap_noproc_physmem_icmpprintfslmodt_rablock_nmbclusters_boothowto_argdev_spl6_ip_output_tick_runout_dumpdev_selwait_bcopy_nblkdev_in_cksumldivt_rasize_mfree_updlock_runrun_routetoif_ip_protox_splx_m_freem_maxmem_raw_input_hz_swapdev_mclfree_icmpsrc_hostid_wantin_time_icmpmap_dumplo_hand_mbstat_rthost_icmp_error_curprib[l$ dbbb X8NVH HxHxNP*@fHy PNXB r,N" AR m*y`< mf.Jmg( mg r,N2-H A, c## 93# HxNX#L N^NuNVH8N-@(yg#|fBB|S/.NXg |b llHxHTNP(@JfR` Ь*@p-@2,Ho$/HTNP(@Jf R `P Ь*@J9 $g0/.HTNP;@ gR`RHTNX`;m0-Hm;m;m0-D@H.-L`(T0,HހJfJg0JlR`0,Hn0l` D//.NP(n oHUa 2g0 3g& 7g* @g& Ag//HUN `z`z`|`z`L N^Nu255@A3A==(ip_initforward: src %x dst %x ttl %x P$@*YP6P>@PFIPZPzP@PIPPPPPPWPP@(PP.P)P(P(P(P&(P0JPZKPhPKPP@?PPPLP0PTCPx.P.P.P.P@@PP*PIPP"P<PDPCP|CPLP&P &P2TPDPjLPLPTPP:gPDPlPxJPPPP\@b@hPaP cP &P .P .P P @ @ P =P =P @ Z P d@ zOP /P EP @ P /P @ @ P @ P 2LP J'P `XP 3P aP! )49AOU\ckv   2&/7AJT[cjpy H L|  6"+3<ELU_emu| &  (/6> IW] emy $ L_if_ifwithaf_rootdev_m_get_ip_deq_mclrefcnt_ipq_printf_if_ifonnetof_mpid_lbolt_rtnet_nswdev_tcp_abort_ip_ctlinput_avenrun_hostnamelen_runin_ip_id_inetsw_if_ifwithaddr__insque_ip_forward_rawintrq_udb_hostname_tz_m_free_pffindproto_inetdomain_ip_slowtimo_ipstat_nchrdev_iptime_boottime_kmapwnt_panicstr_nswap_noproc_m_cat_imin_ipintrq_splimp_physmem_ipprintfs_ip_stripoptions_rablock_ifinet_in_pcbnotify_nmbclusters_boothowto_argdev_ip_output_domains_ip_freef_ip_reass_tick_inetctlerrmap_ip_init_runout_dumpdev_selwait_bcopy_nblkdev_in_cksumldivt_rasize_ipintr_m_adj_mfree_udp_abort_updlock_runrun_routetoif_ip_protox_splx_m_pullup_m_freem_maxmem_hz_tcb_swapdev_ip_enq_mclfree_ipaddr__remque_hostid_wantin_time_m_copy_panic_ifnet_dumplo_ipqmaxlen_ip_dooptions_hand_mbstat_rthost_icmp_error_ipcksum_in_netof_ipforwarding_ip_drain_curpri_splnetb[l$ bbb0(tNVH0 n (Ј*@-|BJ g /. NX@ .m@;yRyJfA-HHx/NP .X-@ nJf1|A .P"@" fJ-f HxN`/-NX/NX(@fJ0g 0-H//- /-Hy4N-|3/.NX` n/NX`/.NX nJg P(h,g n PR( n P0($g n -@/- NXJf+l /.NXJf@0, f -|1`TJf -| `B0-lo -|(`,0-ln@;m;mBm /./.NP;@ /./.HT lPN -@`0-@f0,H-@ m nh nB`HxBNP-@Jf -|7`xp| n!@ n (Ј-@ @ !m!m!m !m o&/./.HUad -@ n1@` n1| . n1@ .Ю2-Hm"0-H n1@0(H-@` n1n nh  nh n"H3h/././.N n nJf/NX` n"H3h nBh /./.NP n1@ /./.HT lPN -@f .Ѯ0-H".mh`A .f @Jg @ P h&g @ PSh& .L0N^NuNVH0 .*@ . (@ np-@`lp-@Jgf f -|` p--@ .o-nJg .g/.HTHUN .Jn . " -A`BR .f .L0N^Nuno route to %x (from %x, len %d) , PRPZPtPPPPP@@PP*P:PPP PPP PPP#(0>ELV^fo|N0  #_if_ifwithaf_m_get_mclrefcnt_ipq_printf_if_ifonnetof_rtnet_ip_id_rawintrq_m_free_ipstat_ipintrq_nmbclusters_ip_output_rtalloc_bzero_bcopy_ip_optcopy_in_lnaof_in_cksum_mfree_routetoif_rtfree_m_freem_mclfree_ipnorouteprint_m_copy_ifnet_mbstat_rthost_in_netofb[l$ bbbNVH0p0.J-@-nL f A#T*y ` JnS*m fgS . fx 9ѹ B@mB@RJxfJ|g*/9HypNPJfHx/9PNP yP (o|`FB`B|Jg .f,|`( 9ѹ B@mB@RJf g 9йRo&Hx/9PNP 9lZJfJg*/9HyNPJfHx/9PNP yP.(B߹JVg hV0(@H*ޅ۹侹o#  @RBpg  @RR mJf8(yPRlbR,fS,,fHTNX ,2 ml 9ѹ B@mB@RNL0N^NuNVH8 yT-h@-hD`PJ$gx yP N`b(m&m.# +y #/NX/HTNPN,*y gJo/NX . gL8N^NuNVH8..N-@&yfHyNX# 'n 'n*|` lJo*L(m f+K 'L &g/.NXL8N^NuNVH0N.*|(m g: ,f< , f2J g Jo l ѐ+l )y #/NX`*L`L0N^NuNVHN-@ n , nh $HBHBBBЂ$ n ("<NԀ 9"<N" N` "9N.` <"9No.</.NX LN^Nutimeout table overflow&QP,aP\3PbQPlQPxQP~QPQPQP3PQP9PQPBPQPP3PQPQP QPQPP*QP0QP8QPDQPJBPRQPXQP`QPfQPnQPv3P|QP9PQPBPQPQPQPQPQP P_PP PQP6RPL3PRWP\WPhWPnWPt PQPQPQPXPaP,P,PKP/PaP KP6/P@,PN@TYP^,PpaPKP/PaP ,P,PKP:/PJWP\WP~WP@P3P@P@PNPPNP@PKP $-3:AENV]tbktt  "+2;CMV`kv ~H#,2:CMtRYbks{$ 0!+(4=EM_klseql_calloutlmult_rootdev_desscan_mpid_ntext_lbolt_qs_cp_time_nswdev_nproc_sum_whichqs_avenrun_hostnamelen_runin_freemem_rate_hostname_dk_time_tz_desfree_avefree_maxpgio_nchrdev_boottime_kmapwnt_panicstr_nswap_noproc_softclock_setsoftclock_hardclock_physmem_dmmax_saferss_maxslp_multprog_rablock_swptstat_avefree30_boothowto_dk_xfer_callfree_argdev_klout_spl7_dk_seek_untimeout_nscan_tick_procNPROC_deficit_ncallout_tk_nout_runout_itimerdecr_kltxt_dumpdev_pidhash_selwait_zdmap_nblkdevldivt_rasize_psignal_forkstat_cnt_dmmin_updlock_klsdist_tk_nin_runrun_minfree_splx_klin_maxmem_hz_text_swapdev_u_setpri_proc_hostid_textNTEXT_wantin_time_aston_panic_total_lotsfree_dumplo_hand_dmtext_dk_busy_hzto_calltodo_timeout_dk_mspw_curpri_dk_wdsb[l$ 9bbb NV#N^NuNVH0*yx/a @X(@g,BBHx/-HnN J9NqL0N^NuNVN^NuNVN^NuNV.*yx g ?aJ`@/aX-@Jg0a-@Jm$  @//./.a *nN^NuNVH0*yx/arX(@gJm m  `# g -\ @JgX - @g /-NX - @HH/B -\ @/a J9f  @/HT/-a L0N^NuNVH *n .. .\ @ ". ARm g mRh g mRhL N^NuNVH0*yx/a,X(@gV  @g /NX  @HH/BHTa* \ @B  @BL0N^NuNVH0*yx/aX(@g$HxHn/-N J9NqL0N^NuNV.*yxB-n-n o*JgHxHn/-N J9gJg&Hx/-HnN -@JgJg&Hx/-HnN -@JgJ gnHx/- HnN -@JgN`BBJg(HxHn/-N J9g`DBJ g(HxHn/- N J9g`BJgjHxHn/-N J9fHnNXJg `N-@HyHnNP/.NX-y yP@ HnHnaP#J9fjJfdN-@Jg. 9lf 9m/.NX`& yP ( @g 9g yP `N yP Jgh || < C"QHy|NXJg/9PHzNP`hHnNX//9PHzXN HxHyNPJgA < C|"Q/9PHzN`*nN^NuNVH *nN.-HH g g/NX`HUNX`HUN`L N^NuNVHBB`V gv gx/NX*g, SrF́ S\ @-PJfL R l Ю @, Ю @B Jf-|`-|`B` n hf/./( N`n `g gJgJ Sr Ю @R`./. n/(N (N"HA((HABAЁ @ PNP-@` n-h n0(& g @fb-|`r .LN^NuNVpN^NuNV.*nJ gRHyNXg@N-@ Rf HUNX` - @g /.NX*nN^NuNVN^NuNV.B \ @Jf#  @B `R mp..N^NuNVH a.Jm<`>`N*y` JmgNeHy NXB`LJf #*ydJmf \ @ RmB BA# L N^NuNVH .. d \ @*Pf  B` L N^NuNVH<*ng moSm` mf2/. /- NPJ f J9fB Bm`|0H-@(m=lPp0,&-@Jg/.HTNPHTNXHTNXBm . g `gr`0.H"HA((HABAЁ` mg4Jmg.(mg"0.H",Nfp0,&g`V&|`Jg 0nge0.H"HAHABAЁ @$P*ye^ `f 0.H/NX0.H/NXHU/.0.H/N L<N^NuNVHx(HyNP`file VPVPHTPRVPXVPVPVPVPVP"VP8VPHVP^.PjVPVPVPVPVPVP0VPJVP^.PhVPVPVPVPgPVPVPVP4gP>VPDVP`TPtVPTPVPTPVPgPVPVP"gP,VP2VPTgP^VPdVPr:PVP,P\PPPLP-PVPVPVP+P\P\PLP*VP<-PHVPZVPnVPVPPVP1PVPaPVPfPMP HAP RiP BP "P "P *bP 4 P :XP VeP fHP VP %P %,29=EKR[dqx xlx !(/8?FQ[cjpvt~H ph(/7?FOW]emx  d&  &. 8>FOW_e_lastf_rootdev_linesw_soclose_dupit_mpid_lbolt_qs_nswdev_file_nproc_whichqs_avenrun_hostnamelen_runin_inodeNINODE_rootdir_soselect_hostname_tz_nchrdev_setjmp_dup_boottime_kmapwnt_panicstr_nswap_revoke_noproc_swdevt_getdtablesize_physmem_selscan_closef_mount_dmmax_rablock_sleep_inode_boothowto_getdprop_argdev_nfile_spl6_spl7_nselcoll_munmapfd_falloc_ufalloc_untimeout_tick_selwakeup_ffs_procNPROC_runout_unsleep_dumpdev_ninode_itimerfix_pidhash_selwait_zdmap_setdopt_getdopt_nblkdev_ilock_cdevsw_rasize_dmmin_updlock_runrun_wrap_binval_select_tablefull_setrun_splx_funlocki_wakeup_opause_timevaladd_maxmem_hz_swapdev_copyout_getf_u_close_fileNFILE_proc_hostid_wantin_time_seltrue_dumplo_hand_dmtext_hzto_bdevsw_unselect_dup2_bflush_timeout_copyin_curpri_iputb[l $ bbbNVN^NuNVN^NuNV#N^NuNVH8-yx n/(NX*@g(mp0,& g `j=lP0.H"HA((HABAЁ$ @-PJg n f (f (f (g 0g n (g 0gf n  fV r -@ n ШSr -@m0 . yP"(6遰m yP <>".d ."(6遰m yP <>".dB`6 n/( (Ю/0.H/ nN g n .m (g -|x`-|`B`/./9PNP&@HxHSNP yPB& n (S@鈁S n/( (Ю/0.H/ nN R n .mh yP n ( @L8N^NuNVN^NuNVH0*yx f -g ` r -@ ЭSr -@m . yP"(6遰m yP <>".d ."(6遰m~ yP <>".ddB`F/./9PNP(@HxHTNP yPB(zTT@R .m yP L0N^NuNVH B`F yP (Z"(6Ё"Ё*@g$gp0@f*zUU@Rm . @L N^NuNVN^NuNVN^NuNVN^NuNVH yx r "9遐.JlB , 9Іr 㠰o  `Z/9 9І//9N Jf6Hy8Hy/9 9І/NJg B/NPLN^NuNVH<(yP , -@*yx  gv gxJg , g fB`x ,6ЬZ"Ё&@g^p0+@R"HA HABAЁй$@*g`( ` `~+gR:m f~`l0,4Hr ЬZ"偐&@gFp0+@R"HA HABAЁй$@*f+gR>mB`j ЬZ&@gXp0+@R"HA HABAЁй$@*f$+gHS//,VN R6mL)l>:)l:69|4R +:Ы>ѹ `,)k66)k::)k>>9k44R +:Ы>ѹBB)kFFBRB,)ydBlb0,(Hr?N.  @;Pj "<N" A0RB \ @$PgPDPnUP~fPPfPPPP8PP[PPP P P P GP &P @P NP \P hP tP P P P P P sP P P P P &P 8P L;P VP ^@ dP jP rP P P P oP P P P P VP P P 2P HP ROP dP nP P P P P =P P P P .P 6P @P FP LeP XP nP `P P VP OP @ P wP XP [P .P >GP `P pP |P P =P P lP P P P P lP P P PP PPP.P(P.5P6TP<EPL7PZAPdPpjP|cPcPcP@P@P@PPPP&PDPjPPPPPPPPLoPZoPt\PoPPPPPPPP PP<PDPZP`PpPPPPPPPP#PPP\PPP(P.+P<PHPNGPhfPtPfPPPPPP8PPPP\P @&P6P>\PXPhPpiP~PiPPPPPPPPPP4\PT\PrP~PPAPcPPP. P4 P> PFPd Pr P\P@PPPjP P~rPrPrPrP@APcPP jPcP EP,PDP`PPPPtPVPNPOPPP GP,@2P:P@PHPRP\PbPhPnPv>PPPjPP  (3<DNT[bkow~tt6 "*2;DKT@]fnx   &/6>HQXbit (19~BKRHYbisy ft $,6?HQYdlsby %+2$9DNV^d lw _nbuf_klseql_exit_suser_rootdev_mclrefcnt_desscan_subyte_bclnlist_mpid_ntext_lbolt_rmalloc_qs_suword_Vfmap_swtch_swapmap_nswdev_file_nproc_sum_whichqs_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_namei_sethostname_gethostname_hostname_tz_m_free_rmfree_desfree_avefree_schar_maxpgio_bswlist_nchrdev_setjmp_boottime_inferior_vrelpt_kmapwnt_buffermap_panicstr_nswap_spgrp_acctbuf_vrelu_bdwrite_noproc_swpexpand_execv_wait_vinifod_physmem_closef_vpassvm_dmmax_fork1lmodt_saferss_uchar_maxslp_multprog_rablock_sleep_swptstat_inode_avefree30_nmbclusters_buffers_boothowto_setrq_spl0_argdev_newproc_nfile_klout_spl5_chksize_spl6_buf_untimeout_nscan_tick_vrelvm_procNPROC_deficit_runout_kltxt_m_getclr_dumpdev_ninode_pidhash_selwait_bcopy_zdmap_nblkdev_bread_vsexpandldivt_wait1_ilock_rasize_rexit_psignal_sethostid_gethostid_forkstat_rdwri_procdupieeeused_getblk_realitexpire_nswapmap_mfree_pfind_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_ctxfree_minfree_execve_tablefull_xalloc_owait_fork_wakeup_klin_getvtimes_maxmem_hz_argmap_text_swbuf_swapdev_copyout_u_uaccess_access_mclfree_swkill_fileNFILE_proc_hostid_ruadd_textNTEXT_wantin_brelse_time_panic_total_kernelmap_lotsfree_dumplo_strlen_hand_mbstat_bfreelist_nswbuf_dmtext_acctp_mbmap_vgetvm_getxfile_fubyte_baddr_acct_vfutl_fuword_copyin_setregs_curpri_iputb[lS$ $bbb0NV yP0((H#0(*H#N^NuNVH0*yxJf yP0((H*/NX(@f ` 0,&H#L0N^NuNV09H#09H#N^NuNV09H#09H#N^NuNVH0*yx(|Jl Yb "d `8 *//-HyN J9f#L0N^NuNVH0(yxJf yP0((H(/NX*@f `20-$yg JygHUNXJf `;l&L0N^NuNVH-yx n. f 09H.09Hg09Hg NJgX n,( f 09H,09Hg09Hg NJg0 yP1@$0303LN^NuNVH *yx.09Hg09Hg NJg030 yP1@$03L N^NuNVH *yx. f 09H.09Hg09Hg NJgl,- f 09H,09Hg09Hg NJg409Hg 09H/aX/aX0303L N^NuNVH *yx.09Hg09Hg NJg(09H/a&X/a\X0303L N^NuNVH0*yxNJgX c `F /Hy/-N J9f (@`(XeL0N^NuNVH0(yxJf*yPJn,0-&H#`P/NX*@f`20-$yg JygHUNXJf `;l&L0N^NuNV.*|` Xd g`*Xe**nN^NuNV.*| g`*B` Xe*|JmXep*nN^NuNV.09Hfp`"*| g gXeB*nN^Nu?P?P?P0?P:?PJ3P^?Pl?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P>P&?P,?P4?PL?PV?Pf3Pz?P?P?PP?P?P?P?P?PP?P"?P.?P:PF?PR?PZ?Pr?Pz?P?PP?P?P?P?P?P?P?PP?P?P(?P4P>?PJ?Pd?Pl?P?P?P?PP?P?P?P?PP?P?PKP$?P*?P6?PH?Pb?Pl?P~?P3P?P?P?PP?P?P?P?P$?P>?PF?PR?Pj?P|?P?P ",26>ENUbku@X B&$+z4<EPX]hpb}~H ),2:BhKzSYdlt|_nbuf_suser_rootdev_linesw_bclnlist_mpid_qs_nswdev_nproc_whichqs_runin_inodeNINODE_rootdir_setreuid_setgroups_getgroups_bswlist_nchrdev_inferior_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_mount_leavegroup_dmmax_osetpgrp_setpgrp_getpgrp_rablock_inode_osetgid_getgid_buffers_boothowto_argdev_buf_procNPROC_runout_groupmember_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_pfind_dmmin_updlock_runrun_bufpages_bufhash_entergroup_setregid_maxmem_swbuf_swapdev_copyout_u_proc_wantin_dumplo_osetuid_getuid_hand_bfreelist_nswbuf_dmtext_getpid_bdevsw_copyin_curprib[lJ$ cbbbtNVH0*yx#( Jg( gb g`Jf(yP`/-NX(@g yP(HH#B9`Jf yP0(&H+@(ydJ,g00,&Hf$,HHl,HH#B9`Jf 09H+@(yd.J,g00,$Hf$,HHl,HH#B9`L0N^NuNVH0*yx Jg gL g`Jf(yP`/-NX(@g/-HTaP`Jf yP0(&H+@(yd\0,&Hf /-HTaRP`Jf 09H+@(y`0,$Hf /-HTaPeL0N^NuNVH *n.. Jyg*Jyg"09m$g09m$g  `L (m~'JlB-HHl NJg@HUNX 9fB9L N^NuNVH0*yx e ` (@HxHn/-N J9f .n .o NJgb  g& g*`: ."<N yP!@F`2 n ` o-|A()h gL0N^NuNV.*yx e `$Hx/- /N *nN^NuNVH0*yx  g&Jf*(|HxH/-HTN `(|`L0N^NuNVH<*n(n HTHUNPHlHmNP -l+lA&HA$HADC  @.` ћSJnLEtJS\ip}t V %/8BIP[fnu|\~H "t'.7@HQ\hn<yn$| _klseql_suser_rootdev_desscan_mpid_lbolt_qs_nswdev_nproc_sum_whichqs_avenrun_hostnamelen_runin_inodeNINODE_ovlimit_freemem_rootdir_rate_hostname_tz_desfree_avefree_maxpgio_donice_nchrdev_boottime_kmapwnt_panicstr_nswap_noproc_physmem_dmmax_saferss_maxslp_multprog_rablock_swptstat_onice_inode_avefree30_boothowto_argdev_klout_nscan_tick_ovtimes_procNPROC_deficit_runout_kltxt_setpriority_getpriority_dumpdev_ninode_pidhash_selwait_zdmap_nblkdevldivt_rasize_forkstat_otimes_pfind_cnt_dmmin_updlock_klsdist_runrun_minfree_getrusage_timevaladd_klin_getvtimes_maxmem_hz_swapdev_copyout_u_setpri_proc_hostid_ruadd_wantin_time_total_lotsfree_dumplo_hand_dmtext_getrlimit_setrlimit_scale60_copyin_curprib[l$ bbb x lNVN^NuNVN^NuNVN^NuNVN^NuNVN^NuNV.*yx//-HxaV *nN^NuNV.*yx/Jl -D` -/Jlp`B/a *nN^NuNV.BJ g op`JJoFJf@/.NX*@gJyg09m$gp`/. HUaP` f0Jyf(RB-|B*y`J-f*`Jf-| yP0(&H-@Jf`PJf0-(Hg4`n0-&HgJg\Jm*gV - fJJgPgP ^rP rP P rP rP rP rP rP rP @ rP "P P rP &OP @sP jrP xCP rP rP YP rP rP rP rP YP rP rP rP rP ,rP HYP RrP ZP brP !)2:RAHPZ`gnr{t(t  @)2<FOZdk t|(  (/7=BIOT_hpw~Ht $-6>EKS ]emw}$#*2 8n>FL_nbuf_klseql_exit_rootdev_linesw_desscan_printf_okill_ossig_sigvec_bclnlist_mpid_lbolt_ntext_qs_procxmt_swtch_nswdev_nproc_sum_whichqs_killpg_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_namei_hostname_tz_desfree_avefree_schar_maxpgio_bswlist_nchrdev_boottime_inferior_kmapwnt_buffermap_panicstr_nswap_acctbuf_noproc_swdevt_sigsetmask_gsignal_physmem_mount_stop_dmmax_saferss_maxslp_multprog_rablock_swptstat_inode_avefree30_buffers_boothowto_sendsig_setrq_spl0_argdev_klout_itrunc_spl6_buf_nscan_tick_ffs_procNPROC_deficit_runout_kltxt_unsleep_dumpdev_maknode_ninode_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_psignal_forkstat_rdwri_remrq_pfind_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_okill1_issig_splx_setrun_sigstack_wakeup_opause_sigpause_klin_maxmem_hz_text_swbuf_swapdev_u_access_proc_hostid_textNTEXT_wantin_time_aston_panic_total_lotsfree_dumplo_hand_sigblock_bfreelist_nswbuf_dmtext_acctp_bdevsw_core_psig_curpri_iputb[l/$ .bbb0NVRN 9r N/BHzN N^NuNVH HyaX*y`J-g -g -gR- -g -f -gR- - g 9NN//0-bHNN///9/9 9"9NN// -dN// 9"9NNN+@dBmb/9/9 9N// 9"9NN// 9N///9/9-NNNNNNN-HHЁ,JlB o,<@HUa^XN. -2 mPPfJg: -f2 - g&- - gHUNXm HUNX`m /NXeNJ9gB9HyaXJg 9 /aX/9BHzN L N^NuNVH0*yPN.Jg -fJgHyNX+nRB-n .?(@*(  oJgJ - f -Fg2NJg(JRgHUaX|NHy|N`hJRgZ|NRNJg< - f -Fg$NJg`|NRN/NXL0N^NuNVH0*nN.JRg& -R?(@`(T f(BR/NXL0N^NuNVH<*nN-@ ?$@&J`Jf ,g ,gHyNX ,RfxBR&B, ,fh| , g HTNX, 9l RN , f|J9gB9Hya:XR`X&L(SfP/.NXL<N^NuNV.B " A "@"R m..N^NuNVH *nN.-HH b@0;N$HyNXHUa&X| - g HUNX/NX- 9l RN - f J9gB9HyaXRL N^NuNVH *n-rN.-HH2ހ -BFo 9lP o~9HHl RN@ L N^Nu?px&??sleepwakeupsetrunVP nPaPLP(xP>PJjPaPyPPPP@@@@WPPPP@@ PPdPP$@*@0@6P@PFPLPPRdP\@bPlPrPPPPPPPPPP=PfP*P QP08PB]PPAPZ%P`PhPnPzPjPaPxPfP=P@oP PB[P`9PffPl+P9PfP P[P9PfP P]P=P P*]PH=P^ P@oP8PzPVPnPCPCPCPlP"]P@ PJ PX P=P@oP8P]PzPVPnPCPCPCP*lPRLP|PPzPVPnP $*0:@GKSZbhott}t  @$.7@KU\dmv} '/6?HP~YbHirxtr: '-698A4KV\dlry2$_nbuf_klseql_rootdev_desscanffixifflti_bclnlist_mpid_lbolt_qs_slpque_swtch_nswdev_file_nproc_sum_whichqs_roundrobin_avenrun_hostnamelen_runinfdivi_inodeNINODEfdoublei_freemem_rootdir_rate_hostname_tz_desfree_avefreefsinglei_maxpgio_bswlist_nchrdev_ccpu_boottime_vmmeter_kmapwnt_buffermap_panicstr_nswap_noproc_longjmp_physmem_dmmax_saferss_maxslp_multprog_rablock_sleep_swptstat_inode_avefree30_buffers_boothowto_setrq_spl0_argdev_nfile_klout_spl6_buf_nscan_tick_procNPROC_deficit_runout_kltxt_unsleep_dumpdev_ninode_pidhash_selwait_zdmap_nblkdevldivt_rasize_forkstatieeeusedfmuli_remrq_cnt_dmmin_updlock_klsdist_runrunfsubi_bufpages_bufhash_minfree_issig_setrun_splx_wakeup_klin_maxmem_hz_swbuf_swapdevfaddi_nrscale_u_setpri_schedcpu_fileNFILE_proc_hostid_wantin_time_aston_panic_rqinit_total_lotsfree_dumplo_hand_bfreelist_nswbuf_dmtext_timeoutffltis_curprib[l2$ bbbpNV.*yxN-@ |-P-h/NXHx/HnN J9f$JgHx/-HyN *nN^NuNV.*yxHxHn/N J9fXJg.NJg$HxHn/-N J9Nq*nN^NuNVNJg> n ѹN-@ n##/NXNN^NuNV.*yx c `N-@Jfn 9P| @-P-h-h-h JfJg` .mf .l B-n`4HyHna*P`" ` @-P-h-h-h /.NXHx/-HnN /.NX*nN^NuNVH0*yx(yP c `HxHn/-N J9fJg +maHnahXJfHnaZXJfN-@JfdHTHzNPJfJg.HyHnaPHnNX/HTHzbN A)P|)h)h)h `$A `"@"#h#h#h /.NXL0N^NuNV.*nHxHUNPJ|fJfB+m`n/.NXN-@Hm|Hma$P -nf -oHmNX/HUHzzN /.NX*nN^NuNV nJm nJm B@mp` nJf (l!yBN^NuNV.*n - lFJf4 JfJgN+U+m . J l:B@ S`,B@ S . B JfJ gp`B B*nN^NuNV n  nѐ n ( nѨ/.a2XN^NuNV n  n n ( n/.aXN^NuNV nJlS nB@ n B@mR nB@N^NuNV#N^NuNV.*yx-UBHna\X*nN^NuNV.*yxN-y 9"<N=@N=y=yHx /HnN *nN^NuNVH0*yx(yPN-@HTHz6NPB)l|BJfJg0 ,nf ,o ,#Jf B)l`4 |)P)h ѬHlNX/HTHzN /.NXL0N^Nu*PP-P*&P<)PF*PL*Pb Ph)Pr*P*P3P*P*PP3P*P*PP-P PP -P(-P0&P8PH*PX*PbPp*P-P-P-P-P*P&P)P"*P,&PD*PJ*PZ*Pp3Pz*P*PPP-P/P2P0*PP&PrP&PP-P-P-P/P2P&P<PDPn-Pr*P*P*PP-P-PPP P P)P*P*P*PP.P@*PV-P^-Pj-Pv-P|*P-P/P2P&P &/<IRzZham w{P~H `&:1@<C~Q_equ~,_suser_lbolt_qs_nproc_whichqs_avenrun_hostnamelen_inodeNINODE_rootdir_ostime_otime_setthetime_hostname_tz_boottime_dmmax_inode_oftime_spl0_timevalsub_spl7_untimeout_tick_procNPROC_itimerdecr_ninode_itimerfix_pidhash_zdmapldivt_psignal_resettodr_realitexpire_setitimer_getitimer_dmmin_settimeofday_gettimeofday_splx_timevaladd_hz_copyout_u_proc_hostid_time_dmtext_hzto_oalarm_timevalfix_timeout_copyinb[l%$ bbb DJlD`(a&DNuDaDNuNVN^NuJg` JmJmgJ/H<&SƁg&BCHCf4$BBHBlLB*M<Qptwodiv_big_bdiv_neg_aSAVElmodtulmodtdivide_by_zeropotdiv_recallRSTb[l$ 7bbbTJ///JgBJg>`J///Jm8g.Jm>g(46H@J@fp`HAJAgЃH@B@Ђ&$Nup&$NuDJngD`D46H@HAЃH@B@ЂD&$Nu d&'N3V9b?lmultulmultneg_resultpos_resultzero_resulta_negb_negb[lm$ *"bbb  XF' |( <.H |0R f$<S$y /<B/N &<8S/<//N SfQ3 < |"H"<ቂ2Ro < |"H2Rj |"| BYQ |(0Nq | N`Bg/<?<?93HNh/Hh @F'Nu@F&Nu@F%Nu@F$Nu@F#Nu@F"Nu@F!Nu@F JgN0Nu@FJg / fN0NuNr NuNr'`Nu o"o !I""P#HNu o"P h #HNu o"o "//BB /S@k 1 VR@$Nu oJf4B( H"H"|"Q !I""P#H 9#NuHzNsetrq oB( H"9g("P h #Hf"9# oBNuHzNremrq@#B"9Bf mF `F'"9g#H | P""PfHzNswtch h #Hg AH"9#` ABJRf (fB/(RNXFNu o@(4F'H("|($|  $2 $2 8(0o.@ $2L(F(4J(Lg/x(LB(LF NNu9P9P9P&P0,P4[P^[P[P[P[P.P $ PdPV PSP PSPdP   5PP:HPNqP@qPqP@@qPP-PP _PPP(P<@f@@@@@P@^ b d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@ @ @ @ @ @ @ @ qP qP HP `P hP tP P P P P 0P hP P P P P ,P JP RP \0P xfP @ 1P @@ D@ H"P L@ P P T3P X@ \@ `@ d@ h@ l@ p@ t@ x@ |@ @4  @\&.8 B KT\bjjFs{D |   X"*5< ENxW^8ekt| d@   @`&,3 0: @I O U0\ |b th ln dt({ \8&<<*  ~$)/72?EL<<T_2js{ Z0>h.0Z(  H%,3";DJ P@X8a g@nx$~ << @ \ TOADDRtrap_resumerei_protoscb_netisr_DMPADDR1_DMPADDR2_cpfault_calimit_mbcopynosiremu1010_copyctxzerodiv_qsnetintrsirbusy_sirtab_swtch_Vfmap_Swapmap_Xswap2map_whichqsfmterr_CMAP1_hardstop_msgbufmap_CMAP2brkptcpout__insque_clkticksgoodbye_consoutstartSAVREGS_sudisable_edata_DMPMAP1_DMPMAP2_forkutlsiroutbuserr_main_rawintr_msintrpaglp2_noproc_longjmpcallmain_softclockfixmask_hardclock_splimp_ESysmap_Sysmap_endbadtrap_scb_usrpt_CADDR1_camap_CADDR2_Forkmap_cabase_ctxutlspurioustrapvseglp2_setrq_spl0_syscall_spl1_spl2FRADDR_spl3_spl4_spl5_spl6_vmmap_spl7emu1111_suibuf_xswaputlCOUNT_clkmouse_Mouse_clknomouseprivviosoftint_iointr_Ctxmap_UsrptmapPOPREG_ipintrFRCTXbytes_Xswapmap_remrq_suwptrchkinst_cnt_mmap_runrun_ufault_mbio_iopbsPUSHREG__setubyte__getubyte_clkrateillinst_sirmask_splx__setuword__getuwordseglplevel1REDZONElevel2level3level4level5TOCTX_Sysbase_mbutl_msgbufaddrerr_Syslimit_u__remque_hpagmaptrace_pushutl_suend_panicdopanic_IOPBmapbytlp_idle_ecamap_cvtopagpaglp_Mbmap_MBBUFmapSVLENsyscallTMPREG_trap_hsegmap_mbbufspacectxtlp_vfutl_swaputl_xswap2utl_ndintr_scanc__setusword__getusword_splnet_Pushmapb[l^$ :bbb NVH0 <r -@BaNB`N #Jf o -@ (op(` .#ܑr "<N# ."HAHABAЁrNr "<Nѹ .rN-@ Po( 9Pr r Ѯ#P .ѹ (o(#(` 9r "<PN# l #Hx/9Hy\N Jf0 9rN# o # .r (@# 9й(@# 9й(@# 9"HAHABAЁй#(@# 9й#(@# 9"HAHABAЁй#(@# 9"HAJJHABAЁй#(@# 9й(@# 9й(@# 9#й(@# (@# 9й(@# 9rNй(@# (@# (@# (@# (@ 9r 㠐"< N##"HA HABAЁй#(@ oHy{NX 9 r . 9mHyNX .*@*.`(HyHx// MXHPN/aXRe#z` й"Sҹ A!@ Re/9/NP# 9r /HyNP/9HyHxHx/9N 9rN/HyHx 9S//9NB m^HyHx . / <r /HyNHx@HyHyHx /9NYX`Hx@HyBB/9NmrHy/9 . / <r /HyNHx HyHy 9r //9N 9Ѯ`$BHx@HyBB/9NJoHx Hy /./`Hx HyBB/9N 9r /HyNP#Jf. 9r /HyNP#Hy+NXJfHyCNXHxHyS/9 9r //9N#aNahNL0N^NuNVH0*| (m -fRB  @Jg*  @fD  @0HR  @JgJf 9g#`R`L0N^NuNVB9HxHxNPHy8HyHxBN-| BS/.aPB`B . @0Hg$ . @HH/S/.aTPR . @JfHx-S/.a,P-nB`R 9Ю @Jf`& 9Ю @HH/S/.aPSJl-n .-@BY/.a^P/.Y/.aLP/.Y/.a:P#Xx-yx# n n!n nBNJ9g09HH//9HybN Hy}NXN^NuNVH0*y <r -@-|/aX+|Z;|4#Z8B<0-4Hr ЭZ #@#DHyHx .Ю/ <r /HyN0-4Hr WЭZ(@B .(XRR mL0N^NuNVH *yT.-< 9r "< n /NXBHx/N Jg6-n -n-mD=mB+G<+nDHx/Hna `p/. yP0((H/HyN /-D/./HyNB` yP yPHx/9PNPL N^NuNVHxHn/.a( \ yT!nD0.H yT!@@ yT@ yT@ yT!n+m 8 -8+n HU n NX  fdN-@`/.HUNP g/.NX+m8 / ./NP/.//9N LPDPJPbPhAP~@PAPBP@P@PjPPYPPP(nP0P8hP@%PDPJPV@\ PdPj@xP~PUPP@UPPPPPjP@PPP*@4P:PDPRPdPpPvjP@PPPPPPP@PP@@  P P @ "P (P 0VP :@ FP LP TVP Z@ ` P hVP p@ vP @ VP @ 7P P P >P ZP @ @ @ WP *@ :WP J@ dP rP zP P aPT@Z PjPnHP~@@@ PPPuPPuP@ PBPP @&P8PHPT-PZjPdPnPvuPPP,PjPPPPzP uP0BP\Ph,PnjPPuPP@ P@@@@@ PHP"HP&P,P PPP PPP P P6PF PVrPpPP PrPPP PrPP*P< PNrPnPP PrPPPLP'PjP(LP.sPPPVPrP1PQP(PjP PQPPPKPPPIP^Pf|P|IPP|PPP 5PPPP&P,P<|PjIP~|P6P`PPPP|PP(P..PFPXPjPpP~PPPPPP@ %/9?HPXclt}@t "+8AJQXctis|@  +3:CHOX^gls{  ^%,39?DMV] h $ox~~ `#H*5>GOU]en v|t8 )08AKQVajub #`+6>@ErNU^g$ny !)2>JV^6fnt{_nbuf_callout_klseql_protoscb_DMPADDR1_DMPADDR2_boot_rootdev_linesw_usetup_mclrefcnt_desscan_printf_ctxinit_suibyte_subyte_mbbufmem_copyctx_bclnlist_mpid_ntext_rmalloc_qs_suiword_suword_swapmap_nswdev_file_nproc_sum_vtopte_whichqs_mbmemmapulmult_runin_dumpsys_inodeNINODE_freemem_rootdir_CMAP1_CMAP2_msgbufmap_rate_initname_DMPMAP1_DMPMAP2_rmfree_desfree_avefree_pagein_maxpgio_bswlist_nchrdev_kmapwnt_vmaccess_buffermap_panicstr_nswap_maxfree_noproc_swpexpand_swdevt_configure_physstrat_Sysmap_ecmap_physmem_end_dmmax_version_peek_saferss_scb_usrpt_maxslp_munlock_CADDR1_clearseg_multprog_rablock_sleep_CADDR2_swptstat_inode_avefree30_nmbclusters_buffers_boothowto_sendsig_callfree_spl0_argdev_update_icode_nfile_klout_spl6_spl7_buf_fusword_initscb_nscan_bootflags_uinit_meminit_poke_mapin_pmegreserve_procNPROC_bootf_ncallout_deficit_runout_kltxt_useracc_bzero_etext_dumpdev_ninode_pidhash_selwait_waittime_bcopy_astoff_Usrptmap_zdmap_firstfree_nblkdev_startup_expandldivt_cdevsw_rasize_psignalDiagRet_cmap_forkstat_cmhash_rminit_pmeginit_nswapmap_mfree_memall_cnt_dmmin_updlock_nclist_klsdist_runrun_bufpages_bufhash_copyseg_iopbs_minfree__setubyte__getubyteuldivt_execve_sirmask_traceoff_splx_cpu__setuword_susword__getuword_cfreecount_grow_exit_vector_klin_maxmem_argmap_msgbuf_text_swbuf_swapdev_copyout_u_mclfree_fuibyte_dorti_fileNFILE_proc_kernprot_physmbmem_mlock_dumpmag_addupc_textNTEXT_wantin_aston_fuiword_panic_IOPBmap_iopbmap_total_kernelmap_lotsfree_dumplo_traceon_zmemall_mbmemall_hand_dumpsize_mbstat_ncmap_cfreelist_bfreelist_nswbuf_dmtext_MBBUFmap_mbbufmap_mbmap_fubyte_mapout_calltodo_bdevsw_hsegmap_mbbufspace__setusword__getusword_fuword_copyin_curpri_ecmx_cfreeb[lҺ$ wbbbxhHNV. . @*Pp0.N f A #TR ` mNJfF*m6f . @ R SrdNJf/.HyxNPN*nN^NuNVH0*n(mHx$NX.BbJf)M(`" ,fHyNX l!Mb)MHTaX/NXL0N^NuNVH8*n`0+4gJg , @p f 0+4gn , @p g/,aX)@Jf `)l*bJg0+4g;|4Rm0J, f.HTa*`6*b)lJg0+4g;|4Rm0 T-h HT nNX(Ug&Jm4f &TJm0gJg0+4gL8N^NuNVH0*n(mHx$NX.Sl0Bl4 fHyNXJg -gB - gN/-/-apPHTabX U-h+|HU nNX/N` U0(4g| HUa XL0N^NuNVH0*n(|BbJf )M )M`" , fHyNX l !Mb)M L0N^NuNVH<&|Hx$NX.*kf/NX`'mb/NX(U0,4gJnHyNX - f $m-m` $m-m0,4g -R//.HRad`/-/.HRN J- f0 - /NX.HU l NX/NX`Hx$NX. -g /-/aPHSaX - /NX+|HU l`LP0-PTJPfPt@zP9P7P@BP7PD7P`@fBP7P5P@BP06PH5PR7Pj7P~7P@BP%P7P*7P:7Pp7P5P(PKPP@BP5P(P0KP6P >#+5?ENVt[eltrz@ #+4;HBKQW_ gnts|. #$*28CKS [eJks{_nbuf_klseql_rootdev_mbcopy_printf_mbbufmem_bclnlist_mpid_rmalloc_nswdev_sum_mbmemmap_runin_rate_rmfree_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_physmem_dmmaxlmodt_rablock_buffers_boothowto_mbbuffree_argdev_klout_buf_runout_kltxt_dumpdev_iointr_selwait_bcopy_zdmap_nblkdevldivt_mbgo_rasizeDiagRet_dmmin_cnt_updlock_mbcopyst_klsdist_mbbufall_runrun_bufpages_bufhash_mb_hd_sirmask_splx_cpu_cnintr_klin_maxmem_swbuf_swapdev_u_mbdone_physmbmem_wantin_panic_iopbmap_total_dumplo_hand_bfreelist_dmtext_nswbuf_intcnt_mbbufmap_swab_mbmhgo_curprib[lӈ$ bbbThNVB/. 0. H/a& N^NuNVHx/. 0. H/a N^NuNVH B`b n P n S n JlHHyTNX`6Jf: n *PJg0.  b@0;N$Nh` n (r *e( r d-| `DHyHx/ <r /HyN n (./- </NP, "<//NP,/. /./ /N`$,-Jfp`B// n /(N Jg/. /./ n /(`/ n /(`JfB`,-ݕ n ݨ n ` n l-| ` n l-|0 n (r *HyHx ./ <r /HyN n (./- </NP,/ //./. a&-@ n Jn .`pL N^NuNVHB`Jf .gj~J f/.NX, gH@/./. /HnN-@  f.HH//.NPJgfp`v~J f/.NX, g0=@/./. /HnN-@  f0.H//.NPJf߮Jn .LN^NuNV0. Jg g" g8p`P . r -@l`: . r -@ d ` . r -@ d0N^Nummrwf@lRPPP-PDP1P<PZPp-Px:P,PJ-PVDP\1PP-PP$:PLPh P:P0PP #,3=CMUtZajtpw@: %.6@KV_gnw~H  t!*09AKT]fkqy$_nbuf_klseql_rootdev_linesw_desscan_peekc_mmpeekio_mpid_bclnlist_nswdev_sum_runin_freemem_rate_pokec_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_panicstr_nswap_buffermap_maxfree_noproc_min_swdevt_ecmap_mmrw_physmem_dmmax_peek_saferss_maxslp_multprog_rablock_mmmmap_swptstat_avefree30_boothowto_buffers_argdev_klout_kernacc_vmmap_buf_nscan_poke_mapin_deficit_runout_kltxt_dumpdev_selwait_zdmap_firstfree_nblkdev_uiomove_rasize_cdevswDiagRet_cmap_forkstat_cmhash_cnt_dmmin_updlock_mmap_klsdist_runrun_bufpages_bufhash_minfree_mmwrite_cpu_klin_mmread_maxmem_swapdev_swbuf_wantin_panic_total_lotsfree_dumplo_hand_ncmap_bfreelist_nswbuf_dmtext_bdevsw_curpri_ecmxb[ lӚ$ Wbbb` o"o / o02gS" f"`"Q `QNu o"o / on `QNu` QNu"o /B/gS @`"Q g2gNu>@j8\#j*1:7ret_ovbcopy_blkclrbloopbwd_bzero_bcopybytesb[ l^$ bbb@TNV . gp` #xBN^NuNV.*|#xJ g -r //- NPB B*nN^NuNVN^NuNV.*| . mgB @mg0 @ mfV-n n n!mp- n!@B`P n ` nJm nJ gp`, n+P`/./. 0. H/HyNp*nN^NuNVH0(| .gp`rJgJ fD ,r /HyNP*@g ,r r NR*B)M . Ь  @0?-@L0N^NuNV.A-HA-H-| |=PBn |=P n(.g |=PRn ndm ndmHyNX np( g>Jg n(HHB`. n(HH`Jf J9f&J9f9H nr(Ag9HH nѐ9HH n쑨 np(  n@ n-h g` n ("HA HABAЁ".PЁ*@ n* n+h n(+@ n (R!@ nmB np(#B9*nN^Nums: ENOTTY: %x, %x, %x Mouse sampling would not stabilize $PP,P2#P6PPPvP@P PL0PR?Pt,PP"P"P"P@P:@P@V@n@x@@@@@@l@v@|@@@ #$,2<IS[afip@y$+7AMUn^gpHw  $*5=EMU]_nbuf_rootdev_linesw_printf_msclose_mpid_bclnlist_buttonsnext_wmemfree_nswdev_file_msread_runin_bswlist_xdelnext_nchrdev_msintr_ms_softc_kmapwnt_panicstr_nswap_buffermap_flip2bits_noproc_swdevt_physmem_dmmax_scb_rablock_boothowto_buffers_argdev_nfile_buf_Mouse_clknomouse_clkmouse_needxdelta_runout_msioctl_dumpdev_selwait_zdmap_nblkdevldivt_rasize_cdevswDiagRet_memall_dmmin_updlock_runrun_bufpages_bufhash_cpu_maxmem_msmmap_ydelnext_swapdev_swbuf_fileNFILE_wantin_dumplo_zmemall_hand_bfreelist_msopen_nswbuf_dmtext_bdevsw_curprib[ly$ bbbP o //$"<`ҘUdR`g <0ҀdR A"<A$Nu6ret_ocsumb[l$ bbb~ `40NV/.NXJlB`p N^NuNVH8*n0-H"HAZZHABAЁ(@&m B)K4ZXR m0-H @J9fR9/9BHzN L8N^NuNVH 0. . mp` "HAZZHABAЁ*@J4g+|$> ->ffHUNX| GmGH+|:/anXBHx"0. H/aP N ->f0>HxHUNP` ->gJygp`(NHU0. H/-EH( @ PNPL N^NuNVH00. . "HAZZHABAЁ*@HU-EH( @ PNX(m4, ->f ->fBHx 0. H/aZ HUNXL0N^NuNV.0. "HAZZHABAЁ*@/. HU-EH( @ PNP*nN^NuNV.0. "HAZZHABAЁ*@/. HU-EH( @ PNP*nN^NuNVH0B*|`(m4`p,,R ->gp g -: gB` -NHH,pg$ -: gx -: @gf -EfBJ fR mRR g f0+| HUNX`HU/-EH( @ PNPpfZe*|`P(m4pg:,>RJ-EgHU-EH( @ PN`HUa2XZe .L0N^NuNVH00. . "HAZZHABAЁ*@/././. HU-EH( @ PN-@Jl/././. HUN-@JlR . tkg tlg tmg txgr tyg^ tzgJ t{g4 @tjgp` t g t f/a!f-H @0H"-nJ ->@g>HmNXJ,g$ ->//-,NPB,>Jg6HmNX. m -: g",@ >/.NX`& /HUHyN >`L0N^NuNVH 0. . "HAZZHABAЁ4 @*PN(p,p-" . b@0;N,2<,. p-* "@` ` . F̀`/NX L N^NuNVH0B(|*l4gB r  @HH€g|` p,Jg ,>f|HTNX>`h ,>g\ ,:fP ,>gRZ m" 9/BHzN L0N^NuNVH0B  @(PgxJlgr rNJf /Hy dNP "HAZZHABAЁ*@ ->g(/aXBHx"/a >HUaXR mfL0N^Nu   l   oct%doct *PFhPpSP|)P)PQPkPhP@ lPF4Pf,P|WP0PPhPP>PrhPPhPPhPNPPhPhP@P\hPhPPdPhP@L4PrMP4PPNP7P RPVMPlLPrkPhP4P 8MP VhP |SP NP %P %P P <QP LkP pP (P @ P hP@@@ @,@0P %.6@JTZ Rfmqy  @#*N3;CLU\bms| N ~H!*4<DM JV]fppx  ^$-5 @FQZcks|_nbuf_flushtty_rootdev_linesw_octinfo_printf_ttyclose_mbbufmem_bclnlist_mpid_oct_speeds_lbolt_qs_nswdev_file_nproc_whichqs_mbmemmap_avenrun_hostnamelen_runin_octclose_ttlowat_octopen_hostname_tz_dmtooct_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_octtodm_noproc_swdevt_gsignal_physmem_dmmaxlmodt_oct_timer_peek_rablock_sleep_octstd_buffers_boothowto_spl0_argdev_nfile_octread_spl5_buf_tick_selwakeup_procNPROC_tthiwat_runout_octparam_dumpdev_pidhash_selwait_zdmap_nblkdev_octwrite_cdevsw_rasize_octintr_octscan_dmmin_updlock_octioctl_runrun_bufpages_bufhash_ttrstrt_splx_wakeup_maxmem_octprobe_hz_getc_octsoftCAR_swbuf_swapdev_octattach_u_fileNFILE_proc_physmbmem_hostid_wantin_octreset_time_iopbmap_dumplo_octdriver_hand_bfreelist_ttioctl_octmctl_nswbuf_dmtext_oct_tty_mbbufmap_bdevsw_timeout_ttychars_octstart_curprib[lƁ$ bbb0d'T d* '-4;?GMT([dmz  , +5=DIOZ dlu}~H$  #,7=EPX^fl t{_nbuf_callout_rootdev_mclrefcnt_mpid_lbolt_ntext_qs_nswdev_file_nproc_nport_whichqs_avenrun_hostnamelen_runin_inodeNINODE_rootdir_hostname_tz_nchrdev_boottime_kmapwnt_panicstr_nswap_maxfree_noproc_ecmap_physmem_dmmax_rablock_inode_buffers_nmbclusters_boothowto_callfree_argdev_nfile_buf_tick_procNPROC_ncallout_runout_dumpdev_ninode_swpf_pidhash_selwait_zdmap_firstfree_nblkdev_swsize_rasize_cmap_cmhash_mfree_dmmin_updlock_nclist_runrun_cfreecount_maxmem_hz_swbuf_text_swapdev_mclfree_fileNFILE_proc_hostid_textNTEXT_wantin_time_dumplo_hand_mbstat_ncmap_cfreelist_nswbuf_dmtext_calltodo_curpri_ecmx_cfreeb[l$ QbbbT8`@NV#T#XHyXNXJf n0H-@#T` #TpN^NuNV#T#XHyXNXJf nHH-@#T` #TpN^NuNV#T#XHyXNXJf n0#TB` #TpN^NuNV#T#XHyXNXJf n#TB` #TpN^NuP @@P@ P8@<PJ@NP^Pb@h@lPr@xP@P@PP@@P@P@P@PP @@P@"P6@:PD@HPX T%-39X=_peekc_nofault_saved_jb_pokec_setjmp_peek_poke_jbb[l$ 5bbb  ptwob[ lʁ$ $bbbb["lā$ $bbbb[$l$ $bbbb[&lO$ bbbXpNVH0*nHxBNP-@JglHxHm8NPJgLHxHm"NPJg, n (Ј(@)MHyHTNP+LB,B`Hm8NX/.NXp7L0N^NuNV.*n-m nB/.NXHUNX /NX*nN^NuNV nh0 n h0(g/.aXN^NuNVH0*n n (Ј-@Jg6 @0 g gp/`> nJg/NXJfp1`"(mHxHl/.N l0BL0N^NuNV n (Ј-@Hx . //.N nh0N^NuP,P@P\ PdP|(P P1P*P%P,,P^P~PP#39AHW`jt|2 *3:CKR[clt} _sbreserve_rootdev_mclrefcnt_raw_disconnect_mpid_nswdev_runin_if_ifwithaddr__insque_raw_bind_rawintrq_m_free_rawcb_nchrdev_kmapwnt_panicstr_nswap_noproc_raw_connaddr_ipintrq_physmem_rablock_nmbclusters_boothowto_argdev_raw_detach_runout_m_getclr_dumpdev_raw_attach_selwait_bcopy_nblkdev_rasize_mfree_updlock_runrun_m_freem_maxmem_swapdev_sbrelease_mclfree__remque_wantin_ifnet_dumplo_hand_mbstat_curpri_sofreeb[)lӁ$ bbbl$ XNV. n (Ј*@p- 3A#pA #HylHy|Hy/.N*nN^NuNVH0B n -h*n` 0-HѮ*UfHxBNP*@f-|7HUNX .`+|h;|* Э(@ n h 0(@ .9@ n0(0g* -@ @ Pg -|/` n)h `B . @)P|HxHyBHUNL0N^Nu@$@.@4@:@@@JPPPNPX P +07>lFP2W_huZ |_ripproto_rip_input_m_get_mclrefcnt_ipq_rtnet_ip_id_ripdst_rawintrq_rawcb_ipstat_ipintrq_nmbclusters_ip_output_rip_output_mfree_routetoif_m_freem_raw_input_mclfree_ifnet_mbstat_rthost_ripsrcb[,l7$ bbb NV###2 N^NuNV.HxBNP*@f/.NX`*;|$ Э-@ nX"@"#h#h#h n ."@"#h#h#h n "n"N-@ 9 m HUNX`*B|Jf#` y!M|#R/.NX*nN^NuNVH8N-@-yJg" n#|fB nB|S/.NXJg^ n (Ј&@B*y` m(h 0,SfJlg 0,kf0-0gHxHkHmN Jf0-0gHxHkHm N JfjJg^Hy;B n/N -@g@/Hk ."/N Jf /.N` ."/NX-m*UfJgH/.NX-@/Hk ."/N Jg ."/NX`d/.N`L8N^NuNVJm NqN^NuNV. n*hBf J gp` . b@0;N Vxxp@@(@@@@L n0(fp `Tf/.NX-@ .`4fp9`&HUNX`0-0gp8`/.HUNP/.N`0-0gHUNX/.N`/.N`JgH0-0f/.HUNP/./. n h h NP-@JgBm0`80-0f`8HUNX/.N`r-|-`Hx n (Ј/HmN n1|`HyN`*nN^Nuraw_usrreqP PPPP4PJP PPPPPPPPPPPP2 P<PPPXPfPpPPPP PBPTPh!PxPPP!PP~PP PPPPP PfPr"PP@P .<FLT2[(dr{&"2:A IU_g_netisr_m_get_mclrefcnt_raw_disconnect_raw_ctlinput_rawintrq_bcmp_m_free_rawcb_rawintr_raw_connaddr_ipintrq_splimp_raw_init_nmbclusters_raw_detach_raw_attach_bcopy_soisdisconnected_soisconnected_mfree_sbappendaddr_sirmask_splx_m_freem_raw_input_mclfree_panic_socantsendmore_m_copy_ifnet_mbstat_raw_usrreq_sbwakeup_sofreeb[0l$ bbbHNVH<*nA-H0-@Jg UJ,fX dLHn/. . @ PNP.. rN @$P`Z Ъ(@ fJ0,$g> l,0( g.Hx/.HlN Jfg ,((d&L$Rff.. . @-P rN @$P`` Ъ(@ fP0,$gD l,0( g4p0,f(/.Hl nNPJgg ,((d&L$Rf*gRk&LGOV_grz _rootdev_m_get_mclrefcnt_rtinit_mpid_rtnet_nswdev_runin_afswitch_if_ifwithaddr_rawintrq_rtrequest_bcmp_m_free_nchrdev_kmapwnt_panicstr_nswap_noproc_ipintrq_splimp_physmem_if_ifwithnetlmodt_rablock_nmbclusters_boothowto_argdev_rtalloculmodt_runout_rtredirect_bzero_dumpdev_selwait_nblkdev_rasize_mfree_updlock_runrun_routetoif_rtfree_splx_maxmem_swapdev_mclfree_wantin_panic_ifnet_dumplo_hand_mbstat_rthost_rttrash_curprib[4lI$ bbb$$"oH"BNu"oL. <Nu SAVREGS_setjmp_longjmpb[6l$ bbb xHNV y ( f ` y ( f fp`BN^NuNVH8*n0-H"HAZZHABAЁ(@&m B)K4||Sn|Jf|`|||D||||RZX m0-H @Jf#HxBHzN L8N^NuNVH 0. . mp`. "HAZZHABAЁ*@+| $> ->fHUNX| GmGH+|:/a~XBHx0. H/a * N r  @HH€fHxB0. H/a g> ->f4>HxHUNP` ->glJygbp`(NHU0. H/-EH( @ PNPL N^NuNVH00. . "HAZZHABAЁ*@HU-EH( @ PNX(m4N|  @PN ->f ->fBB0. H/a HUNXN ->f ||NL0N^NuNV.0. "HAZZHABAЁ*@/. HU-EH( @ PNP*nN^NuNV.0. "HAZZHABAЁ*@/. HU-EH( @ PNP*nN^NuNVH `v y HH*R "HAZZHABAЁ*@ y HH.R y HH,R ->fHUNX` @g -: gB` -NHH.  g0N-@-m4 n| n|/.NX g$ -: gp -: @g^ -Ef:J fJ mRR g f(+| `&HU/-EH( @ PNP 9 e # 9 f~HxBHzhN L N^NuNVH0B*|B  @Jf(m4|p,g ->f^HUNX>`J ->g6Hx0-BH/NPHx0-BH/NPHxHUNP>p,g:|(R>J-EgHU-EH( @ PN`HUaTXZR m .L0N^NuNVH00. . "HAZZHABAЁ*@(m4/././. HU-EH( @ PN-@Jl/././. HUN-@JlV . tkg tlg tmg txg tyg tzgj t{g4 @tjgp` t g t f/azX .`N|  @PNB`N|  @`HxHx0. H/a `HxB`B n/aBX/`Hx`Hx`HxB0. H/a /apX n `zL0N^NuNVH..B @g  g g g LN^NuNVH..B g@  g g g LN^NuNVH0.. "HAZZHABAЁ*@(m4N-@||J-GfBB/ap `T|!z@  @( -Gf@`, -: g``@ -:g -Gf ` -Gf`|@|@|@" A-G  @0H&  @0HgT X33 " X303 Vr 30" A0/.NXL0N^NuNVH0*n(m4N, ->!f-H @0H"-nJ ->@g>HmNXJ,g$ ->//-,NPB,>JgTHmNX. m -: g >`$ /HUHyN >/NXL0N^NuNVH 0. . "HAZZHABAЁ4 @*PN*  @,|p-( . b@0;N>DN,.  @}| " AP` ` . F̀`/NX L N^Nu`D $, tvU@ suP*P4ZPl8PPPPPPuP.@P8PX@xvP3PP,P2bP@0PZP8PP3P P0PP3P<0Pn8PP8PP@@ 8P(@6@<@J@^\P3PYPFPT@Z@b6Pf@l@r@uP8PP\P&P"&P0PrP8PPoP3P P0P3P P 68P B3P v P 6 P L@ ^4P 4P YP 3P P 6\P T:P r^P XP uP YP 8P 3P  P \ P x P YP@@@ @,@0MPF6PJ6PN6P J%-D7BLV`fpt |    @ #.8?GOXbkr{ ,  &/8~AJHQY `i qy   `  !)/7>GJpS^dow  _nbuf_flushtty_suread_rootdev_linesw_suattachEXC_ADRERR_ttyclose_mbbufmem_bclnlist_mpidEXC_TRACE_qs_surptr_nswdevUSERCODE_file_nproc_sudriver_whichqs_mbmemmap_suparam_runin_suintr_suwrite_ttlowat_sudisable_bswlist_suioctl_susoftCAR_nchrdev_kmapwnt_su_wr5_buffermap_panicstr_nswap_noproc_swdevt_gsignalEXC_RESET_physmem_dmmax_suprobe_rablock_sleepEXC_BOOTING_buffers_boothowto_spl0_argdev_nfile_spl6_su_clk_sumctl_suibuf_buf_su_ttyEXC_BREAK_selwakeup_procNPROC_tthiwat_runoutEXC_ABORTEXC_EXIT_dumpdev_pidhash_selwait_zdmap_supoll_sustd_nblkdev_su_cntEXC_DOG_cdevsw_rasizeDiagRet_su_speeds_suinfo_sustart_dmtosu_su_timer_suwptrEXC_BUSERR_dmmin_updlock_runrun_bufpages_bufhash_ttrstrt_splx_cpuINITSPa_wakeup_maxmem_getc_suopen_swbuf_swapdev_u_suclose_fileNFILE_proc_physmbmem_wantinEXC_KCMD_suend_iopbmap_dumplo_sutodm_hand_bfreelist_ttioctl_nswbuf_dmtext_suact_mbbufmap_bdevsw_timeout_ttychars_curprib[>lށ$ bbbHNVBHn /.a" N^NuNVHxHn /.a N^NuNVH0*n(n `Jg/./ajPHH, %fHH,  lgn Xgnl DgnR %gavP`R Sr gBJg/.Hx,aPP-| nHH, o/./a(PR` n  oxR`-T .R @HH,g/./aP`/.Hx%`b Og` cgn bg` dg` ugn sgnn ogp`` xgZ`RL0N^NuNV. fJl/.Hx-aDP .D-@A*H .". N @ .". N-@Jf/.SHH/aPAb*nN^NuNV.BJg `B#*NHUHUNP 9Ped @Jg @/(NX/.HyaP/.BNP*nN^NuNV/.HyaPN^NuNV n/($0(a/0(//. HyaNN^NuNVH ..J g^*yȻg ->gN, fHUHx NPHU/NPHUNX/N`Jgv gn gf 0`g(B#0`B  @BR mJm mB"9 ARJg /NXL N^Nu0123456789abcdefpanic: %s %s: table is full %s%d%c: hard error sn%d 1P@IPPP :PRPSP 2P6PB@TPl@@RP.P_P_PP$JPFOPNOPXOPbOPvOPOPOPOPOPOPLP  )1:CKXS]cgovt{t @z '08BKU`it| ~H!(t-6?GQZcjpb{2$_nbuf_klseql_resume_boot_rootdev_linesw_desscan_uprintf_printf_printn_bclnlist_mpid_qs_nswdev_nproc_sum_whichqs_runin_freemem_rate_ttlowat_ttstart_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_harderr_physmem_dmmax_saferss_maxslp_multprog_rablock_swptstat_avefree30_buffers_boothowto_argdev_klout_spl6_buf_nscanulmodt_procNPROC_tthiwat_deficit_runout_kltxt_dumpdev_pidhash_selwait_traceback_zdmap_nblkdev_putchar_cdevsw_rasize_forkstat_dmmin_cnt_updlock_klsdist_runrun_bufpages_bufhash_minfreeuldivt_splx_tablefull_cnputc_klin_maxmem_msgbuf_swbuf_swapdev_u_proc_prf_wantin_panic_total_lotsfree_dumplo_hand_bfreelist_dmtext_nswbuf_bdevsw_ttyoutput_curprib[Clե$ bbbHNVH0*nA(H+n ." Ҁ*( )nL0N^NuNVH8*nA(HJ of . oHyNX&L`  m»fp od +"9N"9-AlD  m +Ё.  -@&Jg Ю //./9ad `R.+ . ѫ . fP'k'Sff rNJgHyNX`PJf0BL8N^NuNVH JoRJ oJ .P*@-M`Jg P -och -ЭmZ -Эn . ѭJg .Ю m .Ю n ѭJgP+m+U` .Ю m$Jg .Ю n .  . ѕ`b.-+n-G.* P-G fA"nc:Q -Э//- n/(HyN+U+mB* .f*J9g"B9/9N` HyNXL N^NuNVH<*nA(HJ nHyNXfB`&L` +nГnPJfJg +Г".Ү m +f2Г".Ү f$KJg|P%j%R` . ѫ . `^ +Г".Ү g$K`PJff`j%j %RQb .Ю '@ +Г".Ү '@ .& .L<N^Nurmallocrmalloc swapmap%s: rmap ovflo, lost [%d,%d) bad rmfreermgetRP^Pf@l7PP PPPPPP*P4@:7Pn@tP8PPP8P,P@7P@7PP ")089=FNU^gt{ V ~#,H3<DLV]fnv~_rootdev_rmget_printf_mpid_lbolt_ntext_rmalloc_qs_swapmap_nswdev_nproc_whichqs_avenrun_hostnamelen_runin_hostname_tz_rmfree_nchrdev_boottime_kmapwnt_panicstr_nswap_noproc_physmem_dmmaxlmodt_rablock_boothowto_argdev_tick_procNPROC_runout_dumpdev_pidhash_selwait_zdmap_nblkdev_rasize_rminit_nswapmap_dmmin_updlock_runrun_wakeup_maxmem_hz_argmap_text_swapdev_proc_hostid_textNTEXT_wantin_time_panic_kernelmap_dumplo_hand_dmtext_mbmap_curprib[GlӚ$ bbblNVpN^NuNVBN^NuNV . m . N^NuNV . n . N^NuNV . e . N^NuNV . b . N^NuNVH 9lЮ eHyxNX`B/9Hx 9t/NHx/9p 9t/N B 9tRt @p0@/NXR mp 9lЮpbf*yl .ѹl L N^NuNVH..|` g `R mBLN^NuNVH0*n(n .. SJg gp`BL0N^NuNVH *nB`RJf L N^NuNVH .. n *P ( Jg> gJ gJRS n S n RJn n P n SB`.//NPJlp` U`//NPJm`L N^Nucallocv@P@_P]P@2PdP@@2P P@@2P/P@$@.@8@B@: PV P4P4P #+4=VB*HQYcimu|ttt@l$-5@:@HO XahqypR&/7~@IHP[dltzlt $"*39@KS[ckq_nbuf_klseql_rootdev_passuc_linesw_calimit_desscan_max_imax_suibyte_subyte_bclnlist_mpid_qs_nswdev_nproc_sum_whichqs_cax_runin_inodeNINODE_freemem_rootdir_rate_bcmp_desfree_avefree_maxpgio_bswlist_cacur_nchrdev_kmapwnt_vmaccess_buffermap_panicstr_nswap_maxfree_noproc_min_imin_swdevt_ecmap_nulldev_physmem_dmmax_saferss_maxslp_clearseg_multprog_rablock_camap_swptstat_cabase_inode_avefree30_buffers_boothowto_camax_nodev_argdev_klout_buf_nscan_ffs_procNPROC_deficit_runout_kltxt_dumpdev_ninode_pidhash_selwait_zdmap_firstfree_nblkdev_cdevsw_rasize_cmap_forkstat_calloc_cmhash_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_klin_maxmem_swbuf_swapdev_proc_wantin_panic_total_lotsfree_dumplo_strlen_vmemall_hand_ncmap_bfreelist_nswbuf_dmtext_bdevsw_curpri_ecmxb[Klѩ$ bbb\hxXNVlH0B 9gHyNXHntaX(||`Jg` T.tf(.uf .*wf nxwR .0vm$ .7vnJ.wf.vHH0-@`HyNXHyNX`fB(||`PJf,/Hy `Jmf* f" U/($HyN`<*|` Jmf,JfJfHy$NXHx BNP0,H".灀9@309H29R333h09H/ l NX-@JnHy6NXJ`f 'm #`` #`Jdf #d 9d`o #`d#/.aXJg 3L0lN^NuNV .##nJlBN^NuNV.*||`80-H2. Hf0. H/ m NX` JfB*nN^NuNV.N. f~ /NX ..N^NuNVH *n`6 #gN @g` g4 f*nHx NXa.  g fB` Sd`L N^Nu LORUroot device? bad/missing unit number use ip%%d root on %s0 root on %s0 no suitable root bad swap space sizexyipddnd,P@$P6@@P@P@@@PP@ P.PTPZPlP|6P6P.P.P@6P@PP@@@@@@@@ @WP&6P*PBWPHSPP@ZSPj@"PGP GP @$QPHCPRCP|>PPCPCPHPHP8PHPHP 8P@N7PXCP^CPhPrCP~CP"PPCPQPQP"PPCP(P$QP.CPNCPbCPl+PzCPEPQP)PQPQP ",29=ELU^kr @ '.7>GRZainx~~H#*36<GOW]elr}_nbuf_rmdir_rootdev_linesw_bclnlist_mpid_lbolt_qs_nswdev_nproc_whichqs_avenrun_hostnamelen_runin_inodeNINODE_rootdir_mastertemplate_namei_hostname_tz_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_direnter_swdevt_ialloc_physmem_mount_dmmax_uchar_rablock_inode_buffers_boothowto_argdev_irele_itrunc_buf_dirempty_tick_procNPROC_runout_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_rdwri_iupdat_dmmin_updlock_runrun_bufpages_bufhash_dirpref_maxmem_hz_swbuf_swapdev_u_proc_dirremove_hostid_wantin_time_dumplo_mkdir_hand_bfreelist_nswbuf_dmtext_bdevsw_curpri_iputb[Tlց$ bbb<NVH0####*y`"(m`Jg lN, e*mfara L0N^NuNVH0*y` g*mf`$(m`JTg0H f `, eBL0N^NuNVH0Jg@*y` g*mf`"(m`0,H f `, eBL0N^NuNVH0*y`,(m`Jg/. /. lNP, e*mfL0N^NuNVH0*y`"(m`J$g l$N, e*mf 9rN/BHzN L0N^NuNVH0*y`"(m`J g l N, e*mf 9rN/BHzN L0N^Nu P P P P P"P(P, P2 P~ P P. P| PPPP PPP(P$#,9 CGT`lrxt_domaininit_lbolt_pfctlinput_avenrun_hostnamelen_hostname_tz_pffindproto_inetdomain_unixdomain_pfslowtimo_boottime_pffasttimo_domains_tick_pffindtypeldivt_hz_hostid_time_timeoutb[Wlg$ bbb 4hNVN^NuNVH *n~# .gRR`NHxHUa P `8 .g #` . fm/HmNPp0-f .g\`D .f . gHxHUaP `mHx#HmNPp0-f . gHyNX .gRmm .gRmm . L N^NuNV.*nfHyNXp0--@ . g> .fHy$NXSmfm .g HmNX . g> .fHy3NXSmfm .g HmNX*nN^Nuflockifunlockino shared lockno exclusive lockL6PnPP@:Pb@h:P@:P2P@:P2P %+/7=DMTajr@{ "+3~<EHLU]elu}N_nbuf_rootdev_linesw_bclnlist_mpid_qs_nswdev_file_nproc_whichqs_runin_inodeNINODE_rootdir_flocki_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_mount_dmmax_rablock_sleep_inode_buffers_boothowto_argdev_nfile_buf_procNPROC_runout_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_dmmin_updlock_portal_runrun_bufpages_bufhash_funlocki_wakeup_maxmem_swbuf_swapdev_u_fileNFILE_proc_wantin_panic_dumplo_hand_bfreelist_nswbuf_dmtext_bdevsw_curprib[[lS$ bbb  @NV.*yx-m-mA-H-|BHna(P*nN^NuNVh.*yxJo o `BAl-H-m -/Hnl/-N J9f BHnaP*nhN^NuNV.*yxA-H-|-m-mHxHnazP*nN^NuNVh.*yxJo o `BAl-H-m -/Hnl/-N J9f HxHna P*nhN^NuNVH<*n yx d \ @(Pf  `0HJ fr`rgBB &UB`$Jl `n +ѭJmR .m-m yP ( g*Hy|NXJg -f` lf0BHUB/, J f <` < @N`$l+l p0*& g`jHx HRNPp0*fj0g  f )j2 +l /. HUHRa jp0*g(jHRNX`/. HUHRa  .Ѭ .#L<N^NuNVA-H-|-n-n-n-n-n/.Hn/. a. -@J g n `Jg-| .N^NuNVH0*n(n =mPBJg gHy NXJf JfB`Jl2p0-& f0.H"9gp`Jfmp0-&* fJf2HT0.H/0.H"HA((HABAЁ`6mBHT0.H/0.H"HA((HABAЁ @ PNP9HH`Jg f0 f( ,ЬoHx/9PNPp` `g=m -m n-h0`-| ,".N-@ ,".N, .䐆d .䐆` ,. `gJf -2-@JoNl. Ї/ fB`p//.HUN n"(d-@J9f fJm f. ,Ї2o" @g g f ,Ї+@2 l .R n"(P"-2m n (0` n (HF2Ш4SL-@` .-@X#-n#JfJl./.NX-@ @/( @/( NP nB(`R -Rf(/9/9/./.0.H/N`/./.0.H/N -@+n` ."<N-@B`< .Ю/0.H/NPJg .Ю/0.H/NPR .ܰmf/./.0.H/N`/./.0.H/N -@ n .萨(l ` n .萨(. n g-|/NX`HT/./ n ( І/aJf, Іg ,2f n/.NX``p0-& @f /.N`* Іf n/.N` /.NXmBJygm&J9f JoJfd .L0N^NuNVH8*n.. (nB`PSJoJg&T-kJg .c-G , Jg8 gb g( .ѓ . . .Ѭ`Jf/./HUN`/.HU/N -@Jf&`Jf/./HUN `/.HU/` .L8N^NuNVH0..*n `SPJfHy NX(UJoJo - Jg" g, g,RSSRB`,//NPJl` T`//NPJlpL0N^NuNVdH0-yx n/NX*@JgL0f  `6 n.( f/NX.Jf ` ff n  @` ff n  @` r, c ` g.JgR/Hn| n/(N J9g6`r @gJg/Hn|NP`  g n-h| mfHn|//- N `(mp0,&-@x xgL @ff$ xg @xf ,2 -@|` f~g f}g`=lPvB yP ( gHy|NXJg `zBHn|/0.vH/0.vH"HA((HABAЁ @ PNJ9f, @g"Jg/ n/(Hn|N L0dN^NuNVpN^NuNVN^NuNVN^NurwipureadcXPDXP\XPlPXPXPXPXPXP.lP8XP>XPfXPxXPXPXPXPXPP XPBmPJPXXP)PXPRPXP2XP@_P"hPCPCPXPXPXPXPEPRAPd&PPPXP'PDPPPDP'PiP @PHAPj1PgPIP@P^P<XPj^PYP/P PXPXP WP lP XP DXP VXP \P jXP CP XP XP WP XP !)2:DJ QU]djsz @ z!(18>GMT[<bkv~ ~H !)1:@@GOW^gqyX  # .6>GOW_ fny_nbuf_read_rootdev_linesw_sosend_suibyte_subyte_bclnlist_mpid_ogtty_qs_nswdev_nproc_file_whichqs_runin_inodeNINODE_rootdir_blkclr_write_ttlowat_geteblk_writev_bswlist_ioctl_nchrdev_setjmp_kmapwnt_buffermap_panicstr_nswap_maxfree_bdwrite_noproc_swdevt_ecmap_physmem_dmmaxlmodt_rablock_rwip_sleep_inode_readv_buffers_boothowto_argdev_bawrite_nfile_mfind_buf_procNPROC_tthiwat_runout_bzero_soioctl_dumpdev_ninode_pidhash_selwait_bcopy_zdmap_firstfree_nblkdev_breadldivt_uiomove_cdevsw_rasize_psignal_cmap_rdwri_cmhash_getblk_dmmin_updlock_mapioctl_runrun_bufpages_bufhash_bmap_rwuio_wakeup_maxmem_swbuf_swapdev_getf_copyout_u_bwrite_proc_fileNFILE_ureadc_wantin_brelse_panic_dumplo_hand_ncmap_bfreelist_nullioctl_nswbuf_dmtext_munhash_mem_no_breada_bdevsw_ostty_copyin_soreceive_curpri_ecmxb[cl$ DbbbHDNVH0(yxJn yP `/,NX*@g$ -f yP0-*h(f - f `JgHxHyNP`0-(H## ## `$ -f HUNXHxHyNPJn# JlBHyNXL0N^NuNVH0 yP0((H"9gB` yPB(.9B S b@0;NVLLHxHx/9N Jg/9NX# HyNX`xHxHx/9N JgT/9N`.9Jm: l0 rN @# ` yP(hVg" ,Df l<0(&fh~/9 /9NP.lvHyx/9NPJg2Hyx 9V/NPJg/9 /9NP.Hy`/9NPHy` 9V/NPJmJg,F`B/9NPJm /9 /9NP`.9 rN*@B H @ йTgDR m 9T@f  9 gN* `N` g yT!yD bT yPy fNHyNXp`4HyNX yP(HH/NX#`rL0N^Nu  RPRP*APDRPbRPlbPxbP~'PbPbPbPbPKPbP'PbPbPRPbPRPbPbPLP RP,bP<RPFbPLbPbP5PbPVPbPbPLPbP5PbP`PbPGNX_js~~H!(t-4=FNXajt|$',_nbuf_klseql_exit_rootdev_desscan_bclnlist_mpid_ntext_ipcreg_qs_suword_suiword_procxmt_nswdev_nproc_sum_whichqs_runin_inodeNINODE_freemem_rootdir_rate_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_acctbuf_noproc_physmem_dmmax_saferss_maxslp_multprog_rablock_sleep_swptstat_inode_avefree30_buffers_boothowto_argdev_klout_buf_nscan_procNPROC_deficit_runout_kltxt_useracc_dumpdev_ninode_pidhash_selwait_zdmap_nblkdevldivt_rasize_forkstat_ptrace_chgprot_pfind_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_traceoff_setrun_wakeup_klin_maxmem_swbuf_text_swapdev_u_proc_textNTEXT_wantin_fuiword_total_lotsfree_dumplo_traceon_hand_bfreelist_nswbuf_dmtext_acctp_fuword_curpri_ipcb[hl@$ bbb$ NVH0*yxN(@JgN89|/-/-Hn/NJ9f)n ` 9\ @BBlL0N^NuNVH0*yx/NX(@gV lg &`D/-/-Hna J9f"/./, NP/.NXL0N^NuNVH0*yx/NX(@g( lg &`/-/, NPL0N^NuNVH8*yxJgJHxHn/-N J9fB/./-N Jf `/NX(@g lg &`N-@&l 0+f `0+g"Jkf#`zHxHkNNPJkfJkPf0+ g7|5PJkPg Q`:0+ f>-kHx/.NPHxHSNP)n nB&n`lNJmN(@f 9\ @B`-kHx/.NPJfHy NX&n9|8)K HxHxNP-@/HSNPJgP n0(H".o 0(H-@/./- n (Ј/N Hx/-HnN /.NX/.NXL8N^NuNVH8*yx/NX(@g lg &`&l /-/-Hna L J9f/.HSNPJ9fhN-@0+g0+g $`00+gJkPfHxHkNNP`QBkP/.NX/.NXL8N^NuNVN^NuNVH0*yx/NX(@g lg &`A-H-|-m-m-mBBHx/-/-N Jf `\/-/-Hna J9f./- Hn/./, N -#/.NXL0N^NuNVH0*yx/NX(@g lg &`A-H-|-m-m-mBBHx/-/-N Jf `4J9f,/- HnB/, N -#L0N^NuNVH0*yxHxHn/-N J9f@/NX(@g* lg &`A-H-|-m-m-mBBB/-/-N Jf `B/- HnHn/, NJ9fJfB`H n0(H".ܲo 0(H-@/./- n (Ј/N J9f2Hx/-HnN J9f -#Jg /.NXL0N^NuNVH0*yx/NX(@g lg &`xA-H-|-m-m-mBBB/-/-N Jf `,/- HnB/, N -#L0N^NuNVN^NuNVN^NuNV-yx n/NX-@Jg2 @ hg &` n/( n/( NPN^NuNV-yxB n/NX-@Jg @ hg &` n po ` nJ gfHx HxNP-@Jf 7`~ n/( n (Ј/ n/( N J9f8 n ( n1@/. n/(/( n/( NJg /.NXN^NuNV-yxB n/NX-@Jg$ @ hg &` nJ gJHxHn/(N J9fHx HxNP-@Jf 7`/. n/(/( n/( NJ9fv nJ gl n0(H".o 0(H-@/. n/( n (Ј/N J9f Hx n/(HnN Jg /.NXN^NuNVH0BBHxHnHxNJ9fBBHxHnHxNJ9fN*@g-y:;|+n N(@gL89|)n ##/./.NPJfVBl 9\ @BBm .\ @B nh/.NX nh/.NXL0N^NuNVH8*yx/NX(@g lg &`p&l HxHxNP-@B/BHxHS k hNJ9f$Hx/- n (Ј/N /.NXL8N^NuNV. pop`PHxHxNP*@;n/. Э//. N -@Jg HUNX` n .*nN^Nuaccept VP5P4NP>VPDVPTVP\VP|VPUPVPVPVPPVPOPVPUP"VP2#P:VPRVPjePtVPzVP8PVPUPVPhPVP VP*PLVPp"P~PVP4P5PVPVP"P@]PP$PbTPxTPOPMPVPUPVPVPVP PVPVP hPDVPf*PrVPMPOPVPVPUPVP8P,VPHVPNVPfPpVP~VPOPVPUPVP8PVP VP6P@VPNVPfVPxePVPVPUPVP8PVPfP(VP.VPtTP~VPVPTPVPVPVPOPVPUPVPD8PTVPjfPtVPVPVPVPVPUPVPP VP VP UP >VP XVP tP VP eP VP VP _P VP P VP &UP DVP deP nVP tVP P VP (P VP VP TP VP VP 8TP BVP RP vNP VP VP NP VP VP 5P VP 5P VP VP VP  P .VP 6VP JVP biP xiP VP UP VP 9P VP VP TP VP (OP VP veP P "-6BL Ydox 8@ !(0;E \K\U^eox ~$H+4r:B N ZbipyH &-5?E MX`hp{_nbuf_rootdev_m_get_sosend_mclrefcnt_soclose_soshutdown_shutdown_ssocketaddr_piconnect_soconnect_connect_bclnlist_mpid_qs_nswdev_file_nproc_whichqs_recv_runin_inodeNINODE_sockname_rootdir_soaccept_sobind_m_free_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_soqremque_solisten_pipe_recvfrom_physmem_dmmax_sogetopt_rablock_sleep_inode_nmbclusters_buffers_boothowto_send_argdev_nfile_buf_sendmsg_ufalloc_falloc_procNPROC_runout_useracc_m_getclr_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_bind_rasize_getsockopt_setsockopt_socket_mfree_dmmin_updlock_runrun_bufpages_bufhash_socketpair_accept_splx_socreate_m_freem_maxmem_sendto_swbuf_swapdev_copyout_getf_u_mclfree_fileNFILE_proc_listen_wantin_recvmsg_panic_dumplo_sosetopt_hand_mbstat_bfreelist_nswbuf_dmtext_copyin_soreceive_curpri_splnet_sofreeb[pl$ bbb ( NV.*yx09H# 3*nN^NuNVNJg yx/HxNPN^NuNVH<*yxHna@XJ9f#HxBHyN (@gx l fp0,& @gHTNX`HHT/-0.H/aB &@g*#A$H`NfSAҵeBL<N^NuNVH8BJ gp`p/0. H/0. H"HAHABAЁ @ PNPJ9gXJg /.NXgBg HTNXJg /.NXB`2Hx Hx0. H/N -@ @ f*|`"Jg0. Uf`l`e*|dJf+n: n&h /+hNX(@+L/+h/, n/( N /.NXB&l T\f 0nJ gp`B@J f| +4SЫ"+4N-@/+HyNP-@JgB`-k0 .Ы8o ."+4N-@/. +Ю"+d/0. H/N -@ @ g/+/.NP` /./. n/( N ."+8NAЈ @ .Ѯ/.NXB +8Ѯ .m,+n: Jg nh/.NX L8N^NuNV-yx n/(a XN^NuNVBa XN^NuNVH8HnaJX-@Jf$*|`Jg0.Ugep`0.H/NXN0.H/NX-@l Jfp`Jm(mlHTNX m&h /+/+NPJ+fp`B-@/-NXBBU rN/NXJfJ/.0.H/0.H"HAHABAЁ @ PNP0.H/NXBL8N^NuNVH0 n h*h /-hHx n0H/N (@/-h/, HUN HTNX -4SЭ"-4N-@-mB`-m0 .Э8o ."-4N-@/. -Ю"-d/ n0H/N (@/./, /.N .ѮHTNX -8Ѯ .mrL0N^NuNV.NJf 9HH`lHxBHyN *@gp0-& `gp`4=mP0.Hmp`HUNX n0B*nN^NuNVHxNXN^NuNV.*yx### # $*nN^NuNVNJggHx0(BH/NPN^NuNVH0*y`F mg8Jmg2(mg&p0,& f0. H",NfUeL0N^NuNVH . fg mg, tg,`R*| `( ".lX`*| `*| ,.fJg ".f `BL N^NuNVH0(yxNJgJg#BJf$*ygHUNXB`HxBHyN *@gfp0-& g HUN`>Jg( y (f 0( m g/9NX#HUNXL0N^NuNVH8&|JgV y(h$, ,`Ԭ",<ҹ ,(NrdNo#BHy NX*yg M(h$, ,`Ԭ",<ҹ ,(NrdNn #BHy N`4HUNXB X @ Ї"@R m/9aX7@ /9aX7@ 9/aX7@'y7y7yBk 9й.g 9йй"N7@ 9й/aX7@Jg 7y`7|y-m2B9BHx/.Hx HSHUHxNJ9g/.HUNPHUNXL8N^NuNVH..BB`R * lJgR mR r ЇLN^Nu f ff}f~@fm@m@tt t@tt@tt t t ttt@t ti@tjtktltm tn totp tq@tttutv@tw tx ty tz t{@t|t}t~tAccounting resumed Accounting suspended PPP$P6P@PLP`PpPvPP?P$PPPP?PPpP~PPPPPPPdP;P8;P@;PF;Pj"P`PPfPPP6P\dP~P`PfPP AP"P6PJPp;P;PoPMP8PLPPP(;P0fP8PrPyPnP`PPfP2PZnPr`PPPP?P$PcP"PD=PVP\PdPlPtPPPPP6PP&Pf@@@PP P PP PP LP P $?P *$P TP \P dP lP P LP P AP 3P P P @ P fP P P  P @  P P B@ LP TfP ^P b P hP n@ t P gP P P P P P P P P P P P P P fP (P .P @P HP XP fP lP P P PP AP  "(.5>FPYajtztt   )0 :>GPY@bku~ >(/9B0JT[foz , ~:&H-8AH OU\dlr|Vt6  &-69ALR _grz$R N (_getmdev_nbuf_klseql_mctls_bootlmult_suser_rootdev_linesw_savacctp_desscan_printf_sysacct_bclnlist_mpid_lbolt_ntext_qs_vhangup_wmemfree_wmemall_nswdev_file_nproc_sum_whichqs_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_ttlowat_geteblk_compress_namei_hostname_tz_desfree_avefree_maxpgio_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_forceclose_maxfree_acctbuf_noproc_swdevt_gsignal_ecmap_iflush_physmem_oumount_mount_dmmax_fork1_saferss_uchar_maxslp_iunlock_umask_multprog_rablock_reboot_swptstat_inode_avefree30_buffers_boothowto_argdev_irele_update_nfile_klout_itrunc_tctls_buf_unmount_nscan_tick_procNPROC_deficit_tthiwat_runout_kltxt_dumpdev_ninode_pidhash_selwait_vfork_bcopy_zdmap_firstfree_nblkdev_bread_fctlsldivt_ilock_cdevsw_rasize_cmap_forkstat_rdwri_cmhash_getblk_xumount_smount_cnt_dmmin_updlock_klsdist_mapioctl_runrun_bufpages_bufhash_binval_minfree_sbupdate_klin_acctresume_maxmem_hz_text_swbuf_swapdev_u_bwrite_fileNFILE_proc_acctsuspend_hostid_textNTEXT_wantin_brelse_time_total_lotsfree_dumplo_vmemall_hand_ncmap_bfreelist_nswbuf_dmtext_unmount1_acctp_bdevsw_acct_profil_mpurge_curpri_iput_ecmx_mountfsb[ylց$ Jbbb,@NV 9"HAHABAЁ-@R dfBN n n1n  n1n n!nJg n .6"@ <"Q2`Hxf .6/NPJg n . "@ < "Q`Hx( . /NP n1n4JgJg(0.HH @//.HyN `HyNX0. H @/HyNP0. HJgV gN gJg$ n0(HH @/HyNPHyNXJf`B n-h-h0( H-@ n f-n-n0.-@ n fJg .Ю//.HyN `/.HyNP/.HyNP n(!-@Jg-| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -| n(!g"Hy/.HyN -|HyNX`. . @/HyNP . f .t @/HyNP` n/(T/(,/((0(BH//(DHyN n0(@//(8/(4Hy7NN^NuX_fkrz'2:CNX^fkpv}%x %s:???????? %s -> %s [%x..%x)%x@%x<%s%sSYN,%s%sACK,%s%sFIN,%s%sRST,>%s<%s> rcv_(nxt,wnd) (%x,%x) snd_(una,nxt,max) (%x,%x,%x) snd_(wl1,wl2,wnd) (%x,%x,%x) ATTACHDETACHBINDLISTENCONNECTACCEPTDISCONNECTSHUTDOWNRCVDSENDABORTCONTROLSENSERCVOOBSENDOOBSOCKADDRFASTTIMOSLOWTIMOPROTORCVPROTOSENDCLOSEDLISTENSYN_SENTSYN_RCVDESTABLISHEDCLOSE_WAITFIN_WAIT_1CLOSINGLAST_ACKFIN_WAIT_2TIME_WAITREXMTPERSISTKEEP2MSLinputoutputuserresponddrop PP( P2 P: P@PPP@@@P&@,P<@F@LP@@P@P@P*@0P<@BPb@z@@P@@@P@@@P@@@ P*@2@8PP@Z@`P@@P@P@P@@@ @@@@@ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@ $</:?GMT\gnuH "+4=FNU^fq|4t _tanames_rootdev_tcpconsdebug_tcp_debug_mclrefcnt_ipq_printf_mpid_rtnet_nswdev_tcp_alpha_runin_ip_id_tcp_debx_rawintrq_tcpstat_ipstat_nchrdev_iptime_kmapwnt_panicstr_nswap_noproc_ipintrq_physmem_tcpstates_rablock_nmbclusters_boothowto_argdev_runout_bzero_dumpdev_selwait_tcp_iss_nblkdev_rasize_mfree_updlock_runrun_routetoif_tcp_trace_prurequests_maxmem_tcb_swapdev_mclfree_tcptimers_wantin_ifnet_dumplo_hand_mbstat_rthost_tcp_beta_curprib[~l.$ bbb088NVH k mp` g -P 9P P P P 9P JP P P ]P P 9P P `KP KP _P 1P @NP R1P hP AP DP QP ,P >@P J)P dNP v1P [P UPrP/P&@,PP:P:PP,MP8DPMPDP$P_P DP<#*5;@HN`fmu( &/8DU_hu:%.4;BKSYdo|4 ")1 @IO W_ iw_tcp_input_rootdev_tcp_debug_m_get_mclrefcntffixi_ipq_printffflti_in_pcbdisconnect_mpid_rtnet_nswdev_tcp_alpha_tcp_saveti_runin_ip_idfdoublei_tcp_debx_tcp_template__insque_rawintrq_m_freefsinglei_tcpstat_ipstat_nchrdev_kmapwnt_panicstr_nswap_tcp_close_noproc_ipintrq_physmem_tcpprintfs_ip_stripoptions_sbappend_rablock_nmbclusters_boothowto_argdev_tcp_output_tcp_reass_sonewconn_runout_dumpdev_selwait_bcopy_tcp_iss_soisdisconnected_soisconnected_nblkdev_in_cksumfcmpi_rasize_in_pcbconnectieeeusedfmuli_m_adj_mfree_updlock_runrunfsubi_routetoif_tcp_trace_tcpnodelack_tcp_drop_m_pullup_m_freem_maxmem_tcp_pulloutofband_sohasoutofband_tcb_swapdevfaddi_sbdrop_mclfree__remque_tcp_canceltimers_wantin_panic_socantrcvmore_ifnet_dumplo_tcp_dooptions_soabort_hand_mbstat_rthost_tcpcksum_in_pcblookup_tcp_respondffltis_tcp_beta_curpri_sbwakeupb[l8$ bbb448NVH<*n m$(hBB -,(-@p0-@-HHЁ2,8Hd0,8H`p0-@-HHЁ.Jm0-Ho0-H.-|0-H @-@ -,Ї2,8Hҭ(d .f -0(nJg60-Hg .Ї2,8Hl r2-@dJ-fp-f0,$H2,"H2,(H4,&H’l 0,$H2,"` 0,(H2,&H-@Jo6 -PD". "HAddHABAЁ2,$HN #d0Jm@fJl8gJm fJm fBmHUaX`N-@&yg8Jk gHyNX7| SyRy #B'| `HxBNP&@/.NXfp7` '|T7|(Jg//./,DN &JfB Ы$@J fHyNXHx(HR/- N %m,%mD%j%j mlbp-f8-|-|0,$HrN l0,$HrN` < n1@ n"H3h` Jg m (Ј-@0(H-@Jg-SHxBNP&JfHSNX/.NX` S -S n1n/. n (Ј//.N n (ЈЮ-@` nBR nRh n0(f0(H-@* 鈁* n!0,$H2,"H2,(H4,&H’l 0,$H2,"` 0,(H2,&H-@0,$HrN".lBJo5n" -0,o -0,5@&5j&&* !`+m(0Jg .Ї2,8Hf*! Юg .Ї5@ 5j .(Ї/HSNP5@$J-f .gR,߭, -,To+m,T -,ToJmZf;|Z -,+@\Jm fX -,(gN -`N// 9NNN;@ m l;| m< o;|< BmZBmBm ` -(RTo -(R+@T0,gBHRHU0-H/HxN .(Ї5@|B0,g <` -$ //-HSN-@f6Jo -DЮPo -DЮ+@P-JgJ-gBL^HUNX*@`$Rm m nB -`NN;@ m l;| m< o;|< J,g*0- H2-H;@ m l;| m< nR`V0-HS @ N//0- HNNN;@ m l;| m< o;|< +m(,HUNX`J m$ h0(g, mXlZB -(S/ -DS//- HUN`BmX;|Z `:HUNX|HUNXB-` mlHxKU]e_rootdev_mclrefcntffixi_ipqfflti_tcp_timers_mpid_rtnet_nswdev_tcp_alpha_tcpexprexmtbackoff_runin_ip_idfdoublei_rawintrq_tcp_slowtimo_tcpstat_ipstat_nchrdev_kmapwnt_panicstr_nswap_tcp_close_noproc_tcp_fasttimo_ipintrq_physmem_rablock_tcp_usrreq_nmbclusters_boothowto_argdev_tcp_output_runout_dumpdev_selwait_tcp_iss_tcp_setpersist_nblkdev_rasizeieeeusedfmuli_mfree_updlock_tcp_backoff_runrun_routetoif_splx_tcpnodelack_tcp_drop_maxmem_tcb_swapdev_mclfree_tcp_canceltimers_wantin_ifnet_dumplo_hand_mbstat_rthost_tcp_respond_tcp_beta_curpri_splnetb[lЏ$ UbbbD`NVH0 n*hN-@BfJ g/NXp` g(m0,H-@`B . b@0;N$&4gN-|8g* n0(g/. BHT/.HxN/.NX .`^/.a`X-@Jf n0(g Jhf1|x n h(h`~ loHTaX(@`hHTN`/.HUNP-@JgF`BJmfBHUNP-@Jf$9|`JmfBHUNP-@Jf/.HUNP-@JfHTNX)@ JfHUNX-|7`/.NX9|9|Z)y<@)l<0)l0T)lT,)l,(HTNX-@`j n (Ј-@1| n0 n1mA .X"@"`2/.NXHTaX(@f`HTNX`/. .8/NPHTNX-@JgR 9က#B`Hx5HTNP`8-|-` nJhRf0(@f -|`v,df -|#`^ n1| n (Ј @e`@ n0(:H2(8H2(>H4(H2(>FBmHUNX*@g m m m$/(NX `;|`;|`*nN^Nutcp_usrreqNP08P6P8PBPP Pp P P0PPP=P,P,P.$PzCP$PP$PIP)P)P9P:PP$PP P8@>BPX@^@h'Pz>PKP7PPP9P "HAHABAЁ(@ @Jf  @*PgJmfp`HxHx(0. H/al Jf$`(/Hym`,g2/HyNPBp`r,g,g . fB)|B@B,Jlf>)|B@9| 9"HAHABAЁ/0. H/Hz N BL0N^NuNVH >. ,. 0"HAHABAЁ*@ g gPJ-gJHxHx@0H/ab Jf0HxHx@0H/aJ JfHxHxI0H/a2 JgB0fBHx0H/a BL N^NuNVH 0. *@N.`$Jf f@HxHUNP f* /NX;n +n+n (B$HUanXJfB`XN.`HxHUNP g/NXHUNX-@ @g HUNX .L N^NuNVH<*n0--@"HAHABAЁ$@ .&@B N-@`HxHjNP *lR* . @ P(h$J f"'M BJ.f)K.` l2!K)K2` k!M 'MJ6fHTaX/.NXL<N^NuNVH<*n`+k.&m.g(k g0,-@"HAHABAЁ$@B*Jl6BJ'l HTNX*S* mHjNX`B-| .f ,( gf 4gx 8gV Dgh+|6Hx,Hx< ,"HA HABAЁ/NP/NP%@-l-l(`+|6%|,-|`+|6%|` ,$rNo9|` ,$rNf( g/,/, NPB()l(` f ,$rNR%@ ,$rN-j".䲀fd-l f8 6g$JJg-|L+|6B-|`-|0`-|,+|6%|<`+|6 ,$rN".䲀l-|H ,$rN-@`-|I ,$rN".䒀-AHx,Hx< ."HA HABAЁ/NP/NP%@ op`B-@B0-H @  -@Hx/NP . n0 . n(刁( nJ*g n .`0,gB`p n(爁( n . @ P0( n(刁( n1n n1n+l +n @ HUNXL<N^NuNVH0*n"0-H @  (@ -gHyNXJm oHyNXHl /-a P0-H @ PJ(gHyNX0-H @ P| m|"L0N^NuNVH  @&Pg2J.g, +"g  @ PJ(f xJf B`.R`  @  -@*k.(m fHyNX0,. mHyNX "HAHABAЁ$@ . @5P*g f5l` n0(",5AHx/.NP n0  @ P|   @ P| k|B  @ PJ(g .R o8HyNX"*+6f$0+H/HyNPp`vSn` f*g*g*gz%|B@p*-@ f| f *gBJg g g f>HTaXz5lB6"`RJ Jl0RHSNX`0 gJo g/./,$/Hy4N` S b@0;N~`R`f fV ,( gD 4g< Hg Ig pg qg` ,Ѫ` ,`B` ,$rN%@` HyRNX`L[l8 ./HyYNP)|B@N.a/NX 6fN. -"f|J+fv||A $HHxHRNP4( . @ P0(,* 刁* m|"/NX 9"HAHABAЁ//.Hz~N L PVPWP@@ PHzPnPVPTP\GP[PR[Pp[P[PnP?PKPnP2?P>KPlWPVP[P[PVP@@@@@ @$@(@4@8WP<@@IP *&/7>GMV^gq{0tt   (1:@CJS [enyx$-8@IPW]bkrzJ0H &,6>HRtW^gpyt (08>GNdV<^g$ny\>_nbuf_klseql_tmstrategy_ctmbuf_rootdev_linesw_rmget_desscan_imax_uprintf_printf_tmclose_mbbufmem_bclnlist_mpid_lbolt_rmalloc_swapmap_tmtimer_nswdev_file_tmread_sum_mbmemmap_avenrun_hostnamelen_runin_freemem_blkclr_rate_tmdump_pokec_tmgo_hostname_tz_desfree_avefree_maxpgio_bswlist_tm_mb_nchrdev_tmintr_boottime_kmapwnt_buffermap_panicstr_nswap_maxfree_geterror_noproc_imin_swdevt_ecmap_physmem_biodone_dmmax_saferss_maxslp_multprog_rablock_sleep_swptstat_tmaddrs_rtmbuf_avefree30_buffers_boothowto_argdev_tmwrite_nfile_klout_spl3_buf_tmcinfo_nscan_physio_tmphys_tick_deficit_runout_kltxt_bzero_tmioctl_dumpdev_tmattach_selwait_mt_softc_tmdinfo_zdmap_firstfree_nblkdevldivt_mbgo_cdevsw_rasize_c68t86DiagRet_cmap_forkstat_cmhash_nswapmap_tmdriver_cnt_dmmin_tmprobe_updlock_klsdist_runrun_bufpages_bufhash_minphys_iopbs_minfree_mttotm_tmslave_splx_cpu_wakeup_klin_tmscp_maxmem_mtutab_hz_argmap_swbuf_swapdev_mbdone_fileNFILE_physmbmem_hostid_wantin_time_tmstart_panic_tmdone_tminit_iopbmap_total_kernelmap_lotsfree_dumplo_tmseteof_hand_ncmap_bfreelist_tmopen_dmtext_nswbuf_tmcommand_mbbufmap_mbmap_bdevsw_timeout_curpri_ecmxb[lp$ +bbbLT\  DhhNVH0A *H(yPBR |-P-hp0-B f#T`-HfAH`A|+H< . gnp gn gn gln g`NHU/.Ba T /-S"<-A . m (6Ю ".m@ .m n (:Ю".m" .m n (>Ю".l .rN n"( Ё-@/./NP-@ n/(L0(@/NP=@p0./ n// n/Hy3N .rN/ n0(@r / y NPH-@/.HyYNP` /././. /.HybN-n n/( /(/(/HyN n/(/(/(/(HyN . -@ n/( /(/(/HyN n/(/(/(/(HyN/.NXL0N^Nu!'-6<BHRW]dju $.AEPWbfjo"'3:CKS^fpz (-2=BGNY`it}!(/8CIOV_fnx&,?R\fytraplofaultUSER ADDRESS ERROR%s: Command aborted code %x USER PRIVILEGED INSTRUCTIONUSER ILLEGAL INSTRUCTIONUSER BUS ERRORsyscall%d: 0x%x%s(%s%x, syscall: error=%d Begin traceback...fp = %x, sp = %x FP loop at %xEnd traceback... Called from %x, fp=%x, args=%x %x %x %x %s: %s trap type %d, pid %d, pc = %x, sr = %x, context = %x Bus Error caused by %s exception function code %x, access address %x segment entry %x, page entry %x pagefault, pmp %x, pte %x %x hpte %x hseg %x bad addr, v %d tss %d dss %d sss %d D0-D3 %x %x %x %x D4-D7 %x %x %x %x A0-A3 %x %x %x %x A4-A7 %x %x %x %x indirexitforkreadwriteopencloseold waitold creatold linkunlinkexecvchdirold timemknodchmodchownold breakstatlseekgetpidmountold umountold setuidgetuidold stimeptraceold alarmfstatold pauseold utimeold sttyold gttyaccessold niceold ftimesyncold kill#38 -- 4.1a selectold setpgrplstatduppipeold timesold profil - nosys#45old setgidgetgidold signal#49#50acctold phys - nosysold lock - nosysioctlrebootold mpx - nosyssymlinkreadlinkexecveumaskchroot#62#63getpagesizemremapvforkold vread - readold vwrite - writesbrksstkmmapold vadvisemunmapmprotectmadvisevhangupold vlimitmincoregetgroupssetgroupsgetpgrpsetpgrpsetitimer#84old swapongetitimergethostnamesethostnamegetdtablesizedup2getdoptwrapselectsetdoptfsyncsetprioritysocketconnectacceptgetprioritysendrecvsocketaddrbind#105listenold vtimessigvecsigblocksigsetmasksigpausesigstackrecvmsgsendmsg#115gettimeofdaygetrusage#118resubareadvwritevsettimeofdayfchownfchmodrecvfromsetreuidsetregidrenametruncateftruncateflockportalsendtoshutdownsocketpairmkdirrmdirutimesgetdproprevokeunmountgethostidsethostidgetrlimitsetrlimitkillpg#147Vector 0Vector 4Bus errorAddress errorIllegal instructionDivide by zeroChk instructionTrapv instructionPriviledge violationTrace1010 emulator trap1111 emulator trapVector 30Vector 34Stack format errorUnitialized interruptVector 40Vector 44Vector 48Vector 4cVector 50Vector 54Vector 58Vector 5cSpurious interruptHP9P HPFHP'P5P@QP@QPHP P4@PHPlPvP~PP@7P>PPP )P$)P4HP:@@PN@fHPx@HPPDP@HP1PHPHPMP$HP4@PJHP\PP8\PDP hHP z@ P P @ P P @ P Z@ `P nHP 5P B P bWP @ P 5P @ P @ P @ P 6@ <P f@ lP @ P AP@@@ @@@@@ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@ & -3:>EMTtYaju~t  %b.6<BMV\gox~ DH t  !)/7;DGNT\djrz$ _rootdev_usetup_printf_uprintf_nosys_mpid_lbolt_qs_swtch_nswdev_nproc_sum_vtopte_whichqs_pagefault_nofault_avenrun_hostnamelen_runin_rate_hostname_tz_nchrdev_setjmp_boottime_kmapwnt_panicstr_nswap_noproc_longjmp_physmem_dmmax_scb_rablock_boothowto_setrq_syscall_argdev_spl6_spl7_trap_type_fusword_tick_procNPROC_runout_dumpdev_pidhash_selwait_traceback_astoff_zdmap_nblkdev_putcharldivt_rasize_psignalDiagRet_cnt_dmmin_updlock_runrun_showregs_issig_sirmask_traceoff_splx_cpu_sysent_grow_maxmem_hz_swapdev_u_dorti_proc_hostid_syscalltrace_addupc_wantin_time_aston_panic_total_dumplo_syscallnames_hand_dmtext_cvtopag_trap_copyin_fuword_nsysent_psig_curprib[l4$ /bbb`hp NV | L .L"@"#h#h3h N^NuNV.*nN-@`4 ->g.J$g(HU m$NX@>HxHmNPJfHxHUaP/.NX*nN^NuNVH *nN. . gHm NXJlHUNX . gXHmNX>/. HU0-8H"HA((HABAЁ @ PNPHmNXJl . g"HUNXJlB-DB-IB-J>/NXL N^NuNVH *n Э . oHxHUaP> m(Hm-QHH/NPJf>HUaBXL N^NuNV.*nfHy \NX>HUa X*nN^NuNVH *nN. ->!fJ$g HU m$NX/NXL N^NuNVH *n0-8H-@ . t}g"n tgn tg nt trft -Efl yP0(&mBg\fT ( fH g< g0Hx0(&H/NPHxHyNP` tg . t gn tgn tgn| tgn trg&/././. HUN` tg$n tf` tvf` t gn( tgn t~f\` t fN` tugn< tf2`-EHH n B`T n.Bmp`` >` n-PN-@ -: f . gHUa`x -:".gb .gFHm HUNP-U-m-mA *+h+hA+P +h+h` :HUaX t f+n:` .: -: g>HUaVX/.NX`" n-P -: gHUa<` :HUa>X`j -:".FgP .fHm HUNP-U-m-mA *+h+hA+P +h+h -: gL`8 n :`lHx/.HmLN `RHxHmL/.`>`8 n.Jf~`/HUaP`HUarX`N-@ ->f>BHU0-8H"HA((HABAЁ @ PNP`N-@ ->f -:g`>:`DJyg 9Ȱgp `HU nHH/-EH( @ PN`" tg ` tgn tg`v tg`h @fgn( tng>n tg`B tog`4 @tgRn @tg` @tgD` L N^NuNVB n (: g/aX n-h (:"g Ѯ .N^NuNVH 0. H$HB((HBBBЂ @$0. "HAZZHABAЁԀ*BN-@ . g g*`n m( Rf>`VJ(f+yP(`F-H , @0H"-oFJ,g m, Rf >`+yP,/.NXB`HUaX-@Jo/.NXpL N^NuNVH0*n (yP;n 8Jl&f #3 JmBf;l(B9mB&>> -EgHUaXBL0N^NuNV.*nJ-EgHUaXB-E`BmBHUaXB>*nN^NuNVH *n:>-U-m-mBB+m`HU/a$PHnNX.l>L N^NuNVH ..*n ,-:  gHUazXR gHUa~X  gb o8HxHUaP -:@g ->g-P-Qg`HU/NPJmHUaXHU/a>` ->f ->g> -Ef-YHHf& -:gHUHy daJP>`L-WHHf@ -:f4HxHUaPHU/aP Э gHUaX:` -THHf8 -:f HxHUaZPHU/a\PHx0-BH/N`-QHHf\ ->f>>BHU0-8H"HA((HABAЁ @ PNP`x-PHHgX`f-PHHg@-NHHg -OHHf: -:f HxHUaPHU/aP-NHHfp`p/`( gX o:-H @0H"-l -EfHUHxa`HU/NPJl` ->g2-LHHg -MHHfHUHUNX/a P-LHHfJgBHUHUNX/a `*-MHHfh -:g(-IHH"fJg>HUHUNX/a P`HU/alPHUHx a`PHUNXJnB-I>` -Ef-XHHfnJgHUNX. g fHU/a PJf`nHU/a PJg^HUNX. g fHU/N`2-VHHf HUa X` Э m -EgP`HU/NPJmHU/aPJgB-IHm HUNPHUaX`-IR-IJfmFJ> \f> ->g>HUHx/aP-FHH-@HU/a P-RHHfV -:gH-FHH op` -FHH-@JoHUHxa*PS`>:HUaXL N^NuNVH0..*n -: g2 -:gp`Hm/NPJg `R` f -:g fp -: f^-Fr. -:f0N*Hm/Hy gN ߹/NX-FJfPp `JR -:gj(| pJg&HHfHUHx\aPJl*,HH. Am ZnHUHx\aPJm` am zn f -:gHUHx aPJl ~f -:g~` -:fHm/NPJfAF(H  @HH,B ? b@0;N\JgS`~ -:, f Jg&HxHHV/NP.` f~B`: -:r , fHHr. lBRJg -:fHm /NP`x -:@g~` -:r , f ~`h~ `b g fPHH-@mB l6HmHxNPR`L0N^NuNVH0*nB ->fp` yP0(&mBg g g ( fHx0(&H/NPHxHyNP`n ->g -> g/.NXB`HxHUNP/.NXN-@ -: gHUa X/.NXg,,-:  gPN-@Jol/NXJfJg n Jg/HUNX/NP-@` g `A (@N-@Jn, ->g -> g/.NXp#`/.NX-|`& g f~ g< n4 ->gn  @Jg  @HH.> -Efh-UHHf\Hx0-BH/NPJgHxHyNP`h Am Zn ` \f>`Z-RHHf gT/. /NP-@Jf6 n Jg, fHU/avPJfBHTNX.l> ->g2 3l*Hm-PHH/NPJf>HUaxX .L0N^NuNVpH8*n(n ->fp`-H @0H-@-lB`ff -:@g| yP ( fj g^ gRHx0(&H/NPHxHyNP yP0(&mBg`SPJlHy {NXJo T.(Jg do~dA&HHTHx/HSN-@Jf -nD -:f -:gJoHH*B-IHU/a0P*lHS -oN-@Jg T Tߨ߬ -n0/.NX` HUaXHxHyNP`Hx?HyHS/N",JfHB-IHUHH/aPJmHUadXHxHyNPJo -: g,B-IHm/HSN -@-FƞݹJoHUaXHxHyNP -:f -o`RS -:f -oh`HUaX .`BHUaX -> g ,fp#` B`@>HxHmNP`L8pN^NuNVH0..*n -:g: -:gZJ-If HUaX` g fHxHUa`l  @ b@0;N00@00 -:g Am ZoHx` -:f`-IHHm^N-@-FHH, >:mJF(m`HUHH/aPHTHUNP(@f:>/.NX-FHH-F o|SmbHUHxaP`Hy NX`D -:g& ->fHUHx\aP>HU/` HU-LHH/aPS-IL0N^NuNVH0*n -:g < ` < (@` HUHTa6PS lL0N^NuNVH0*n -VgHU-VHH/aPHUHx a PN-@(m`HUHH/alPHTHm NP(@f(m`HUHH/a@PHTHUNP(@f>/.NXmIB-JL0N^NuNVH ..*n -> f: -:g -: gHU/` f -:g~ -:gh  n g f  f8HUHx^aP f~?` -:g``@ -:g Am Zn HU /aPL N^NuNVH ..*n g,-RHHg -SHHg f -:gp`BL N^NuNVH0*n(n `HTHH/aPfL0N^NuNV nJ(g, (>//((NP n> nB(/.NXN^Nu|`{}~ABCDEFGHIJKLMNOPQRSTUVWXYZddddddd22xxx}}}}ttrstrt^ ({)}!|^~'`ttwritettyrub @:7Pr/PXP8P_PZPZPKP0_PJ_PlXPP@iP*7PPXPbPbPbPbP(P P/PlmP sP7P6PbPxXP7PPXP7PFNPXP6NPFP7P8KPJ7PbPbPPKP7P EP 4bP J@ hEP |bP XP XP bP bP bP _P PP RP @ ^(P KP N@ P }P }P&}PP_P}P}PP(PNNPrP?P7P@WP?PXP?P0@P@nPPXPbPbPbP(P P/PXP"/P.XP67PXXP`bPx7PXP_PP7P XPXPd@r@(P P/PPV_PP@bPbP.bP:bPN(PZ P`/PhbP@iPJP"7PRXPj Pp/P~@xP P/PWP ?P" P(/P/P:@7PVPXPJ@PiP@@"7PFVPpVPXP`=PZP .(08@E $OY_fqu~ , @#.8?G ZPXajqz L| & /7@H~QZaHhqny  %,58ALRZbhow}`\< @'_nbuf_flushtty_wflushtty_rootdev_passuc_linesw_maptab_max_ttyclose_bclnlist_mpid_lbolt_ttyretype_qs_cp_time_nswdev_file_nproc_whichqs_avenrun_hostnamelen_runin_inodeNINODE_rootdir_putc_ttlowat_hostname_dk_time_ttstart_tz_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_ttypend_swdevt_gsignal_physmem_dmmax_ttyecho_ttydefaults_ttyblock_rablock_sleep_ttyopen_inode_buffers_boothowto_dk_xfer_argdev_nfile_spl5_spl6_buf_dk_seek_ttbreakc_tick_selwakeup_procNPROC_tk_nout_tthiwat_runout_dumpdev_ninode_pidhash_selwait_bcopy_zdmap_nblkdev_ttread_uiomove_cdevsw_rasize_dmmin_catq_updlock_tk_nin_runrun_bufpages_ttyout_bufhash_ttrstrt_nextc_b_to_q_splx_partab_wakeup_maxmem_ttyrub_ttyinput_hz_getc_swbuf_swapdev_u_ttwrite_fileNFILE_proc_hostid_wantin_time_panic_dumplo_hand_bfreelist_ottioctl_ttioctl_nswbuf_dmtext_dk_busy_ttnread_nldisp_bdevsw_ttyoutput_ttselect_ttyrubo_scanc_ttychars_dk_mspw_curpri_ttwakeup_unputc_dk_wdsb[lB$ TbbbdxhNVH0*n -Efp`.HxNX(@HxHUNP*+l BB BL0N^NuNVH *nN.HUNXJg/NXB`HyNXBBB B-E/NXL N^NuNVH *n ->fp`jN.` -EfHxHUNPJ g/NX -Ef/. B/- U/( N-@ U+h BB .L N^NuNVH ..*n J f4 mRR g f+| HUNXL N^NuNV . tf( . tg @tg @tg @tgp`pN^Nubkclose: no buf P.P^$Ph9PvBP@P8P$PP8P0P9P B&.6@FJRX_ho| @P"*17<G PX`iq~zH'/7=HPX`h_nbuf_flushtty_bkinput_rootdev_linesw_printf_bclnlist_mpid_qs_nswdev_file_nproc_whichqs_runin_inodeNINODE_rootdir_ttlowat_geteblk_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_bkclose_noproc_swdevt_physmem_dmmax_rablock_sleep_inode_buffers_boothowto_argdev_nfile_spl5_buf_procNPROC_tthiwat_runout_bkopen_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_uiomove_cdevsw_rasize_dmmin_updlock_runrun_bufpages_bufhash_splx_wakeup_bkread_maxmem_bkioctl_swbuf_swapdev_fileNFILE_proc_wantin_brelse_dumplo_hand_bfreelist_nswbuf_dmtext_bdevsw_curprib[lu$ 'bbbZPP#P 0P5P,PPP P$P(P,P0*P40P8-P<P@PDPH PLPPPTPX#P\0P`5Pd,PhPlPp PtPxP|PPPPPPPPPPPPPPPPPPP $.8>FM V_@hqz  &/7?GPXbks{_nbuf_bkinput_rootdev_linesw_ttyclose_bclnlist_mpid_nswdev_runin_ttlowat_ttstart_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_bkclose_noproc_swdevt_nulldev_physmem_rablock_ttyopen_buffers_boothowto_nodev_argdev_buf_tthiwat_runout_bkopen_dumpdev_selwait_nblkdev_ttread_cdevsw_rasize_updlock_runrun_bufpages_bufhash_bkread_maxmem_ttyinput_bkioctl_swbuf_swapdev_ttwrite_wantin_dumplo_hand_bfreelist_nullioctl_nswbuf_nldisp_bdevsw_curprib[l~$ bbblt  `NV.0.  mp`0. "HAZZHABAЁ*@ ->f@HUNXB:J$g> ->f0>HxHUNP` ->gJygp`"HU0. H/-EH( @ PNP*nN^NuNV.0. "HAZZHABAЁ*@HU-EH( @ PNXHUNX*nN^NuNVH00. "HAZZHABAЁ*@0. "HAHABAЁ(@B  fj` yP0(&mBg^ g g ( gp`Hx yP0(&H/NPHxHyNPgJf$ -> gp#`HxHUNP`^ o, n Jo"/HUNX/NPJl-| f HUNXJg*`ZJ$g"/. HU-EH( @ PNP-@HmNXJ g //, NPB  .L0N^NuNV.0. "HAZZHABAЁ*@J$fp`/. HU-EH( @ PNP*nN^NuNV. n0(8"HAHABAЁ*@ n (>f g+|/.a X*nN^NuNV n0(8"HAHABAЁ-@ @Jg* @ //(NP nB n ./NXN^NuNV.0.  mp`0. "HAZZHABAЁ*@J$gp`Z+|,$ ->g HUNX>0. "HAHABAЁ-@ @B nBB*nN^NuNV.0. "HAZZHABAЁ*@ ->gHx0-BH/NP>HxHUNPB$*nN^NuNV.0. "HAZZHABAЁ*@B ->fp`N0. "HAHABAЁ-@ @ gfJg(/. /(NP-@Jf nBB`/. BNP-@`$ n gp#`HxHmNPJg ->fJg. n Jo$/HmNX/NPJl-|-H @0H"-nJ ->@g>HmNXJ,g$ ->//-,NPB,> .*nN^NuNV.*n0-8"HAHABAЁ-@J f-| @` n n . HUaxX*nN^NuNV.0. "HAZZHABAЁ*@0. "HAHABAЁ-@ ->fp`N-@ . g gf/.NXB`Jg ->f/.NX` n-hg n Rf n` n!yP` n  gJg-h g n Rf n`f n!yP `V*nN^NuNV|H<0. "HAZZHABAЁ*@B0. "HAHABAЁ-@B ->fp` n Jg4$PJf4S n P n JlHy NX n Jf .`J dl *`pd.A(H/. Hx/HTN-@Jf Ї&@`H n g* Ѫ n Ѩ n `HxHmNP n  gVJfHU/HTN HUBNPHUNXB`HUHH/-EH( @ PNPRdJ-Dg mHUNX -> gb Ѫ n Ѩ n Jf|p#L<|N^NuNVH00. "HAZZHABAЁ*@0. "HAHABAЁ(@0. H"HA((HABAЁ @  f . f~gl tpg" t gt tig.`z -Pfp` nJg`B` nJg `HxHUNP` nJg``HmNXJl0. H//./. HUN-@Jl-| -QgRB-@ @gJg< `Jf@HUaX .L0N^Nuptcwrite<1PRUP%PHPP1PPPL1PpPHPHPHPHP!PP%PHP%P6FP@LP^FPPCP+P1PPTPP+PCPF1PX@nCPP1P!PPH1PPLPLP%P&FP0LPPP|CP+PPJ1PnP)PAPAP3PHP,3PHHP1PP@OP 46P %P ?P P CP P CP 1P P 7P @ PP vFP RP  )1;AHL,V^ekt}  $& $-4=DOW^dju  ^ @~HZ$&/5@HPTZcflw_flushtty_ptcopen_ptsopen_rootdev_linesw_ttyclose_mpid_lbolt_qs_ptsstart_nswdev_nproc_file_whichqs_avenrun_hostnamelen_runin_putc_ttlowat_hostname_tz_ptcread_ptsread_pt_ioctl_nchrdev_boottime_kmapwnt_panicstr_nswap_ptcclose_ptsclose_noproc_swdevt_gsignal_physmem_dmmax_rablock_sleep_boothowto_argdev_nfile_spl5_tick_selwakeup_procNPROC_tthiwat_runout_ptyioctl_dumpdev_pt_tty_pidhash_selwait_zdmap_nblkdev_uiomove_cdevsw_rasize_ptsstop_dmmin_updlock_runrun_ptcwrite_ptswrite_b_to_q_ptcselect_splx_ptcwakeup_wakeup_maxmem_hz_getc_swapdev_u_proc_fileNFILE_hostid_ureadc_wantin_time_panic_dumplo_hand_ttioctl_dmtext_bdevsw_ttychars_curprib[l$ fbbbxhNVH0*nN,Jn~BB+m` m.RSn: -S(@ (@BB(#J9f>`P -fD(m X+@(#J9gHyNXB9/NX L0N^NuNVH8*n(n JoN.Jo|-LRSg\ mRSnz -S&@ &@B+m&#J9gHyNXB9/NX `rBB+m/NXB`X -ff&m X+@&#J9g4HyNXB9`L8N^NuNVH8*nN-@Jn D./.NX `H -. l.J g(m&LǹdHH g. `R`L8N^NuNVH0*n.. N,JoJoJg -(@ -Sf-m`  -@ .-@mB X+@(#J9gHyNXB9`r߭Jn2(#J9gHyNXB9Jn B+mB/NXL0N^NuNVH8*n N.&mgJl:(yf/NXp`f#BA&H+K`2 f(A(H(g(T#BA&H R+K/NXBL8N^NuNVH8*n.. JnB`*N, n(hgJlf&yg\#BA(H n!L`6 f(A&H&g"&S#BA(HSJf n!L  nѐ/NX L8N^NuNVH0*n(n JgRg f ,X` `BL0N^NuNVH0*nN,Jn~`S mHH.Sn0(m (@B+m(#`d - fR -+@(m (@`(T f-LA +H(T(# nB/NX L0N^NuNV.` /. /a\P/.aX.l..N^NuNVH *n lp`"BHUaXAR m0.HL N^NuNVH *n N.Jf/NXp`4=n BHUAHH/aPR m/NXBL N^NuP\7Pb7Pl-PrP7P7P-PPP.PP,PP>7PD7PN-PTP\Pb.PjPr,P,P7P7P-PPP.PP P",PP7P7P-PPP.P$P87P>7PH-PNPVP\.PdP|,PP7P,P7P-P7P7P-P*,PZPv7P7P-P7P7P-P,PRP7P7P-P7P7P-P,PP7P,P,P #-3;BH QW@`ir}~  &, 2;CKU^e<msJD_nbuf_q_to_b_rootdev_linesw_bclnlist_mpid_nswdev_runin_putc_ttlowat_putw_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_rablock_cwaiting_buffers_boothowto_argdev_spl5_buf_ndflush_tthiwat_runout_dumpdev_selwait_nblkdev_cdevsw_rasize_ndqb_catq_updlock_nclist_runrun_bufpages_bufhash_nextc_b_to_q_splx_cfreecount_wakeup_maxmem_getc_swbuf_swapdev_wantin_getw_dumplo_hand_cfreelist_bfreelist_nswbuf_bdevsw_curpri_unputc_cfreeb[l$ ybbbv@NVJfp`>/. 09H/09H"HA((HABAЁ @ PNPN^NuNVJfp`>/. 09H/09H"HA((HABAЁ @ PNPN^NuNVJfp`>/. 09H/09H"HA((HABAЁ @ PNPN^NuNV tq fBBy yPBh&B`TJfp`H/././. 09H/09H"HA((HABAЁ @ PNN^NuNVJf B`>/. 09H/09H"HA((HABAЁ @ PNPN^Nu(P(P (PBPX(Ph(Pr(PP(P(P(PP(P (P(P (P8(PB(PdP|(P(P(P(PP #'/6?F ORW`isz ~H %.v8@IRU[ckqy_syopen_rootdev_linesw_mpid_qs_nswdev_nproc_whichqs_runin_ttlowat_syread_nchrdev_kmapwnt_panicstr_nswap_noproc_swdevt_physmem_dmmax_rablock_boothowto_argdev_procNPROC_tthiwat_runout_dumpdev_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_dmmin_updlock_runrun_sywrite_syselect_maxmem_syioctl_swapdev_u_proc_wantin_dumplo_hand_dmtext_bdevsw_curprib[lā$ bbb|\8NV. . tg0n t~gFn tvgn f~gp`Hx .N//.N B`Hx/. .N/`*nN-@ n (: f0- f t f/.N` n (:2-g0-gf  //NP n-P-h-h . @"n"#h#hA . "@"#h#h` n :/.NX nUG nmH nmL nmM n:0-H n: n (: g>/.NX/.NX`*n nG nhH nhL nhM n (:;@`N nJg n >`6 n>`&Hx .T`Hx/. .T` n rF n:` n: n r n:` n (:r n ` n  n1@B` n0(BH` t}g`` t gn tg`H t g~`: @tgn& @twgn tug` @t|gn` @ttgn @tg`*nN^NuX5P)PP;P`UPPAP &06=AJRX_hq~  @ %.5>IRZaglu{ ~H#)15<EPV^fltz_nbuf_wflushtty_rootdev_linesw_bclnlist_mpid_lbolt_qs_cp_time_nswdev_file_nproc_whichqs_avenrun_hostnamelen_runin_inodeNINODE_rootdir_ttlowat_hostname_dk_time_ttstart_tz_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_dmmax_rablock_inode_buffers_boothowto_dk_xfer_argdev_nfile_spl5_buf_dk_seek_tick_procNPROC_tk_nout_tthiwat_runout_dumpdev_ninode_pidhash_selwait_bcopy_zdmap_nblkdev_cdevsw_rasize_dmmin_catq_updlock_tk_nin_runrun_bufpages_bufhash_splx_maxmem_hz_swbuf_swapdev_fileNFILE_proc_hostid_wantin_time_dumplo_hand_bfreelist_ottioctl_nswbuf_dmtext_dk_busy_bdevsw_dk_mspw_curpri_ttwakeup_dk_wdsb[lѦ$ bbb,NV##N^NuNVH8&n |b klHxHSNP&@Jf R`x Ы*@ c BHUNPp0--@0-Hg0-H".o^R`JB*B-;n ./HSNP;@gFRp0-/HyNPHSN`0-H/HSNPJfHxp0-//-p0-//- HyN(@f&/-NXJgHxHxHUN `X3A #kHSHy ,"/N Jg8 ,"/NXL8N^NuNV n-h/NX/.NXN^NuNVJmn nd . b@0;NNNNNN`< . -@Hz . @//.HyNN^NuNVH8B*n ` 0-Hހ*UfHxBNP*@f/. NXp7`+|`;|* Э(@B(B,| P9@ . @)P . @)P n9h n9h9l Bl /HUNP9@ 9@| n&h0+/0+g <`B/BHUNL8N^NuNV n-hBJfJ g-|`@0;N$j`JfHy/.NP-@JfHxHx/.N -@Jgf`bJf -|9`P/.NX`@/./.NP-@`(-|-` nJ g -|8`/./.NP-@Jf/.N` nJ gz/NX/.N`x/.N`jJg4 . @-P nJ f|/./NP-@Jg`r nJ g/./.a.P-@BJgJ/.NXA ."@"`*/.NX/.N`H/./.NPJg /.NX .` . cHyN`N^Nuudp cksum %x udp_usrreq P P P PB)PPPrPP PP@P*P "P(P8 P>3PVPl2Pz@@@'P5PPPTPj PpPP*PH P&PP P4P4Pb PvP!PPPP-P(!PfP P6PP*P@,P #5<HV _fp4u| &1@RHYcm|  +8BJ_m_get_mclrefcnt_ipq_printf_in_pcbdisconnect_rtnet_in_pcbbind_udp_ctlinput_udpstat_ip_id_rawintrq_udb_in_pcbdetach_udp_init_in_setsockaddr_ipstat_ipintrq_dmmax_ip_stripoptions_udp_in_in_pcbnotify_udp_usrreq_nmbclusters_ip_output_udp_output_inetctlerrmap_soreserve_udp_input_soisconnected_soisdisconnected_zdmap_in_lnaof_in_cksum_in_pcbconnect_m_adj_mfree_udp_abort_dmmin_routetoif_sbappendaddr_udpcksum_m_pullup_m_freem_mclfree_panic_socantsendmore_ifnet_mbstat_dmtext_rthost_icmp_error_in_pcblookup_in_pcballoc_sbwakeup_sofreeb[lE$ .bbb |NVH8*n(m .0b ,LFg2Hl/./,00- H/Hy|NHyNX .0fJgJyg*$, ,`Ԭ ,(",NHykNX . ",N-@/././. /HUaT-@Jgv/. .",d/0- H/N &@ gHSNX`@/.HSNPJg ./ + Ю/NP ` .$mBHzP/././.HUa-@Jo/. . ",d/0- H/N $@ gHR`V/. .",d/0- H/N &@/./+ /* N ./ + Ю/NPHRNX/./. HUa ` HyHTaPHlHyNPBL<N^NuNVH8*n(mJg ,,",N". eB . ",N-@Hz :/./. /HUa\-@Jgl//-0- H/N &@fB/.HSa ``Jk&g.Hl/+p0+&/HyNHyNX `*HyHTaPHlHyNPBL8N^NuNV.*n -"-,N-@-mBB` ."-pAЈ @ "-lF®Ё @ l` ."-pAЈ @ "-lF®Ё @ (m0-n ."-pAЈ @ "-lF®Ё @-PR .,md -".N*nN^NuNVH  n*h ."-\NJg .SЮ @Jf l, n ("-N-@ -".NЭ8`X -"-,N-@ -R-@`< ."-pAЈ @ "-lF®Ё @ (m+n`R .,mB`4 ."-pAЈ @ "-lF®Ё @ (lR .oB` .SЮ @ Э8-@ .Xo" -X"-`".XҮ AАf`J@gZ -@"-DN"-N$ -|"HAHABAЁ" N"-8SЁ"-8N"-8NѮ .L N^NuNV.-n n*h/././. / nN-@Jg .`-|`T .Ѯ . ,m -, /.B/. /. nN-@Jf ."HAHABAЁ-@ .,m .T"-,N-@ -|`8/.B/. /. nN-@JfRR . ,fB R .,mB*nN^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @ ."( lB`< ."-T-@ -LF-@ .ЮS"-8N".n/- -". N$"-F® -NԀԭ -d/ n0( H/N (@&l f UgHTNX`P'y ."-N-@ ."-T-@`< .ЮrNAЈ @ .ЮrNrāgR .m-n`< .ЮrNAЈ @ .ЮrNrāgR -8".m ."-T".A4҈ AS .gA4 .R ."-T-@`f .ЮrNtF .ЮrNAЈ @S$S . "-pAЈ @ "-lF® Ё @S R .mR-HTNX .L8N^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @Jf .0fB`/- -". N$"-F® -NԀԭ -d/ n0( H/N (@&l f Ug HTNX`Jf .0gx'y .0f&/.HSHUa -@HTNX .` ."-T-@-@`A4 .JfR .8m .8fJgf/.HSHUa -@"-N-@..`, .ЇrNt .ЇrNAЈ @R8m -8.߫$߭ . "-pAЈ @ "-lF® Ё @ߨ R-A4 R`/./.HSHUa -@Jm2B`. .ЇrNtF .ЇrNAЈ @Rm .$ . . "-pAЈ @ "-lF® Ё @ . R-A4 .S .gA4 .RHTNX . "-NЮL8N^NuNVH0*n(n Jf -l(`8 -8SF ."-N-@"-`/HlHUN Jg -n` ."-|N"-N-@AT .JgJXf( -".N"-|SЁ"-|N-@`A .-H ."-|N"-N"-N-@.` Ю @JPn R m fB` Ю @JPnRm Ю @JPo ."-XN-@ ."-N"-|$-`N-@A\ .  Pf(Hm//.Hy%NHy@NXA\ . 0H. .Ї/HlHUN Jg .Ї"-`-@`zA`-@Jo <".nށ`Hm//.HyaNHy|NX/-8/.HTHUa -@JlB`)n( ."-`/HlHUN SS , "-pAЈ @ "-lF¬ Ё @S ."-|N"-N-@A .$ ."-|N"-N"-NԀ BSPAT .SR- , "-NЮL0N^NuNVH8 n*h . "-pAЈ @ "-lF® Ё @Jg/- -". N$"-F® -NԀԭ -d/ n0( H/N (@&l f UfxJ gz'yJg ."-N-@rNAЈ @HH .rNrāf .rNt .rNAЈ @S S . "-pAЈ @ "-lF® Ё @SR- . @f0RR . "-pAЈ @ "-lF® Ё @RHTNX . "-NЮ`p-k0B`NR .mB .rNAЈ @HH .rNrāf 'n0`R .mHTNXBL8N^NuNVH<*n(m .0b ,LFg2Hl/./,00- H/HyNHyNX . ",N-@/. HTNPJg/-/. HyN `/, ,".N$",F® ,NԀԬ ,d/0- H/N $@&j f Ug HRN`'y . ",N-@ .0f . ",`/HkHTN Jg.Hl/. 0- H/HyNHyNX . ",`/HkHTN RR .",pAЈ @ ",lF®Ё @R . ",|N",N.A $ . `\ . ",8N". -A rNAЈ @ .rNp8"<ā-BHxHk4/HTN .",T-@B` . ЇrNAЈ @ . ЇrNrāg2Hl . Ї/0- H/Hy)NHyJNX . ЇrNt . ЇrNAЈ @Rmh߫$߬ .",pAЈ @ ",lF®Ё @ߨ .rNAЈ @ .rNp8"<ā-BHxHk4/HTN .",`/HkHTN Jg ,8$ ,8 .",pAЈ @ ",lF®Ё @ ,8 RR .",pAЈ @ ",lF®Ё @R .",|N",N.A $ .",|N",N",NԀ BRPAT RR,HRNXLHm/.HyN HyNXpL0N^NuNV/. ./HyN N^Nudev = 0x%x, bsize = %d, size = %d, fs = %s alloc: bad sizefile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s realloccg: bad sizedev = 0x%x, bsize = %d, bprev = %d, fs = %s realloccg: bad bprevfile system full %s: write failed, file system is full mode = 0%o, inum = %d, fs = %s ialloc: dup allocout of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s alloccgblk: cyl groups corruptedpos = %d, i = %d, fs = %s alloccgblk: can't find blk in cyldev = 0x%x, bsize = %d, size = %d, fs = %s free: bad sizebad block %d, ino %d dev = 0x%x, block = %d, fs = %s free: freeing free blockdev = 0x%x, block = %d, fs = %s free: freeing free fragdev = 0x%x, ino = %d, fs = %s ifree: rangedev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebno = %d, fs = %s alloccg: block not in map%s: %s <@BPL@R[PlUPP?POP?PDPP,@>@DPNUP@P@[PUPP?P@$P.@4[PD?P>PYPCP7P.>PbDPz;P7PYP@@PUPP.OPfXP@P@[P@@PUP ?PP(P&OP8PN?PFPPPr?P?PPT(P *(P DP ZP z>P YP ZP (P ?P (P .?P N(P (P ?P .P P P >P YP ZP <P (P (P ?P f(P z?PPPX(Pp)PP?PP?PP(P?Pr(PP?P@P@[P)P\@bPl@r[P5PP?P"P,(P8?P`PPP>P$ZP<(PH?Pb(Px(P?PP"PR?Pl(PYP@P@[P?P4P,@2PLPbP~>PYPZP(P)P@ P@[P4PxP?P(P?P(PBP$?PB(Pd@jPt@z[P(P?P?P (P2BPN)PP?PP(P?P2P\P~@P@[POPPP>PYP ZP02P<OPV2Px@~P@[P2POP8Ph(Pv?P?P(P PcP(P P&cPd?P(PEPaP*@0P:@@[Ph@nP #+4<FLS[dqx" @!*29BIPBW]clu|RHH%-7AIQXairs^~ B &.6=E_nbuf_setblocklmult_rootdev_linesw_uprintf_printf_bclnlist_mpid_lbolt_nswdev_avenrun_hostnamelen_runin_inodeNINODE_rootdir_blkclr_alloccgblk_hashalloc_hostname_tz_fragextend_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_bdwrite_noproc_swdevt_fragtbl_ialloc_alloc_physmem_mount_dmmax_ifree_freelmodt_isblock_rablock_inode_buffers_boothowto_argdev_fserr_buf_tickulmodt_runout_badblock_clrblock_mapsearch_bzero_dumpdev_ninode_selwait_bcopy_zdmap_nblkdev_breadldivt_cdevsw_rasize_fragacct_brealloc_getblk_around_dmmin_updlock_runrun_ialloccg_realloccg_alloccg_bufpages_bufhash_blkprefuldivt_dirpref_maxmem_hz_swbuf_swapdev_u_hostid_wantin_iget_brelse_time_panic_dumplo_hand_bfreelist_dmtext_nswbuf_inside_bdevsw_scanc_curprib[l$ $bbbXHNV.JfHyXNX/./. 0. H/a *@ f\ -oHyfNXHU0. H"HAHABAЁ @ PNXRHUa vX *nN^NuNVH0/. 0. H/aPJfx/./. 0. H/a *@ fT -oHylNXHU0. H"HAHABAЁ @ PNXRJg/.0. H/aPJf/./.0. H/a (@ g HTaX`T ,oHysNXHT0. H"HAHABAЁ @ PNXRf/./. 0. H/a ` HUa X L0N^NuNVH *n. fR -oHy}NXHU0-H"HAHABAЁ @ PNX fHUa ~XHUaX` gL N^NuNVH *n fR0-H"HAHABAЁ @. gHUa` HUa,XL N^NuNV.*nHUaX*nN^NuNVH0*n @g HUNX 9@gHyNX g g`;|N.Jn&(|`(| l !M+l )M +L`J f g(|` g(|`(|@ l!M +l)M+L 7/NXL0N^NuNVH0 . rN2. HЁr?N"HA HABAЁ(@*l`& -$ f0-n f fp` *mfBL0N^NuNV/. 0. H/atPJg/./. 0. H/a `BN^NuNVH0 e-|@ . rN2. HЁr?N"HA HABAЁ(@*l` -$ f0-n f fN-@ g"@HxHUNP/.NX`/.NXN-@ m!m m !m/.NX/.HUaPJgR`*mfF0. HmHyNXa*@HUaX m!m m!m+l+L l!M)M;n +n $Bm/.HUaPJg L0N^NuNVH0a*@HUafX m!m m!m(|+l+L l!M)M;|Bm/.HUaPJg L0N^NuNVH0*n . fp` . l6 gHUaXB` gvHyNX`d mgT-m$ . "<NЮS-@ -$rN2-HЁr?N"HA HABAЁ-@ n(h`g0,mf fJg ,$n ,"<NЬ$oN-@ g$@HxHTNP/.NX`p/.NXN-@ l!l l !l/.NX gHTap`HTaX(lf/. HUa PL0N^NuNVH$*n . "<Nr -@gl( - Ю/ -//9N `-mgx - Ю/ .//9N $@fj/./9NP$@gN/.HR/- N /- /./9N `/./9NP$@g+J falJfRf HUaPXB`+n+n pL$N^NuNV nJg /( /(/9N nB nBN^NuNVH0N-@(|` , f@b/.NXfB`*l N-@ m!m m !m/.NX gHUa6X`p*HUa"X m!m m!m+y+| y!M#;|BmHUa XpL0N^NuNVH0` @HxHTNP/.NXN-@(|` , f@bg/.NX*l N-@ m!m m !m/.NX gHUa `v* L0N^NuNV.*nN-@`HxHUNP g/.NXJ9fHUaX*nN^NuNV.*n gHyNX  gHU m0N` gHUa`HUNX*nN^NuNV.-n ."<NЮS-@ . rN2. HЁr?N"HA HABAЁ-@ n*h`0-n f fJg -$n -"<NЭ$oN-@ gh@HxHUNP/.N`B/.NXN-@ m!m m !m/.NXHUaX`2 f/.NX*mf*nN^NuNVH0`\ n g 0. mflN-@ m!m m !m/.NXHUaX/.NXN-@(|`*l ` f*m f@e/.NXL0N^NuNV.*nB g0-H-@fp` .*nN^NuNVH0(|`$*l`0-n f*mf eL0N^Nubread: size 0breadbreadabreadrabpbwriteblkdevbreallocdup biodone@]PP@V]PhPWP@]P*hP8WP@]PhPWP4WPD@J]PthPWPhP\QPdbPvbP|bPQP2PbPbPbPbPbP2PPR@Pb%PzLP@P(%P@LPt2P*PPPPP2PPP>P"@(]PbPP@V]P@P@P%PLP@P$2PD*PPPP`PPh2PPP@P $P *P TP ZP rP x P FtKR[dlv L F B$ "-5= DKS[(c lt_nbuf_klseql_allocbuf_rootdev_linesw_rmget_desscan_bclnlist_mpid_rmalloc_qs_nswdev_nproc_sum_whichqs_runin_freemem_rate_geteblk_rmfree_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_incore_buffermap_panicstr_nswap_geterror_bdwrite_noproc_swdevt_physmem_biodone_dmmaxlmodt_saferss_maxslp_multprog_rablock_sleep_swptstat_avefree30_buffers_boothowto_argdev_bawrite_klout_spl6_buf_nscan_procNPROC_deficit_runout_kltxt_dumpdev_pidhash_selwait_bcopy_zdmap_nblkdev_breadldivt_cdevsw_rasize_forkstat_brealloc_getblk_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_bfreemem_binval_minfree_splx_wakeup_klin_maxmem_getnewbuf_swbuf_swapdev_u_bwrite_proc_wantin_blkflush_brelse_panic_total_lotsfree_dumplo_hand_bfreelist_nswbuf_dmtext_bfree_baddr_breada_bdevsw_bflush_biowait_curprib[lю$ bbb$NVH *nJ lB`-mBB n -2"(P-@Jf l l lR n"(P"-2m n (0` n (HF2Ш4SL-@ n차0lJo/(0/HmN/./.HUN/AN ./HUN-@Jfp` .R n"(0N+@2 n ($ n"(dAN". mB/.NX lAN . -P f Jg`\Jg . R n"(0N"-2l8Jgh n (HF2Ш4SL-@ (4ЮSL-@o//.HmN/. /. HUN//.HUN`h . R n"(0N"-2l n (4ЮSL-@` n-h0/.HmN/. /. HUN/HUN -@Jg~ @ ($ n"(d-@p0-& @f /.N` /.NXAN . mB l$AN . R  n"(d# . R l . T n"(P"-2m n (0` n (HF2Ш4SL#`B-|-n  -| n"(t .N-@ . m .䑮 SJnJghA~p-PJf g(BB/.HUN-@ n/(0/HUN -@Jg @ ($ n"(d-@/.NXA~p mB`x n/(0 ."(d/0- H/N -@ @ g/NX` n-h n"(t .N-@ . ".N n"(tN. Ю @-PJf f/.NX`Jf* lBB`/.//.HUN-@ n/(0/.HUN -@Jg @ ($ n"(d-@ mp0-& @f /.N` /.NX Ю @ /.N` /.NXR o n (tSl* RЮ @  n"(d# n#0 .L N^Nu7P(P.+P3P/PPBPP3P/PP\3PjP8PPPH+PP3PP$8Pd(P;P)P)PP;P3P8P8PPP;PP+P !+15=DMTaj@s|$,~5>HENU[ckr{ "_nbuflmult_rootdev_linesw_bclnlist_mpid_qs_nswdev_nproc_whichqs_runin_inodeNINODE_rootdir_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_bdwrite_noproc_swdevt_alloc_physmem_dmmaxlmodt_rablock_inode_buffers_boothowto_argdev_buf_procNPROC_runout_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_breadldivt_cdevsw_rasize_dmmin_updlock_runrun_realloccg_bufpages_bufhash_bmap_blkpref_maxmem_swbuf_swapdev_u_bwrite_proc_wantin_brelse_dumplo_hand_bfreelist_nswbuf_dmtext_bdevsw_curprib[l$ bbbNVH8*n(n &m f+L +LB `r ,((lFJ g$ k (((l, k ,((m&HJ f)k 'L f.+L`(&k `J g k (((m ,((m&H`L8N^Nu #+2@;DMXbiqz %+6>F_nbuf_rootdev_bclnlist_mpid_nswdev_runin_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_physmem_rablock_buffers_boothowto_disksort_argdev_buf_runout_dumpdev_selwait_nblkdev_rasize_updlock_runrun_bufpages_bufhash_maxmem_swbuf_swapdev_wantin_dumplo_hand_bfreelist_nswbuf_curprib[l֚$ wbbbNVH *n=mP0.H.p0-& g `g8B`jep`^/. 0.H/ "HA((HABAЁ`.d/. 0.H/ "HAHABAЁ @ PNPL N^NuNVH0*n.. fn mJ(g4p0-& g p0-& `g `p0- g HUNXp0- g `\JyfB`R09m*g209m,g$(| g0-,Hg Xep0-&f pL0N^NuNV./.BHyN *@g 09m*f `aJfHUNXB*nN^NuNVJyf yp` BN^NuDPp'Px&P8P/PP6/P>/PJ/PX/Pd/P~/P/PP P/P:P/P/P/P ")-5<BKR_hox  ~'0H7@HPW^gow_suser_rootdev_linesw_mpid_openi_qs_nswdev_nproc_file_whichqs_runin_inodeNINODE_rootdir_namei_nchrdev_kmapwnt_panicstr_nswap_acctbuf_noproc_swdevt_physmem_mount_dmmax_xrele_uchar_rablock_inode_boothowto_argdev_nfile_procNPROC_runout_dumpdev_ninode_pidhash_selwait_zdmap_nblkdev_cdevsw_rasize_owner_dmmin_updlock_runrun_maxmem_swapdev_u_access_proc_fileNFILE_wantin_dumplo_hand_dmtext_acctp_bdevsw_curpri_iputb[l $ \bbb @NVH0*y(|~?`()LPSl#A#+|"*+M.9`&*+M y +y"A#SnBL0N^NuNVH<*n 0. H/NXgHy NX0. HЮr?N&@(S` .f0. l fp0,glHx HTNP`p0,gD$|`& *f=R j*h -|`LeHy NXJl f,-lg n!l""`#" l" BB"Rl l`(Tf,(yfHy NXB`T-lg n!|"#BB"HTNXHSHTNP9n )M)n9|Rl B/-0 ."-N" -N$ ."-N"-F" -NԀԭ ."-N"-xN"-`Ԁ -d/0. H/N -@ @ g(/NXHTNX()LBHTaPX` n-h ."-xNѮ n <C&"Q/.NX L<N^NuNV.*np0-fHy NXHUaXHUa X*nN^NuNV.*n m fmJm(n6BHUaPp0-&-@Bm&BNmB/./-HUN p0-FgBHyHyHUaRHUaXBmJg y +y"`#+|"BA#Sm *nN^NuNVH8*n&mp0-Fg2J+f*/+0 -"+N" +N$ -"+N"+F" +NԀԫ -"+N"+xN"+`Ԁ +d/0- H/N (@ g HTN`p0-g n +P6p0-g n+P>p0-@g+yFm -"+xNЬ -@A&"n <"QJg HTN`HTNXL8N^NuNV(H0 n (2 cP*h . Э0S"-PS,  -@t-@ -t"N".-A n <(CJ"Q2-|FA .FJl( .~".FЁ @BA .F SFJFl~ ` .N"Ё @BSn n!n 2 nhBHxHyHy/.aAJ(H-|FA~ .F-PJgR/.FA .F//.HTa*A .FJl"A~ .FB/-0/.HTN A .FJlVSFJFl|~ `jAN -PJgTAN B l R"-P",2m -0` -HF2Э4SL*//.HTN SnJmAN -PJg l R"-P",2m -0` -HF2Э4SL-@@)n 2 l R"-P",2m -0` -HF2Э4SL-@GNU^iqjxH :2 ",5=DOW_cjsv~._nbuflmult_rootdev_linesw_ifreet_bclnlist_mpid_lbolt_nswdevulmult_avenrun_hostnamelen_runin_inodeNINODE_rootdir_geteblk__insque_getfs_hostname_tz_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_bdwrite_noproc_swdevt_iflush_physmem_mount_dmmax_free_ifreelmodt_iunlock_rablock_sleep_inode_buffers_boothowto_argdev_irele_itrunc_buf_tickulmodt_runout_bzero_dumpdev_ninode_selwait_bcopy_zdmap_nblkdev_bread_indirtruncldivt_ilock_cdevsw_rasize_iupdat_dmmin_updlock_runrun_bufpages_bufhash_ihinituldivt_tablefull_wakeup_maxmem_hz_swbuf_swapdev_u_bwrite__remque_hostid_wantin_iget_brelse_time_panic_dumplo_hand_bfreelist_nswbuf_dmtext_ihead_bdevsw_curpri_iput_ifreehb[lo$ bbbx(NVH<̕-|B . -@ HxNX-@ @*h nNgP gg  g `R n ( e`J9f n*h /g(y`(`R /g(yĹf(y&lHTNXRl #p0,& @fHx@HTNPJfdB`& /g$ lR . @RRJf3 . @BJ9fJ fJf /.N`-|  f"JfBBp09XP-@ ,2"<Nr -@B`" +HFf4g HRNXB/9HTa  $@g^BJf .f -|B * Ю-@ ."<-A n0(fTJhgN0(b>0(XP2(bJg0 hb /aXJgHyHTaP .ѹ` g n0(-@Jg0(XPJox .İm -|-y n0(`JJfH .Ѯ f-y .䰮m$-| n0(й䐮-@ nJg40(yf(0(/ P/HyN Jg-y n0(ѹ0(Ѯ 9䰮m  fhJfbJl(gZHxHTNPJf@JfB`##lBg HRNX/.NX#B` n0(XЮP2c4HyHTaP n0(XЮP)@2lB n0(XP/Hy /N HRNX  fJfHxHTNPJf># 9fB` 9䐮#Jg , fRl `/9 HS0, H/N (@f/9N` 9.f" 9.fJ9ff:#  f*Jg"JfHxHTNPJg`b  f f-| l ."HAHABAЁ @Jgh ."HAHABAЁ @0l fBHTNX ."HAHABAЁ @(PHTNXRl &lU`NR`f# , f `/9 HS0, H/N (@g`\-LHxHyHyN Jfp/.NX/9 HS0, H/N (@fP/.NXg HRNXg HTNX/.NX` , ffRl &lp0,& f8Jf /f*HUNXR-@ ,2Ю dR oB>`P/9 HS0, H/N (@/.NXfn`/. n ( Ь2/HUN BHxB/,2 n/( HTBNJ9f n*h HTNX /f:/.NX`R /g(yĹf(yHTNXRl `(nHTNX&l` /g/.NXJg"#`$R /g/.NX`/.NX L<N^NuNV/. /9 n/( (/HyNN^NuNVH *nB`AJfp`Rp0-eAHHL N^NuNVH0B n# p09XP-@JfV 9gHy'NX3BHx/9/.Hy /9HxN-@` 9й y2c 9й!@2Hn/9/9az -@Jf/9NX9HH`B*np0-XP-@p0--@p0--@`d .Ю(@Jg;n Ю*@` .Ѯp0,XP-@p0,Ѯp0,Ѯ/.HUHTN .eJf, .Ю찮dHy4NX .Ю3`. .lHyCNX3;n Ю*@/.HUHy N /.NX yhB/9NX .L0N^NuNVH0*yJf>B BHx/9p09XP/Hy HUHxN`HHn 9䐹/HUa (@fB` n09hHTNXmBpL0N^NuNV n # BHx/9p09XP/Hy /.HxN/.NXN^NuNVH0 n*h . "-P-@ -HF -@ l .R"-P n"(2m -0` n (2"-HFЭ4SL-@//.B/./.N"-d-@J9f `HTNXB`@/./. n0( H/N (@ fJg , Ю n L0N^NuNVH0*nA(HB`HnHx/HxHTHUBN-@ <-@Jf" mp0,XP".dB`6Jg ,.f lg lf ,. fp0,ހ2mrpL0N^Numangled entryi_size too small..%s: bad dir ino %d at offset %d: %s wdir: newblkwdir: compact1wdir: compact24 Pv=P=P=P=P=P=P P.P=P>PH=P^=Ph=Pr=PCP=P-P=P=P CP=P@@=PH=Px=P=P=P=P P=P=P=PB>PV=P`=Ph=P~CPCP=P@=P)P"CPD>PR=PX=Pf=Pn=Px=P=P=PBP=PNP=P=P=P=P=P>P2=PlPPNPP.P=P=P=P=PBP8@>=PD PVP^=PnBP"PCPNPCP=PFP*=P4=PDBPTP~ P1P=P=PNP"P=P P.P .P ,CP <=P P"P `"P |=P @ P =P =P =P =P (=P 6@ <DP F=P R=P \=P b=P l1P ~=P =P =P =P =P =P =P =P NP =P n)P |=P @ DP =P @ DP =P =P )P ?P =P =P NP 4=P :=P B=P N=P V=P h=P t1P =P =P =P ?P =P =P =P =P 1P =P &NP 7P =P CP ,PV1P #-3;BOXajqw@   (/4(>FOW`gHnw~ r   *%+3:BJP[ck 0u}_nbuf_rootdev_linesw_printf_bclnlist_mpid_nswdev_runin_inodeNINODE_rootdir_ovbcopy_geteblk_namei_bcmp_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_direnter_swdevt_physmem_mount_dmmax_iunlock_rablock_dirchk_inode_buffers_boothowto_argdev_dirrewrite_irele_buf_dirempty_runout_dumpdev_ninode_selwait_bcopy_zdmap_nblkdev_breadldivt_ilock_cdevsw_rasize_rdwri_dmmin_updlock_runrun_bufpages_bufhash_bmap_dirbad_dirbadname_maxmem_swbuf_swapdev_u_access_bwrite_dirremove_wantin_iget_brelse_panic_dumplo_strlen_hand_bfreelist_nswbuf_dmtext_blkatoff_bdevsw_curpri_iputb[ l:$ .Bbbb X|DHNVBN^NuNVH8*n0--@?.Jo .f@N-@B Jf#` y!M #a/.N` l "HA HABAЁ&@ @JhgxN-@(|@`R@HxHTNP f <A/ Q*_ )|,0#HSHTa PJfB/.NXHUN`F+l((+l/.NXHT0,H"HAHABAЁ @ PNXL8N^NuNVH0BNJfp`N-@ . ngn ng ngh ngB ng8 ng: ng ng-|/.NX .`(A`B9A` n#`(nB "HA>>HABAЁ @ g R m l "HA>>HABAЁ @  "HA>>HABAЁ @ `R n B` @ hg4 @ h0(& `f n h (Nm -|`.-*-JmxJo ljJf, l\ "HA HABAЁ-@` l0-|B "HA>>HABAЁ @Jf-FR l*Jm "HA>>HABAЁ @ f`4Jl -|`,. "HA>>HABAЁ @ $HB>>HBBBЂ$ "HA HABAЁԀ-B n h (N n0J l n!yL` n!m  n!m nJo (Ш#L` nBBL n1|Jm n "HA HABAЁ"@"#h#h`L0N^NuNV/. HyHx0. H/HyHzNN^NuNV/. HyB0. H/HyHzrNN^NuNVJ\g 9\`J9Ff <@`B## #L##3 N-@HyaX 9g/.NX m oB` 9N^NuNVH8(|`fHxBNP-@gh @!|  n (Ј&@Hx\HSNPHyHSNPR9E'M)m '|XHSa"X*l g 9EeL8N^NuNVH<*n(mA $H -X g gn`+l @+lD gp`p@0,@%l$%l B(%yRyC |%PB<+|X+|Pp* f /HUaP`HRa X&@Jg+|XHSa ^XL<N^NuNVH0J9Ff8R9FHxNX*@JfHypNXA((HA# |#`HyzNX####BBl. "HAHABAЁ @ fDmHyNX09HfB#A#dJdf #dB9d09H/aX/NX# H`R`NL0N^NuNVH<*nR |b m0lHx0HUNP*@Jf R` Э$@%j%j%j %j$$%j((%j,,p*gHRaX(@Jg<&lA -H( f4 *((g R$` JDo)|XB -$lr Э",t 塐-@Jo+@( .`B( ,ѭ$pL0N^NuNVH0*n(y g9m @g HUNXHTNXBL0N^NuNVH0*n(y` -$g(TfR B`./9NXJfA #-C L0N^NuNVH<*n(y` -$f - g(TfJ9Agp- gp-?-@/- NXJf 9 &|  g>edRkp-@gJf/-NXJfdjp-@fb lR ."HA HABAЁAЈ$@ @Jhg,`t-r9Bg,HxHUaPR(B` l ."HA HABAЁ$@ @Jhgp- fJ o n lJmJm -ltJ(g R8`p - -@ .й4 oRR<`8Hx$NX-@/.NX(@/.NXg .ѹ4f R`Hx\HTNPA\-H)HHx@/.NP)LH)nL .@)@@ n!@ )m D n!lDA -HHx0/HUN . @ ."@" nB n( n( nyB)|P)|Xp- f n ` nB n  n!|V0 n!m$ n"n#h($HyHTNP mF - f.Jl0H/NX l@ ` l@ )|X`HTaX`jHR/.aP L<N^NuNVH(*n/-NXJfB`>HUaX&@Jg-k A'P 'n|nyBHSaXpL(N^NuNVH8*nB &@+m+m+m +m$$+m((+m,,(K` 0,Hހ(Tf0;@||M RHxHyBHSNL8N^NuNVH8*nHxBNP(@Jf RB`2)|L9|0 Ь&@gHx0HSHUN L8N^NuNVH BA-H-n`HxBNP*@g.. mrN-@-yg( .r  @RSy n#/.NXJg.<0;@ .쐍+@`& po pp` pn .0;@+|  Э-@///.N ߮ n -M J n .`/.NXBL N^NuNVH<*nA $H-|HxBNP(@Jgf)|L9|0 Ь&@Hx0HSHRN Do <` -D.'G,/. //-@a^ -@fHTNXR`F(߭@Dߪ(JDoR< bP P 5P P tP bP nP x@ ~ P P bP P P bP bP P PP P&P,3PNPl\Pv3P~WPPiP3P:PhqPr5PPPbPPUPPPPP$PXPdPnPPPUPPP&bPRPbPbPbPbPlP cPlP,bP:bPJNPfNPRPP>@^PfP.PUP$PbPgPFPPbPRPTPt0P~zPvPPPzPlPRP@tPtPRPPbPRP}PbP lPAP$lP2PFPfPpjPPPP6mP>mP\NPdBP~,P@WP,lP<lP@ #+2;CJUZblXt~  |&@/8@IRU_jt{xV\ )09FQ\bjq`x  >H &.7,DKT[d@lv~<.f> '06?JFR[fnu~ LP|_if_ifwithaf_nbuf_ndstrategy_netisr_suser_rootdev_linesw_m_get_mclrefcnt_ipq_printf_ndmapbuf_sccsid_mbbufmem_ndflushp_bclnlist_mpid_rtnet_wmemfree_nswdev_file_mbmemmap_runin_inodeNINODE_ip_id_rootdir__insque_rawintrq_nd_init_m_free_nd_slowtimo_ndsize_ipstat_bswlist_nchrdev_nduout_kmapwnt_ndsenddata_ndsmatch_buffermap_panicstr_nswap_ndwrite_noproc_min_swdevt_genericsize_ipintrq_splimp_nddiskstrat_physmem_mount_ndiodone_biodone_dmmax_ndclear_setswapsize_ndswapsize_rablock_sleep_ndioctl_inode_buffers_nmbclusters_boothowto_mbbuffree_spl0_argdev_nfile_ndsin_ip_output_spl6_buf_nderrreply_ndsout_physio_runout_nd_input_bzero_dumpdev_ninode_selwait_bcopy_ndumatch_zdmap_in_lnaof_nblkdevldivt_cdevsw_rasizeDiagRet_ndopen_xumount_ndlociodone_mfree_ndgetnp_dmmin_updlock_ndstat_mbbufall_runrun_bufpages_bufhash_routetoif_minphys_binval_sirmask_ndoutput_splx_ndrootif_cpu_ndcopyctom_ndstart_wakeup_ndcopymtoc_m_pullup_m_freem_maxmem_mbutl_swbuf_swapdev_getf_mclfree_fileNFILE_ndread__remque_physmbmem_wantin_panic_iopbmap_ifnet_dumplo_hand_nddump_bfreelist_mbstat_ndnull_dmtext_nswbuf_nd_mbbufmap_rthost_in_netof_bdevsw_ndintr_mpurge_curpri_splnetb[lȁ$ bbb8 NVH0J8gaJfR(|`rJgf Tg` l-h nJ(gLJ(g( ./HyLNPHyUNX nB( n!y HTNXe*y`Hp0-f4Jm g.mRm BHyHyHUNHUNXeBHxNXL0N^NuNVH0*n(m ,0SЭ2",0N-@B`rHx/.HUN ",d-@ l .R",P"-2m ,0` ,HF2Ь4SL//.0- H/N R .mL0N^NuNVH n (8 @ Ю @-@ . -@ z`p n (8rN"ҀpgP  @.  @,(`& . f Ю @ .ѐ؅R n8oR n8mLN^NuNV.*n . $e&/. HyfNPHyuHUNPp`B*nN^NuNV n (8S b@0;Nj,` . Ю @ fp` .rA .Ю @r.r.g` .rA .Ю @r.r.fL` .rA .Ю @r.r.f`FHyNXBN^NuNV n (8S b~@0;N\Bt ttt`p . Ю @B`b .rF .Ю @`@ .rF .` .rF .`HyNXN^NuNV n (8S bz@0;NZBp"ppp`l . Ю @`\ .r .Ю @`< .r .` .r .`HyNXN^NuNVH0*|`TJgH0n f@ m(h T\g*Hl0. H/HyN HyNX `4e0. H/HyNPHyNXBL0N^NuNV.0. yfp`2*|` 0n f rN`ep*nN^NuNVH0*|B`BBA .BR oN-@(m `$ ,"<NAЈ @RR(l f/.NX/. .< @/HyN BA .Jg(A ./ .r /HyN R oHyNX@Re L0N^Nufs = %s update: rofs modbad block %d, bad blockisblockclrblocksetblockdev = 0x%x, fs = %s getfs: bad magicdev = 0x%x getfs: no fsLOCKEDLRUAGEEMPTY%s: total-%d, %d-%d @=P =P&P`@fPn@tLPKPBPP$PKPKP;PVP P=P TP:6PTAPJPP!P0:P>RP@P@)P@LP@LP$@*LP>Pr@xP@LPP@P@LPGPPP6PP*OP\*Pv6PCP@@P@P@P&OP@@ @@ %-7=DLUbiv4 8@   &/8?HS[cjpu{H $*4:BFMV^fpv}_nbuf_setblock_rootdev_linesw_printf_bclnlist_mpid_lbolt_nswdev_avenrun_hostnamelen_runin_inodeNINODE_rootdir_syncip_getfs_hostname_tz_syncprt_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_bufstats_noproc_swdevt_fragtbl_physmem_mount_dmmaxlmodt_isblock_rablock_inode_buffers_boothowto_argdev_update_fserr_spl6_buf_tick_getfsx_runout_clrblock_badblock_dumpdev_ninode_selwait_zdmap_nblkdevldivt_cdevsw_rasize_fragacct_around_iupdat_dmmin_updlock_runrun_bufpages_bufhash_bmap_sbupdate_splx_maxmem_hz_swbuf_swapdev_hostid_wantin_blkflush_time_panic_dumplo_hand_bfreelist_dmtext_nswbuf_inside_bdevsw_bflush_curpri_iputb[l܁$ )Mbbb P$NVHya"XN^NuNVNJg HyaXN^NuNVH0*nHxBHyN (@gTp0,& @gHTNX`,Hx@HTNPJfHTNXJg /NX*L0N^NuNVH0-|(yx ,R-@g .f ` .gLHxHxHyN *@fBJ9fT , /atX*@B`HxBHyN *@g/./.HUa L0N^NuNVH0(yxHxHxHyN *@f,J9f4 , /aX*@gBHx`HxHxHUa L0N^NuNVH0*n.. Jg` gHxHUNPJf8 g:HxHUNPJfp0-& @fHUN`B g0HUNX/BHUN -@HUNXJ9f g BHUNPHUNXN(@Jg\ 89|-y)M/HUNPJ9f . @` .\ @BSlHUNXL0N^NuNVH0(yxNJg*BHxHyN *@g `.J9f0/,aX*@gJg +lNmFHUNXL0N^NuNVH8&yxHxBHyN *@gp0-& @fNJf HUN`Rm(m@HxHyHyHUNHUNX#BHxHyN (@gHTNX`B-mFBp0-& `f -|`(p0-& f -| ` m-h0B-n-nHxqPX=PbPlPlPkPlPlPlPlPlPlPlPlP lP,1P2PXmPvmPmPPlPlPlPkPAPlP&lP21P8PXPrlP|1PPPvPvPWP jP lP lP 1P P lP VP lP P .lP BlP NXP pP lP kP lP lP P TP 3P lP (KP j0P lP P XP lP P lP kP lP P TP 4lP <3P lP lP XP P lP lP WP P :lP DXP ^P hlP nlP WP P lP`lP@PP=PPlPPvPvPWP3PlP"1P(P4lP<lPLlPvmPPP=PlP vPvPWP&(PtCP;PlPlP@wP@PPlP*1P0PDlPzqPlP=PPlP1PP@PlP.@4PRVPVP=PPlPdPlPlP)PlPP>lPVlP^lPKPvPvPWP(PlPlP h!(0:@GNRZagpy$   <@| %0:AIS[ cl zt{ z 0 #-5= EK S^fs|~H. $,6?GKQXajps{ L R !_nbuf_lstat_suser_rootdev_fsync_printf_bclnlist_mpid_lbolt_openi_qs_nswdev_nproc_file_whichqs_avenrun_hostnamelen_runin_ftruncate_truncate_inodeNINODE_rootdir_syncip_namei_sync_flocki_hostname_bcmp_chmod_tz_bswlist_nchrdev_lseek_boottime_kmapwnt_saccess_buffermap_panicstr_nswap_noproc_direnter_ialloc_outime_physmem_fchmod_dmmax_chown_utimes_xrele_uchar_flock_iunlock_rablock_inode_symlink_buffers_boothowto_stat1_argdev_dirrewrite_update_irele_nfile_ocreat_itrunc_sostat_buf_dirempty_falloc_unlink_chmod1_tick_fchown_procNPROC_runout_groupmember_dumpdev_maknode_ninode_pidhash_selwait_chdir_zdmap_nblkdev_ilock_rasize_rdwri_iupdat_owner_dmmin_chdirec_updlock_fstat_runrun_bufpages_bufhash_rename_link_chroot_funlocki_dirpref_maxmem_hz_open_swbuf_swapdev_copyout_getf_u_access_chown1_proc_fileNFILE_dirremove_stat_hostid_wantin_readlink_time_panic_dumplo_open1_hand_bfreelist_nswbuf_dmtext_fubyte_mknod_copyin_curpri_iputb[*lڈ$ bbbl< ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@HHHHL@P@X@h@HHH#+$3_fragtbl124_fragtbl_fragtbl8_around_insideb[,l$ bbbNV yRN^NuNV. 9R/NX. f B ..N^NuNVH0(yx/NX*@g< mf(Hx$HnNPHx$/,HnN ` /,/-aVPL0N^NuNVH0(yxHxBHzHN *@g/,HUaPHUNXL0N^NuNV.*np0-FgBHyHyHUN=m -m=m&=m(=m*=m,=mP-m2-m6-m>-mFp0-& `f -|`(p0-& f -| ` m-h0Hx$/. HnN *nN^Nu>P>P$>P*>P2HPF>P`>Ph=P*PPPKP$BP*BP22PP %+2:@IV]js{ @ V%.9AHMS[bks|H&,7?GOW_e_nbuf_rootdev_linesw_bclnlist_mpid_lbolt_nswdev_file_avenrun_hostnamelen_runin_inodeNINODE_rootdir_ostat1_ostat_namei_hostname_tz_schar_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_mount_dmmax_uchar_rablock_ofstat_inode_buffers_boothowto_argdev_nfile_buf_tick_runout_bzero_dumpdev_ninode_selwait_zdmap_nblkdev_cdevsw_rasize_iupdat_dmmin_updlock_runrun_bufpages_bufhash_maxmem_hz_swbuf_swapdev_copyout_getf_u_fileNFILE_hostid_wantin_time_dumplo_hand_bfreelist_nswbuf_dmtext_fubyte_bdevsw_curpri_iputb[0l!$ bbb @D NVBHxa(PJgHxHxaPJfHy @NXN^NuNVH ..-GN-@/./9NP-@/.NXJfB`$ .r *@B/9/. ./NJf0N-@/././9N /.NX`/.HU ./N . JgT g `N-@B`B*#RyRm0y/.NX` r "<N,JoB;| Ry RyHUaXS`L N^NuNVN^NuNVBHxaxPJgp`BN^NuNV.N-@*ygBJm gHy GNX;n Sy .  @RP#B+| `/. /.a,P*@/.NX *nN^NuNV./. /.ajP*@fB`Hxp Э/NP *nN^NuNV.N-@ nJh fHy LNX n0( H @SP nBh n c< (Ј*@ r  @Sf*#Ry n*P nB nB|#Ry/.NX *nN^NuNV.aDJf RyB`xN-@*ygBJm gHy RNX;n Sy .  @RP#B+| `Hy WNX/.NX *nN^NuNVH0*ngN.N-@Jm fHy ^NX0- H @SPBm c< Э(@ r  @Sf(#Ry(U*BB|#Ry/.NX*LfT/NXL0N^NuNVH8*n..JgJ mJlHy dNX0- H-@`0fHy kNX0-H". m0-H *UJ nA&HBJof ;gHy rNX .`*N-@(ygBJl gHy yNX9n Sy . @RP#B)| `/.HxaP(@/.NX&g0-H l ` 0-H 9@ |c. Э-@Ю )@ .r  @R`&0,H/ Ь/ ЭЮ /N ;g0,HB *U&L`/.aZXBL8N^NuNVH0*n(n `*UJf`d |d0-HЭ2,HЁ |c*`D0,H/ Э2-HЁ/ Ь/N 0,mHTajX(@fL0N^NuNVH0.. *ngzJl D.JolJmf<`d0-HBm*UgNJoJ0-Ho0m߭`4Jmg (M*Uf0,Hn0,HBl*n`0lL0N^NuNVH0(n p n0N-@*ygDJm gHy ~NX;l Sy0, H @RP#B+| `0, H/BaP*@/.NXgBm0-Hrp l 0-Hrp`". -A0,Ho 0,H-@/. Э2-HЁ/ Ь/N . 0.m .Ѭ0.lJlfHTaX(@fjJ gHUatXHTaXB`* L0N^Numbinitmgetmfreemgetm_moremfreem_copym_copym_copymgetmget$@*KPFPTTPZPj=PDPGPSP8PPTPP=PSPPP,FP2FP>OPLOPV=Pl1POPOPP7P@KPOPOP7PD=P,PP@KPOPDPPFPFP OP,7PD7PJOPT=PtOP~P7P@KPOPOP7P@KP=PPP,@2KPBOPjDPtPFPFPOP7P7POP=P=P@KP @&KPl@rKPP7P@KPOPOP7P=PFDPPPx.P.PP7P@KP*OP8OPB7Pj=P.P '18AENX_tdmvt  *5BIPVajqT{~HBt4!*.6=ENT\bjq$x d_klseql_m_get_desscan_mclrefcnt_m_expand_lbolt_rmalloc_qs_swapmap_m_pgfree_nproc_sum_whichqs_avenrun_hostnamelen_freemem_rate_hostname_tz_m_free_rmfree_desfree_avefree_maxpgio_boottime_vmaccess_maxfree_m_cat_splimp_ecmap_dmmax_saferss_maxslp_multprog_swptstat_avefree30_nmbclusters_klout_nscan_tick_procNPROC_deficit_kltxt_m_getclr_bzero_pidhash_bcopy_zdmap_firstfreeldivt_forkstat_cmap_cmhash_m_adj_nswapmap_mfree_memall_cnt_dmmin_klsdist_minfree_splx_m_clalloc_klin_m_pullup_m_freem_hz_argmap_mbutl_mbinit_mclfree_proc_hostid_time_m_copy_panic_total_kernelmap_lotsfree_mbstat_ncmap_dmtext_m_more_Mbmap_mbmap_ecmxb[6lB$ $bbbb[8lO$ bbbhHNV n "n"i#h n"n "i#h n1|: n1| > nh" n Bh$ n Bh( n hpN^Nu'.7 ?_mclrefcnt_piconnect_nmbclusters_mfree_mclfree_mbstatb[:l%$ 1bbbH unix PD P`PhPp PtP@@@)3@IP[dl t_mclrefcnt_raw_ctlinput_unixdomain_raw_init_nmbclusters_domains_mfree_raw_input_mclfree_unixsw_mbstat_raw_usrreq_uipc_usrreqb[<lԁ$ !_bbb lLNVH0Jg/./.N`/./.NP*@fp+`0Hgp)`~HxHxNP-@Jfp7`b n (Ј(@9|Bl8Jyf9|)M BBBHT mN-@JglHTaX .` n BL0N^NuNVN-@/. BHx/. n h hN-@/.NX .N^NuNVN-@BBHx/. n h hN-@Jg/.NX .`\ nJf!H n!H nhJ lB  l . `p n1@ nh /.NXBN^NuNV nJg:B/NPJf"Hx/.NPJfHyNX nB nJfF0(g: 8/NX ."/NX ./NXN^NuNV.*nN-@0-f `&/-a4X -g `/-a X -fJgJ gm0-g0-f,BHUaP-@JgJ fb/.NX .`0-gB0-g0-g J fp$`0-gHxHmNNP`Jg(BBHxHU m hN-@J fJfr0-gHyNXmHUa"X/.NXB*nN^NuNVBBHx /. n h hN-@N^NuNVHx n0(g -|%`$/. BHx/. n h hN-@/.NX .N^NuNVH<*nBA&HB0-f m 0(g n0-:H"(op(`H .g 0-f m 0(gp`B-@`mLHxHmLNP0-LfmLRN-@0-gdHx /9PNP-| /.NXmL0-LgmLHmLNXJg /.NX .`lJmPgp0-P-@BmP`0-f. m 0(g -|9`zJ f -|'`hJgZJgm/. /. .gp`p /HU m hN-@JgmBJfA&H nJg .gT-|/.NX nJoJo$PJfP nS nJlHyN`0-:H2-8H2->H4-H2-H4-H2-ZPRPhoPOPD-P@aPOP:PXPoP2@8aPrOPoPOPoPLOP-PYP oP&YP,EP@OPdQPvRPZOP@aPFQPRP^OPj'PtFP@aPgPgPFPkPOP 'P [P UP "P ,gP 6[P @OP CP P CP P RP oP (OP tQP P OP -P YP @ aP $`P <@ BaP pP @ aP OP &CP 4oP 'P @ aP gP UP P [P [P gPFPFPgPOP@aP'P(@.aP>gPfUPpP[P[PgPFPFPgPOP QPOP@'PN_Pb6PnOP&PGP0EPPYPPPPJP !Z)4\=*ITblrv}@"-7>FQZcku~P :".6~?HHOXairy%.9?GV^elt~  _nbuf_suser_rootdev_m_get_sosend_mclrefcnt_soclose_soshutdown_soconnect_sodisconnect_bclnlist_mpid_qs_rtnet_nswdev_file_nproc_whichqs_runin_inodeNINODE_sbwait_rootdir_soaccept_sobind_rawintrq_ifrequest_rtrequest_m_free_pffindproto_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_soqremque_ipintrq_gsignal_splimp_solisten_physmem_dmmax_sogetopt_rablock_sleep_inode_nmbclusters_buffers_boothowto_argdev_nfile_sostat_buf_sbflush_procNPROC_runout_m_getclr_bzero_soioctl_dumpdev_pffindtype_ninode_pidhash_selwait_zdmap_nblkdev_uiomove_rasize_psignal_mfree_pfind_dmmin_updlock_ifconf_runrun_bufpages_bufhash_routetoif_splx_socreate_wakeup_m_freem_maxmem_sohasoutofband_mbutl_swbuf_swapdev_copyout_u_sbrelease_mclfree_fileNFILE_proc_wantin_socantrcvmore_m_copy_panic_ifnet_dumplo_sosetopt_soabort_hand_mbstat_bfreelist_nswbuf_dmtext_m_more_rthost_soreceive_curpri_splnet_sofreeb[FlR$ ]bbb <\PNV nh nh .N/NXN^NuNV. n*hgDB/aPPJfHy NXHx/.HUa HmNNXHm"a X nh nh .N/NX ."/aX .8/aX*nN^NuNV nh nh8 .N/NX .8/axX ."/afXN^NuNV nh nh0 .N/NX .8/a$X ."/aXN^NuNVH0*n4-H0-HԀ0- rNnHxBNP-@Jg~ @ (Ј(@80-H9@9m0-H9@)m 9mNN9mTTBHTHUaB BBBHT l hNJgBHTa`P/.NXB` L0N^NuNVH0*n(n )MJfRm)m+L`Rm)m+LL0N^NuNVH<*n(m&L` fB`D&JJ g +` +$@fJ f 'jSl` 'jSlB%jBpL<N^NuNV nh .8/anXN^NuNV nh  ."/aJXN^NuNVH *nN-@ . g gD/.NXB`Jm"f0- fJmg/.NXp`vHm"azX`0-:H2-8H2->H4-H2- n"H3h&( n0($H2("Hm: n"H3h"$Hm8N`HyN` n0H g f0Jg& nJf/./.aP-@Jg`n nJf -|9`X n h*P0-$H2-"H2-(H4-&H’l 0-$H2-"` 0-(H2-&HJo/. n (Ј/Hm"N Jg/.a` nJfHyNX n h*P/.Hm"NP0-&H2-(H nh>;m&(0-"H2-$H nh:;m"$Hm"`Hy`Hx5/.a6P`P-|-`DHy`|L N^NuNVH0/9|/9x/.N -@Jf2HxBNP*@fp7` Э(@ n!L(BL0N^NuNV.*nJg/-NXBJgHUaX`Hx6/- anPJ f/NX UB/-NX /NX*nN^NuNV. n (Ј-@T# nB(HxHxHyN *@gHUNXp0``9HH-@f`9HH-@B9 .`4HyNX*@g n+P n!MHUNXB*nN^NuNVH0 n (Ј*@ n-hA#B-HxBHyN (@fD9HH-@B9`&-|&`-|=`-|)HTNX .`p0,& f-lJg n"n0Qf I0H g` f n"n#h n-h n"n#h  n!n /.NX/.NXHTNXB`t n0(g0/NX-@g @-h n!n n!nHy;B/. N n!@`zHyNX`hL0N^NuNV. n*hgB n/NX n P0H g\ fb - f n+h `4*m `*mfHyNX -f n+h nB`B/NX*nN^NuNV/.ahXN^NuNVN^NuNV n P1nP/.a"XN^NuNVN^Nuuipc 1uipc 2uipc 3uipc 4piusrrequipc connipunp_disconnectP%P>@D$P-P@$PzP@$P P @2@N@T@^PvPPP PP<!PRPXPn+Pz!P!P!PP P!PPP.!P<!Pb+PPP+P"PZ#Pp@v$PP@$P*PD+8ENU]dku~xp H$J,38>ES\_hpw |R_unp_attach_mclrefcnt_unp_disconnect_unp_connect_inodeNINODE_rootdir_namei_m_free_schar_dmmax_sbappend_iunlock_inode_nmbclusters_irele_unp_sendspace_unp_drain_sonewconn_soreserve_m_getclr_maknode_ninode_bcopy_soisconnected_soisdisconnected_zdmap_unp_bind_unp_usrclosed_mfree_unp_abort_dmmin_sbappendaddr_m_freem_u_mclfree_m_copy_panic_socantsendmore_mbstat_dmtext_uipc_usrreq_unp_recvspace_unp_detach_iput_unp_drop_sbwakeupb[Qlݬ$ ubbb< 4.1c BSD UNIX (GENERIC) #3: Thu Jun 30 22:53:15 PDT 1983  _versionb[SlƮ$ bbb'0XNVH8*n(n -o&M..*L-n (K-G -UBHU/.aB Jg"BHT/. a0 JfHxHU/.a  B`pL8N^NuNVH0..*n ,9BA(H-U-m .`A mHyNXmL//9NP(Jf0*HxHU .V/a~ JfHyNXB`^ݭ`(Jg m Jg///9N Bچl H@H@B@܀XmBm<*pL0N^NuNVH 9"HA HABAЁ n"(4偲oB`*nB`J n (4倐.o.9//9NP*f/./.a|P` 9Ѯ n (4".m n(F g@ (4"<N//9NP n!@0 nJ0f/(4`pL N^NuNVH . -@ *nB`8 . .o.9///9N B 9Ѯ . m n(F g". eHxHn/.Hx </`,BHn/.Hx -6". /a .L N^Nuvmdrum NDMAPvsexpandvsswapvstodbvstodb *ipj\PLP@dP P P @dP6 P<PN(PmPmPmP P PmP@APJ PP PmPmP PPmPAP PPJ)PT@ZdPJPJPGP^mPd)PjmP[PmPAPmP)PpPJP[PpPJP>LP`@fdPr(P!P@dP$PmPAP(mP.)P !*4:AHQU^fmtr{t @"*0;BKRXais|~H %~/7(?EOV^hrtw~.z#(,29$@KU]cju}_nbuf_klseql_rootdev_vtod_desscan_bclnlist_mpid_lbolt_ntext_rmalloc_qs_swapmap_nswdev_nproc_sum_whichqs_avenrun_hostnamelen_runin_freemem_rate_hostname_tz_rmfree_desfree_avefree_maxpgio_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_maxfree_noproc_imin_swpexpand_ecmap_physmem_dmmaxlmodt_saferss_maxslp_multprog_rablock_swptstat_avefree30_buffers_boothowto_argdev_klout_buf_nscan_tick_procNPROC_deficit_runout_kltxt_dumpdev_pidhash_selwait_zdmap_firstfree_nblkdevldivt_vsexpand_rasize_vstodb_cmap_forkstat_mwait_cmhash_nswapmap_vmemfree_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_vsxalloc_vsswap_klin_maxmem_hz_argmap_text_swbuf_swapdev_u_vsxfree_proc_hostid_textNTEXT_wantin_vschunk_time_panic_total_kernelmap_lotsfree_dumplo_hand_ncmap_bfreelist_nswbuf_dmtext_mbmap_curpri_swap_ecmxb[Ylǁ$ "bbb? xXNV.##BHy "HAHABAЁ/NPR @m..N^NuNVH8*n(yf ` ,f (Tff(yJgBHTaX l&hA 0,HBB0,H/p0+ r / y N HTNX)MBlBlg/9HTNP`B( L8N^NuNV.*nJg HUNXBHyHUNP*nN^NuNV ."HAHABAЁ/NX ."HAHABAЁ @B ."HAHABAЁ"@" ."HAHABAЁ @0RN^NuNVH<*nBB m0( r -@N-@ n JfJfB`ZHUa$X n x n $P *gHyNX5n rN-@ ..-|@ -6R-@ -:Ю-@ ->".-A m .l ЭZ(@ -6 l -6`p,%L 05@&|3*`Lpc ` p&gJf p0 ?6`6X SJfp* SJg6` .mذl -6 -6ЭZ"Ё(@ -: l -:`p,%L 05@&|3*`Lpc ` p&gJf p0 ?6`6X SJfp* SJg6` .mذl <.0-4Hr ЭZ"偐(@ -> l ->`p,%L D5@&|x3*`Lpc ` p&gJf p0 ?6`6Y SJfp* SJg66`JgHyNX n /aX n B` က//./. y N /.NXLS"<-Am .Ь6m(m .Ь:mm .Ь>l rN-@ , ".Ё-@ @JgP/-Lp0-@/NP=@p0.? f`9HH-@B/-LNPN-@Jg nJfHx/./HTa</.NXp`BL0N^NuNV.*yPJfa`/-NXHy/-NP - ga`*nN^NuNV.*nX`J g .  @0*nN^NuNVH<*n..,.*.N-@ r (@ x(p` r &@JSf:BaX$@R=S rN.?.A6`$p+?"HAHABAЁ$@Rj ?*X08=S/p./NP..A6R SJf./.NXLd "-6遰mh <>dZ -6ЭZ"-6$Ђ`n <>e20-4Hr ЭZ"<偐`< <>d 6l0 6l ЭZ(@ R-@ f <`` 0. H/NXr-fp0-@" A0`(Mp0,@"HA HABAЁй*@fHyNX - f0. H/NXr-fp0-@l@爁l/. 0. H/a>PJgHyNX-m/.NXL0N^NuNV. .  @0 й*@N-@`^ - f$0. H/NXr-f `R m/.NXL0N^NuNVH ## 9# 9r N#l#~`~ S"HA HABAЁй @P @爁P "HA HABAЁй*@ S?툁-?-Roz 9"HA HABAЁй @PB  @0R m y 9?툁 y(?#BL N^NuNV/.aX/.a^XN^NuNV. .R"HA HABAЁй*@`HxHUNP-f*nN^NuNV. .R"HA HABAЁй*@-fHyNX-g HUNX*nN^NuNVH .r .//9PNP*@ .Ю r ,`4gp0-@/aX`Hx r /NPXRSJnL N^NuNVH .r //9PNP*@ .Ю r .`&p0-@/aX fXSJnL N^Nuvmemall sizevmemfreevmemfree vreadmemalldup mem allocbad mem allocmemall ecmapmemall mfindmemall intrans|wantmemfreebad mem freedup mem freemhashmunhashmunhashmunhash mfinddup page unlockoP"@(~P2P8P@xPNmP\Pb>PjPrP|-PPPxPmP5P@~P2XPL]PtPPd@j~PXP]PXP]P8]Pb]PXP]PPkPxPmPP5P@~P/PP lP8]P^]PfPz]P]P@~PXP+P@~P(tPRxPtPPPpPjtPrZPpP_P]P_P$pP@0PH@N~P~]PuP3P @~P>XP@~PlP5P@~PP P mP (XP 0+P 8@ >~P HXP f]P v@ |~P /P ]P ]P &]P <]P b]P ]P P lP P P P P xP &VP D7P TVP \'P P P xP VP 7P VP 'P P P VP ;P D7P RZP nVP VP aP VP VP P P P _P &]P .ZP 8_P dMP v@ |~P /P _P ]P 0P @ ~P MP2_P`]Ph0Pp@v~PMP@~PlP,_P:]PB/PjMP]P0PlP/P_P0]P80P_P]P0PlPXP+P+PXPP0P]PZPP PP2]P\]PPP]P_PP]PP]PP PPJXPd]Pz>PXP]P@~PmPvPPf!PvPP $.4;BKOX 6bk t|tt  #@,5?HR]gnw  +4?GNU\ajqw~H & *5?GtLS\emw> $$.6 p?HNY`hp y_nbuf_klseql_rootdev_desscan_bclnlist_mpid_lbolt_ntext_rmalloc_qs_swapmap_wmemfree_memfree_wmemall_nswdev_file_nproc_sum_vtopte_whichqs_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_hostname_distpte_tz_rmfree_desfree_avefree_pagein_maxpgio_bswlist_nchrdev_boottime_kmapwnt_vmaccess_buffermap_panicstr_nswap_maxfree_noproc_imin_vslock_splimp_ecmap_mhash_physmem_mount_dmmaxlmodt_saferss_usrpt_maxslp_vsunlock_munlock_clearseg_multprog_rablock_sleep_swptstat_inode_avefree30_buffers_boothowto_argdev_nfile_klout_mfind_buf_munlink_nscan_tick_meminit_getfsx_procNPROC_deficit_runout_kltxt_dumpdev_ninode_pidhash_selwait_Usrptmap_zdmap_firstfree_nblkdevldivt_rasize_forkstat_cmap_mwait_cmhash_nswapmap_mbmemfree_vmemfree_memall_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_splx_wakeup_klin_maxmem_ptetov_hz_argmap_swbuf_text_swapdev_u_fileNFILE_proc_mlock_hostid_textNTEXT_wantin_time_panic_kernelmap_total_lotsfree_dumplo_zmemall_vmemall_hand_bfreelist_ncmap_nswbuf_dmtext_munhash_mbmap_mapout_mpurge_curpri_ecmxb[nl $ bbbC t 't-6?IPXahq|Ht$ _rootdev_mpid_nswdev_sum_runin_rate_nchrdev_kmapwnt_panicstr_nswap_noproc_physmem_dmmax_rablock_boothowto_argdev_runout_dumpdev_selwait_zdmap_nblkdev_rasize_cnt_dmmin_updlock_runrun_maxmem_swapdev_wantin_total_dumplo_hand_dmtext_curprib[pl$ +Fbbb xNVH8RX .r .-G*yP 6d -|` <>e -|`-|/HUNP(@f df0,@g fp0,@R"HA HABAЁй @(gZHx/-VNP/HUNP(@gJ gp0,@/NXHx/HTN R,`N-@p0,@R"HA HABAЁй @(g.p0,@/NXRT f mVRh@/.NX,g fHT //-VN RR0J gp0,@/NXHx/HTN`RB`f:-|Hy8Hy/HUN-@-@-@=y`p0@-@ -@Hy8Hy/HUN-@ oHyNX f*JVfHyNX mV h<=h -n`T f=y-n`: .\ @JfHyNX .\ @ P&h=k -|-T f gJfN-@/.0.H/NP-@Jg @p( f n(g n(fHy"NX mVRh@ .␹r NSй-@/NXB(Rp.爁XR mY n n n(f n(gHy/NX n np0("gHyCNX -VrJN nh @h 0.yfR4`R8R0R0.yg:/.09H/NP-@Jg/.09H/NP/.NX`/.NX m /.HUHxHTNp.爁p0,@-@R"HA HABAЁй @ f\ mVRh@HT //-VN `H/0-H//9N - r / 9 /NP-@BB` np0(@-@/NX .R"HA HABAЁй$@ .4g*fR`hRp* bZ@0;NxxHyNXp0* @"HAJJHABAЁй&@SkHJkHf HkHNX*fp* ff k8 (Z`Pp0* @"HAHABAЁй(@`(l^ , @fSl2Jl2fHl2` ,6ЬZr2*Ё`0 g f$0,4Hr ЬZr2*剐-@ nf2* @fSk@`SBBHx/.N RhXm0 gHyNXB+y # 9@gHyNXN-@*yf@/NXL". e-| <-@-m>`| . "-6遰e@ <>". d.-| -6". -A-m:` -| . -@ mV-h4 .S-@(n-n -@SmX fX`Y f. f$JgY/.09H/NPJf/.HTaZPJf .S-@(n .Юo .".-A`-n-n -nR .찮lX fY`X f. f$JgX/.09H/NPJf/.HTaPJf .쐮S-@Юg(n f .候 .` .候 .䑮 .ЮR n fS n S`S n S @R-n B`gJfFp0,@/NX fHT . //-VN `-T/.HUHxHTNJfHyNXp.爁p0,@-@АR"HA HABAЁй @ f mVRh@`RRBXR R nm .L0N^NuNVH0*nJ fjgB`r0-@gp0-@R"HA HABAЁй(@,f,ff0-@g-f`f0-@fpL0N^Nupagein pg_filenopagein PG_FTEXTpagein u.u_ofilepagein mfindpagein intrans|wantpagein c_page chgdpagein vreadpagein pfnumbad c_pagepageout klsizecleanup CSYScleanup centerkluster \PmP`PQPVP5PPqP |P\P )P4QPNVPjBPr\PePPmP\PqP|PmP mP*P@lPfmPlmPvP@vP@vPlPmP@vPmPH@R)Ph?P@vPVPSPQPBPH@NvPv@|vPjPSPlP\P\P\PmPlPlP?PlPPeP(eP4PR[PQPVPPP5PPP:)PRlP\?PplPzPeP2P\P\P@vPuP@vP$HP8P@gP`mPfmPpPPmP\P\PPPfP(PBQP\VP@+P1P@P |P 6P <yP nP tSP KP >P _P P P >P _P P P VQP pVP !P qP >P ,mP 2mP >P XlP P P \P 'P QP @P P PP pP 5P ";P 0PP 6CP <P DP JyP R{P jVP jP {P QP @ vP RP h@ /P pP~ PSP@PP!P!PpP5P;PPP;P{PQP qPrPP"nPTPf>P@vPrPrPPlPP,P6\P@\PFCPL{PR{P`{Pf\PPePNPPwPPpPP(1P4QPNVP@vPjPfP$pPP\P@vP!P!P!P !P&!P,fP4@P>PPePxPGPdPPlP?PlP?PPPGP.GP^qPP[P@vPQPVP|QPVP !'0~9 AKQX\ f`oxtt @'2<CLT\cjsz "+2=FN V]fny~H t (2;DMS[aiqw~$ %-6=CKJQYbhn_nbuf_klseqllmult_rootdev_vtod_desscan_cleanup_klicnt_bclnlist_mpid_ntext_qs_dpageout_kluster_swapmap_memfree_nswdev_file_nproc_sum_vtopte_whichqs_runin_inodeNINODE_freemem_rootdir_rate_distpte_rmfree_desfree_avefree_pagein_maxpgio_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_maxfree_noproc_splimp_ecmap_mhash_physmem_dmmax_preptofree_saferss_maxslp_munlock_clearseg_multprog_rablock_sleep_swptstat_inode_avefree30_buffers_boothowto_spl0_argdev_nfile_klout_mfind_spl6_buf_munlink_nscan_procNPROC_deficit_runout_klocnt_kltxt_dumpdev_ninode_ctxunload_pidhash_selwait_Usrptmap_zdmap_getbits_firstfree_nblkdevldivt_rasize_forkstat_cmap_pageout_nohash_cmhash_nswapmap_memall_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_minfree_noklust_splx_wakeup_klin_maxmem_argmap_text_swbuf_swapdev_u_uaccess_fileNFILE_proc_mlock_pushutl_textNTEXT_wantin_blkflush_panic_kernelmap_total_lotsfree_dumplo_hand_newptes_ncmap_bfreelist_nswbuf_dmtext_munhash_mbmap_fifo_mapout_klok_curpri_Pushmap_swap_ecmxb[|l"$ wbbbPNVB<#<#D yP!n6#Hx/.aJPB/. a>PN^NuNV.*yPN/-: -6ЭZ/NPB/->0-4Hr ЭZ"->S偐/NPBJBgHyPNXBJ`HxHm2NPJm2fHxHyBN HxHy8BN B6B:B>BBB*nN^NuNVH<*n(n &n$n)m66%l6B6'm6)m::%l:B:'m:)m>>%l>B>'m>)mJJBJ)mBBBB9m22Bm2)mVVHTHUNPBVA <C"Q | <C"QA8 <C8"Q | <C8"Q%kLLBLA <C"QHxHHkNPA <C"QHxHHkNP/.HRHSHTHUNL<N^NuNVH<*yPJg .rNJgHy[NX-y-yJ f0 -6Э:-@ .ѭ: .ѹ`$ .ѭ> ->S"<-A .ѹ 9<й8&@ 9Dй@$@ ".o4/./. ". "<N/N 9<-@ 9D-@J f .й8JoB`".Ё` .й@Jo".`B偐(@Jl .D/HTNPBJ f .Ю#<` .#D-|xJl .D-@`nn@ .ѹL-L-n`A(XSl/././.N L<N^NuNV.*n`R9Hx/9NPHyHUNPJg yP/(NXHyHyHyHyHUN#LHyNXJgp`.J g> 9<`#<#DHyHyHyHU/9Pa`HxHHyNPHxHHyNP | <C"Q | <C8"QBLJVg mVR(DHUNXHx/-: -6/ -6ЭZ/HUaPHx/-> ->S"</0-4Hr ЭZ"->S偐/HUaB*nN^NuNVH0*n ..,.//9PNP(@`SgRB l*XXR`X/./.HxHUN nRBB " Ҁ Ap0(@/ Ѕr /NP " Ҁ A@R mRp0-@/NXXJf^ n L0N^Nuvrelvm rssexpandVPVPVPVP,VPVVP\PrFPFP@[P(PVP=PVP=PVPVP$VP:P8P8P:4P^4Pr PVP!P@[PVPVPVPVP$VP2VP:VPHVPVPJPTPZ'P`PfVPnVPP4PP4PVPPVPPPDPVP P`PMP*$P &,37@HOtT\enu~t0 "+5>GNXcnv}N~H #,4;EOtT[dmu|j$ "+2:AIQW_klseql_resume_rootdev_desscan_mpid_ntext_qs_swapmap_nswdev_nproc_sum_vtopte_whichqs_vpasspt_runin_freemem_rate_desfree_avefree_forkutl_maxpgio_nchrdev_setjmp_kmapwnt_panicstr_nswap_xfree_maxfree_noproc_ecmap_physmem_vpassvm_dmmaxlmodt_saferss_maxslp_munlock_multprog_rablock_Forkmap_sleep_swptstat_avefree30_boothowto_argdev_klout_nscan_vrelvm_procNPROC_deficit_runout_kltxt_bzero_dumpdev_pidhash_selwait_zdmap_firstfree_xrepl_nblkdevldivt_vsexpand_expand_rasize_forkstat_cmap_procdup_cmhash_xlink_nswapmap_vmemfree_cnt_dmmin_updlock_klsdist_runrun_vgetu_copyseg_minfree_vmdup_vgetpt_klin_maxmem_argmap_text_swapdev_u_proc_ptexpand_textNTEXT_wantin_panic_total_kernelmap_lotsfree_dumplo_vmemall_hand_newptes_ncmap_dmtext_mbmap_vgetvm_curpri_ecmxb[lϹ$ bbb tNVH *nJm4fHy tNX0-4H//9NP.JfB`BHU0-4H/ / n NJf/0-4H//9N ` r +@Z0-4Hr WЭZ+@0-4H//-Z /N B`" І @p0@/NXR0-4HmpL N^NuNVH8 n*hVg &hZ(m8g -4/HS/,ZN `-|`-Fgnn@B` A&XR4m-F gd-Fg$/-4Hx/-"<NVL N^NuNVH8*n(n&nBHUHx/- n NJfB`B Э @ " Ҁ"A" Э @R mB/-NPHxHSHTN JgHxHS/.N 'MP`^B09H/HxHxHxB/-NHUN +䰭6f +谭:f +찭>f +PgHy {NX'mZ80-4Hr ЭZ '@@0-4H'@HpL8N^NuNV n/(N/. /ahP//9N N^NuNV/. /.a>P//9NP n!@N n (NN^NuNVH *nJ g(B09H/HxBHxB/-NHUN B Э @C "R mHxHnNPL N^NuNVH0.. <D( 98"<N&-yHJo rNJgHy NX .Ї//9NP-@g` "<N* .-@B/9P/ .Ю/NJfF/. .Ї//9N yP/(NXHyNXJg`/.//.a / Ю/ .ЮЇ/a .Ю, *@ " Ҁ(A`DHyHxp0-@/ /HUNp0-@/NXXRe 9Dй@*@ .ЮЇr "9DЁ(@ Юr ,`(XXSJfN-@ .r  yP!@Z yP#Z8 .ЮЇr #@#@߹H0 yPh4 yP0(4Hr W yPШZ!@/.NXJgv/. /NP//./9N `F/./. /9PN JfHxHyNP`n yP NL0N^NuNVH0..,. *@ . (@`8 /Hxp0,@/ /HUNXXRSJfL0N^Nuvgetptvgetuptexpand@zP*|P0 PTQPt|PzP5PQP&PQP7PDPP/PrPPsPP5PUPQP]P|PP$BPsPsPriP~jPUPUPF[PV&PpPPrPP@zP0 P6PZ P` PrPP]PsP sP5P UP(sP83PB@HzPX|P^ PtUPsPQP^P|PPsPPsP"P4QPjGP7PsPsP5PsP5PBP5P sP sP sP *5P 0sP 6sP <sP DsP NsP bsP tjP QP P |P P sP hP P :P sP P QP $QP TGP #,6<CJSW^govt{ t 6 @#-5>HS]dmzt| %,27> FLS^gov~H t!(1:BIS\enw}$ #.5=E NU]Bfntz_nbuf_klseql_resume_rootdev_desscan_bclnlist_mpid_lbolt_ntext_rmalloc_qs_swtch_swapmap_nswdev_nproc_sum_whichqs_vpasspt_avenrun_hostnamelen_runin_inodeNINODE_freemem_rootdir_rate_hostname_distpte_tz_rmfree_desfree_avefree_maxpgio_bswlist_nchrdev_setjmp_boottime_vrelpt_kmapwnt_vmaccess_buffermap_panicstr_nswap_maxfree_vrelu_noproc_vusize_ecmap_vinifod_physmem_mount_dmmaxlmodt_saferss_usrpt_maxslp_clearseg_multprog_rablock_sleep_swptstat_inode_avefree30_buffers_boothowto_argdev_klout_spl7_buf_nscan_kmcopy_tick_mapin_procNPROC_deficit_runout_kltxt_dumpdev_ninode_pidhash_selwait_bcopy_Usrptmap_zdmap_firstfree_nblkdevldivt_rasize_forkstat_cmap_vrelswu_cmhash_setredzone_nswapmap_vmemfree_memall_cnt_dmmin_updlock_klsdist_runrun_vgetu_bufpages_bufhash_minfree_swapout_ctxpass_splx_vgetpt_klin_maxmem_hz_argmap_text_swbuf_swapdev_u_proc_ptexpand_hostid_textNTEXT_wantin_time_panic_total_kernelmap_lotsfree_dumplo_hand_newptes_bfreelist_ncmap_nswbuf_dmtext_vinitpt_mbmap_mapout_vgetswu_curpri_swap_ecmxb[l$ Ubbb LNVJ f 9rN# J fB#2 9rN"9 貀o 9rN# J f6# 9 rN"9 䲀o 9 rN# J f #( f$ 9r ?oHxHy /-:HUN ` f>NJgBBHy`R9BHyNPN`B-| 9 rN".o-|-|-lJJVg lVJ(Ef 0(BHѮ/9 /.NP-@".N"9o2 .ѹHTNXJf/9/.NP&LB o #   l # BB*y`\ -  fB -g8g2JVg mV(Ff-HH o< -f - n -f$-HH".l(M-HH-@`Jf -g -f-mBJVg mV0(@H(EHHNѮ .ذ l""HA HABAЁ-@R`-y n (nF#$|` j .m$HJf n!j%n n!n n eJfH-|$y`.*R-HH-HHЁ-@m(M-@$jfJf$JgfJg . oN ,f HTNXNJgF-lBJVg lV0(@H(EHHNѮ/9 /.NP-@ѹ`B/,>/,:HTN JfT/9/.NP`8NR9BHy`VNVH8 9 rN"9 NrN/ 9r N/NP//9NP 9йrN# 9"HAHABAЁйrN#*|(|&|` ЕrN( ѓBXXXhc 9rNJfѹ 0-Dy-HHS b@0;N - nR - gRy`J - g( - nRy`.-HH lRy`-HH lRy-HH m `6R - gRy`Ry -:Э>ѹ0-Dye 9ѹ 9ѹ09y09 y3"/.Hya PL0N^NuNVH *nB   @/(/ 9 4"9 8N// . NN// " Ҁ A/(/   @ "(NN$& ւ C !AR m|L N^Nu@?qi?x VX?ҝu?WARNING: should run interleaved swap with >= %dMb @ PDPFP"@(@4@: P@DPHFPN@X P^DPfFPl@r@~@@FP@@FP@@@ P%P@P@ PDP FP@@(@2 P:@TFPZ@`@h@p@ePP@@PPGP1PPP@PP@P@bP>@FFPL@RP\@dFPj@pPFP9PP@@D6P\PPd3PtXP6PePeP P;P;P/P3P@FP@&"P6FP<PB:PP:PX*Pf:Pp"Px:P@@@@mPbP@FP@$PmPmPmP9P8mP@6PPP3PFP@"P :P XP0:P:"PB:PL6PRPZPl@tFPz@PFP:PFPP:P"P:PPPFPP1PPFP1PQP PP"YP6QP>fPF)PTQPXP^QPdPjQPpQPtPzQPPQPP@;P@FPbP;PPPZP;PZPP P 7P P :P P &@ 0@ 8P @@ H@ NP X@ `@ jFP r P xDP FP FP P bP ZP ^P FP nP gP gP gP gP _P gP gP d@ pgP zgP dP gP gP gP gP gP gP gP gP gP bP gP gP @gP \gP l@ tgP @ gP @ gP gP gP gP 9P gP gP gP gP gP gP gP gP P gP (P N@ \@ b@ hVP vP |NP @ NP aP $*28DJQX\dktpyt   b "x(1 7x>EKS \ d nw~   : ~  H#.7=CKQ[dl v| t    &.4$; EMSZb js{_klseqllmult_rootdev_desscan_imax_printffflti_setupclock_mpid_lbolt_ntext_qs_nswdev_nproc_sum_whichqs_avenrun_hostnamelen_runin_freemem_rate_hostname_tz_desfree_avefree_maxpgio_nchrdev_boottime_vmmeter_kmapwnt_panicstr_nswap_maxfree_noproc_imin_ecmap_bigp_physmem_cexp_sched_dmmaxlmodt_swapin_saferss_maxslp_multprog_rablock_sleep_swptstat_avefree30_boothowto_spl0_argdev_klout_spl6_nscan_tick_procNPROC_deficit_runout_kltxt_loadav_dumpdev_nbig_pidhash_selwait_slowscan_zdmap_firstfree_nblkdevldivtfcmpi_rasize_cmap_forkstatieeeused_cmhash_fastscanfmuli_vmtotal_remrq_cnt_dmmin_updlock_klsdist_runrunfsubi_minfree_swapoutuldivt_wakeup_schedpaging_klin_maxmem_hz_text_swapdevfaddi_proc_hostid_textNTEXT_wantin_time_total_lotsfree_dumplo_hand_ncmap_dmtext_bplist_timeout_curpri_ecmxb[l $ bbb4tHNVH8*n(n&n BB Э @p0(@k@kXR mHxHT/. a L8N^NuNVH0*n (n..`2HyHx ?/ r /HTNXSJfL0N^NuNVH0*n(n -6ЭZd@ Z`. -6ЭZeJ -6"-6ҭZ$ Ђ`F0-4Hr ЭZ"->偐c0-4Hr ЭZ"< L0N^NuNVH *n.. 6d ЭZ`r "-6遰e6 <>d( -6ЭZ"-6$Ђ`"0-4Hr ЭZ"<偐L N^NuNVH8*n(n .Ю-@&l +0"<N-@` .".N.BHx .".N/HTN"+d-@` . U@鈁UJ9fJlUU@RL`* r "<NЮRH|` " Ҁ A R mXR .g Rml .m L8N^Nu0P:GQXclw~H t%,5>FPY_hnv~$_nbuf_klseql_rootdev_desscan_bclnlist_mpid_ntext_qs_nswdev_nproc_sum_vtopte_whichqs_runin_inodeNINODE_freemem_rootdir_rate_desfree_avefree_maxpgio_bswlist_nchrdev_kmapwnt_vmaccess_buffermap_panicstr_nswap_maxfree_noproc_ecmap_vinifod_physmem_dmmaxlmodt_saferss_maxslp_multprog_rablock_swptstat_inode_avefree30_buffers_boothowto_argdev_klout_buf_nscan_mapin_procNPROC_deficit_runout_kltxt_dumpdev_ninode_pidhash_selwait_zdmap_firstfree_nblkdevldivt_rasize_cmap_forkstat_cmhash_cnt_dmmin_updlock_klsdist_runrun_bufpages_bufhash_bmap_minfree_klin_maxmem_ptetov_text_swbuf_swapdev_u_uaccess_proc_textNTEXT_wantin_total_lotsfree_dumplo_hand_bfreelist_ncmap_nswbuf_dmtext_curpri_ecmxb[l$ {bbb  NV.*n09yf$ -"<N-@ -$ЮoHUN` o -$"9N-@Юn -$"9N-@"9N"HA HABAЁ @=P ."9N-@"9NЮ+@$`=y;nJnfHyNXHU0.H"HAHABAЁ @ PNX*nN^NuNV/. HyHx0. H/HyHzNN^NuNV/. HyB0. H/HyHzbNN^NuNVH0HxBHyN *@gp0-& `gHUNX`x=mPHUNX0.Hm `H(| `40nf&Jg `( r N/a` JTfL0N^NuNVH ."HA HABAЁ @=PHx0.H/0.H"HAHABAЁ @ PNP ."HA HABAЁ @  ."HA HABAЁ @(B` , ."9N$ "9NԀ.mHy#NXo,9Jfl3HxHy*Hx rNY//9N/9Hy1 rN/ rN//9N`///9N ڹm$LN^Nuswstrategyswfreeargmapswap P*P2/PDPTPb PpPvPPP/P PPP P/PPPP@AP8IPV9PhPr'P9PP'PPP>PKP KP .P*>P2PJ>PTP\/Pt>PPIPP"P<PBPL PRP\Pd@jAPrPzPP#P@/P;P2P3P@/P/PP2PPPP %-7=FOW]Lely@@*2~;BGOW_hpyH"-5;FNV]ems_nbuf_swstrategylmult_rootdev_linesw_bclnlist_mpid_oswapon_swapmap_nswdev_file_swread_runin_inodeNINODE_rootdir_namei_rmfree_bswlist_nchrdev_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_biodone_dmmaxlmodt_uchar_rablock_rswbuf_inode_buffers_boothowto_argdev_swwrite_nfile_buf_physio_swfree_runout_dumpdev_ninode_selwait_zdmap_nblkdevldivt_cdevsw_rasize_rminit_nswapmap_dmmin_updlock_runrun_bufpages_bufhash_minphys_maxmem_argmap_swbuf_swapdev_u_fileNFILE_wantin_panic_kernelmap_dumplo_hand_bfreelist_dmtext_nswbuf_mbmap_bdevsw_curpri_iputb[l$ bbb_4NVH0*n(mVg HTNX ->Э:Э6"<N;@4HyHUNPJg.BHyHyHyHUNJf"HUNXg HTNXB`HxHyHUat B  @p0@"ҭ Ar2(AgHyNXR mHyHUNPgHUNXHTNXBBN, -f HUNX - g#L /NXB-RRlpL0N^NuNVH8*n-|-|(|&| 9g" 9f-|(|&|N.` .BHTNP 9f ./NXHSHTHUN HSHUNPJfHyHUNPB`PR'n D'nH HUNXJVg" mV (Ef"H3h@BHU/-VNP+mBJHk/. BHx -6ЭZ/HUNHk8/.BHx0-4Hr ЭZ/HUNJBgHyNXBHSHUa NHxHUNP - g -fPgHyNX HUNX B-SRpJ9gB9HyNX .F 9g .FHTNXJf4N. Pg -f HUNX/NX .L8N^NuNVH8*n(n -6Э:Э>"<N. -6"<N,0-4HfR0-4Hr  `Z0-4HlR`R ,H"<N*0-4HlJDg ,HVg -6ЬD"<N-@ ,HV"<N-@JgJg~ .Ю nnR -6ЬD"<N-@ ./ .r 㠐ЭZ/0-4Hr ЭZ",HS偐/N SJg( r /0-4H/ /HU/.aJDg4 -6ЬD"<Nr //BHU/.aB`: -6ЭZ"Ё&@f 0+@f+gHyNXRDmB`F0-4Hr ЭZ"偐&@f 0+@f+gHyNXRHmL8N^NuNVJoNB09H/Hx/./. .r n ШZ/ (N ".Ё//. N N^Nuswapinswapoutswapout rssizeswapoutswdsptswdsptfBL0N^NuNV.0. "HA HABAЁ*@B*nN^NuNVH<*n0-"HA HABAЁ(@0- @&P$k + /NX-@0-H/aX)m'm 'mB+ HSNX`HxHTNPJn g"0-H/aX (4HUNXHTNX/.NXL<N^NuNV.*n -o+y*nN^NuNV0.  mp`4/. HzB0. H/0. /HzNN^NuNVH00.  @ P*h0. "HA HABAЁ(@`HxHTNP fJfp0 gBL0N^NuNVH8 ."HA HABAЁ*@ . @ P(h&|`(HHg+H9@FHH~2Sn`TJfL8N^NuNVH80.  @*P0. "HA HABAЁ(@0.  @ P&h . vgF @vfZ n - /NX-@0. H/adX g&6`P n. ?"(`p`H g6` BS`0. H/aX0. H/aX >f/.NXBL8N^NuNVH8*n(m0- &@ -gBHSNX9| - @p0@r "--@r9@ -S-@ .9@ .9@ .9@ .9@9|G9|L8N^NuNVH0*n0- (@BHTNXL0N^NuNVH8BB  @*P(m9| BSnp0,g|BSn9|  "HA HABAЁ&@ gp0 gHUNXHSNXR mp L8N^NuNV.*y - /NX-@a./.NX/9BHzN *nN^Nu 6:8  vp!P8.PPLP@@=PN=PPPLP=P*4P:$PvP?P=P@@P,P*LPTPd$PPLP@,LPRPfLP=P$=PPPh?PP*?PLLPPGP?PLP=P=PCP(YP @@@ @$@8@<LP ( 2<BLS\dnw6 @@r $*D4=DOX`jiqy~H :$-598BKRZcnv~_nbuf_vpstrategy_vpprobe_rootdev_vp_softc_mbbufmem_mpid_bclnlist_lbolt_swapmap_nswdev_mbmemmap_avenrun_hostnamelen_runin_vpminphys_vpgo_hostname_tz_rvpbuf_bswlist_nchrdev_boottime_kmapwnt_vpdone_panicstr_nswap_buffermap_noproc_vpopen_physmem_biodone_dmmax_peek_vpdriver_rablock_sleep_boothowto_buffers_vpbits_vpclose_argdev_vptimo_buf_physio_tick_poke_runout_dumpdev_selwait_zdmap_nblkdev_mbgo_rasize_nswapmap_dmmin_updlock_runrun_bufpages_bufhash_vpcmd_splx_vpintr_wakeup_maxmem_vpblock_argmap_hz_vpaddrs_swapdev_swbuf_mbdone_vpwrite_physmbmem_hostid_wantin_vpcinfo_time_iopbmap_kernelmap_dumplo_hand_bfreelist_vpioctl_nswbuf_dmtext_vpwait_mbbufmap_mbmap_timeout_curprib[l$ Abbb%8hNV. . "HADDHABAЁ*@+n - X/NX fB`\ m g m | m gf (fHx/9NP+@$JfHy&NX`|,BBHUa m$p(Jg g/. Hy&NP`f/. Hy&NP+|(`Hx BHUa -@g8 ."HAHABAЁ% @//./. Hy'N m (g/. Hy'!NPRJg*`/. Hy'FNP+|( (g^p*nN^NuNVpN^NuNVH8*n0-D(@0-x&@0-H-@Jf/9BHz!N R0-H" Ҁ A 'Mp'm$tHx/9NP-@JfHy'[NXB+@L8N^NuNVH0*n(n HT "<xN/Hy'~N |@;lB;lDBmF;lH;lJ;lL;lP;lR;lNB l&A . ." Ҁ"A"#hR`Hx/.HTa Jf4 (f-|-|`-|-|B .l:B+A+AHHl nBh/././.HTaRJgN/././. "<xN/a Jg /.HSaPHxHSaPJg B+@R+A`zHxB n0(S/0(2(ЁS//.  @p0@r "./HxHTa HTaXJgBA .0R ~mHy'NX/.Hx/9N J+@fB l ." Ҁ AB ." Ҁ ABR` n <Cx"Q`R`L mpJhmp0-N-@Jop0-L".e-|p0-L"HA< g6 ."HAHABAЁ% @//./Hy'NB` m (`g |@|Sn m |`-AHHr,-HH€gB " Ҁ A$Pgg*A-AfAB-H0Pf(0+hf0+hf0+hf 0+ h gL "<xN/-AHH/ "<xN/Hy'Np`R mL`-AHHrᡃ,- mp0(H.J gtp0+/p0+ S/p0+S/p0r2+ЁS//BHx HTa@ HTaXJg( "<xN/Hy'NP`p0r2+Ёr2+Nr2+ NS-@Bp0+r /B/.Hx "<xN/a `pL0N^NuNVH *n (g m (L N^NuNVH0*n`~Sn m (f(m$HUaX,g ,&cp&` p,`BL0N^NuNV.*n mھfHUa"XJfL/.Hy(NPB*nN^NuNVBn=|-n0.SnJ@gp n0nT` mcp0-//.Hy((N ` . gJmgJmg . g|p0-fnp`jJngRm> nHAm$Bm>0-@Rm@ n(HAmBm@ %~mHy(/.HS/aAfX ,ifNB,@ lpJhm lp0(H @ &0+/Hy(NP` %~mHy(/.HS/a^0+HrN& "HAxxHABAЁp @ P0(H&|BBBBB/BHxHUa~ ` %~mHy)/.HS/a/.a:`d fAf ,if0-/.NXDDe0 L/././.HjxN-@m .r ѭ2 .ѭ60.m:0.m< n %~mDHy) Hy&l/.p+/a:/./././.Hy)Np0*Br2*DЁr2*HNr2*LN-@p0*L".䒀S-A-|`+gHJ+gB +g0 %~m$Hy):Hy&r/.p+/ap+` .r ѭ2 .ѭ60.m:0.m<-m60- xyattach: can't get bad sector info xy%d: error %x reading label: %s xy%d: drive type %d clash with xy%d xy%d: initialization failed xy%d: Corrupt label xy%d: Unsupported phys partition # %d xy%d: unit not online xyopen: no buffer for disk label xygo queueing error 1xygo queueing error 2xyintr: intr while busy xyintr: bad bp fixedfailedxy%d: offline restoreretryfixedfixed(forwarding %d/%d/%d -> alt blk # %d) errorxy%d%c: %s %s (%s) blk %d err at blk %d - %s xyxycno errorinterrupt pendingerror pendingbusy conflictoperation timeoutread err - header 2CRC/hard ECC errorcyl addr errorunknown 08sector slip errorsector addr errorunknown 0bunknown 0clast sector too smallmemory addr errorunknown 0funknown 10unknown 11seek err - header 1unknown 13write protectbad commanddrive not readyzero sector countdrive faultbad sector sizeself test error aself test error bself test error cunknown 1dsoft ECC errorfixed ECC errorhead errordisk sequencer errorunknown 22unknown 23unknown 24transfer errorundefined errorforwarding bad blockbad block forward failednopwritereadseekresetformatread allstatuswrite all_P4Pr~PxP@ P@ P@ P*@<@B P`@f P@ P_P&P|PoPP |P.~P4PF@L Pv&PSP@ P&PSP@ P~P%PVgP\ Pf@l@rPx'PP_P&PSP@@@&@, P&PSP&PSP@ P&PSP@ PPP &P "SP @ P @@ F P JP p@ B7P ^&P @ P @ P ~P P l_P P&PSP~P%P7P&P7P<&PL7PgPhP=PhP(4PL7Pd&PhP:P?PPmPVPPDP&&P6_PN7PnSPPP(&P8_PF P^ PTP_P@}P7P2&PF@L}P^GPrgPgPGPSP6SPP>PP(_Pd@j P_PSPPP&P"P:PH@N P@@@ @d@l@P@@ P@@7P,&Pf@n@tP_PPPv@~@@lP@@ @:@@ P^PjP@@@0gPHGP\gPp7P_P7P0&P|@7P7P@ P4PH7Pd&P7P7PePEP 7P "&P N7P l7P eP EP 7P &P 7P!_P!zbP!P!sP"P".P"FP"RP"P"P"P#P#&P#,P#N&P#ZSP#r&P#zoP#P#7P#&P#7P#_P$2GP$FgP$ZgP$nGP%@%@% P @@@@@ @$@0@4P8@<PL@R@X@^@d@j@p@v@|@@@@@@@@@@@@@@@@@@@@@@@@ @@@@$@*@0@6@<@P@T@X@\@`@d@h@l@p@t@x@  &/7@GP Yagq{& 2%~ #%( 2;?GPY@bku~&4$*2 :#BGPX^env}H B * %D$D-5=CMV_ipv{ l` "-5;F%8OW_\gp8{ _nbuf_xystrategy_suser_xyioctl_rootdev_linesw_xydinfo_peekc_uprintf_islabel_printffflti_mbbufmem_bclnlist_mpid_lbolt_rmalloc_cp_time_xydone_swapmap_nswdev_cmdnames_xyprobe_mbmemmap_xyopenulmult_xyerrlvl_avenrun_hostnamelen_runinfdivi_xywatch_xyerrors_xyslave_hostname_dk_time_tz_rmfree_xyunitsfsinglei_bswlist_nchrdev_boottime_kmapwnt_buffermap_panicstr_nswap_noproc_swdevt_physmem_xystart_xyecc_biodone_xythrottle_dmmaxlmodt_xyread_rablock_sleep_buffers_boothowto_disksort_dk_xfer_spl0_argdev_simple_xydump_buf_dk_seek_physio_tickulmodt_tk_nout_runout_bzero_dumpdev_xygo_xyintr_xyattach_selwait_zdmap_nblkdev_clrintldivt_mbgo_cdevsw_rasizeDiagRetieeeused_xyustart_nswapmap_usegeom_xycdriver_dmmin_updlock_xyctlrs_tk_nin_runrun_mbio_bufpages_bufhash_minphys_getlabeluldivt_splx_cpu_xywait_xyrstart_isbad_wakeup_maxmem_hz_argmap_swbuf_swapdev_u_mbdone_uselabel_ck_cksum_physmbmem_xysize_hostid_wantin_time_xywstart_panic_iopbmap_kernelmap_dumplo_hand_bfreelist_xyaddrs_dmtext_nswbuf_errmsg_dk_busy_xycommand_mbbufmap_mbmap_xywrite_xyticks_bdevsw_biowait_xycmd_timeout_xycinfo_dk_mspw_curpri_dk_wdsb[l$ bbb#define NAR 2 b[l݁$ bbb#define NBK 1 b[lҁ$ bbb#define NCG 1 b[l죁$ bbb#define NDD 2 #define NDDC 1 b[l쩁$ bbb#define NDECNET 0 b[l즁$ bbb#define NDSD 0 b[l죁$ bbb#define NEC 2 b[l욁$ bbb#define NEFS 0 b[l얁$ bbb#define NEN 1 b[l쎁$ bbb#define NETHER 1 b[l쌁$ bbb#define NIMP 0 b[l삁$ bbb#define NINET 1 b[lo$ bbb#define NIP 4 #define NIPC 2 b[lw$ bbb#define NLOOP 1 b[lu$ bbb#define NMB 1 b[ll$ bbb#define NMS 1 b[lY$ bbb#define NMT 2 #define NTM 2 b[lc$ bbb#define NND 1 b[l]$ bbb#define NOCT 1 b[lW$ bbb#define NPTY 1 b[lS$ bbb#define NPUP 0 b[lO$ bbb#define NSU 1 b[lJ$ bbb#define NTB 0 b[lA$ bbb#define NVP 2 b[l<$ bbb#define NWIN 0 b[l)$ bbb#define NXY 2 #define NXYC 1 b[li$ bG :byu /* pup.h 4.5 82/04/10 */ /* * PUP port addressing. */ struct pupport { u_char pp_net; u_char pp_host; u_long pp_socket; }; /* * PUP header. */ struct pup_header { u_short pup_length; u_char pup_tcontrol; /* transport control */ u_char pup_type; /* protocol type */ u_long pup_id; /* used by protocols */ struct pupport pup_dport, pup_sport; #define pup_dnet pup_dport.pp_net #define pup_dhost pup_dport.pp_host #define pup_dsocket pup_dport.pp_socket #define pup_snet pup_sport.pp_net #define pup_shost pup_sport.pp_host #define pup_ssocket pup_sport.pp_socket }; #define PUP_TRACE 01 /* trace pup in network */ /* * A sockaddr, as seen through the eyes of PUP. */ struct sockaddr_pup { short spup_family; short spup_zero1; struct pupport spup_addr; char spup_zero2[4]; }; #define sp_net spup_addr.pp_net #define sp_host spup_addr.pp_host #define sp_socket spup_addr.pp_socket b[lic$ b} byv +/* pup_proto.c 5.2 82/08/01 */ #include "../h/param.h" #include "../h/socket.h" #include "../h/protosw.h" #include "../h/domain.h" /* * PUP-I protocol family: raw interface */ int rpup_output(); extern int raw_usrreq(); struct protosw pupsw[] = { { SOCK_RAW, PF_PUP, 0, PR_ATOMIC|PR_ADDR, 0, rpup_output, 0, 0, raw_usrreq, 0, 0, 0, 0, }, }; struct domain pupdomain = { AF_PUP, "pup", pupsw, &pupsw[sizeof(pupsw)/sizeof(pupsw[0])] }; b[lih΁$ bD 7by} n/* if_imp.h 4.6 82/03/19 */ /* * Structure of IMP 1822 long leader. */ struct control_leader { u_char dl_format; /* leader format */ u_char dl_network; /* src/dest network */ u_char dl_flags; /* leader flags */ u_char dl_mtype; /* message type */ u_char dl_htype; /* handling type */ u_char dl_host; /* host number */ u_short dl_imp; /* imp field */ u_char dl_link; /* link number */ u_char dl_subtype; /* message subtype */ }; struct imp_leader { struct control_leader il_dl; #define il_format il_dl.dl_format #define il_network il_dl.dl_network #define il_flags il_dl.dl_flags #define il_mtype il_dl.dl_mtype #define il_htype il_dl.dl_htype #define il_host il_dl.dl_host #define il_imp il_dl.dl_imp #define il_link il_dl.dl_link #define il_subtype il_dl.dl_subtype u_short il_length; /* message length */ }; #define IMP_DROPCNT 2 /* # of noops from imp to ignore */ /* insure things are even... */ #define IMPMTU ((8159 / NBBY) & ~01) /* * IMP-host flags */ #define IMP_NFF 0xf /* 96-bit (new) format */ #define IMP_TRACE 0x8 /* trace message route */ #define IMP_DMASK 0x3 /* host going down mask */ /* * IMP-host message types. */ #define IMPTYPE_DATA 0 /* data for protocol */ #define IMPTYPE_BADLEADER 1 /* leader error */ #define IMPTYPE_DOWN 2 /* imp going down */ #define IMPTYPE_NOOP 4 /* noop seen during initialization */ #define IMPTYPE_RFNM 5 /* request for new messages */ #define IMPTYPE_HOSTDEAD 6 /* host doesn't respond */ #define IMPTYPE_HOSTUNREACH 7 /* host unreachable */ #define IMPTYPE_BADDATA 8 /* data error */ #define IMPTYPE_INCOMPLETE 9 /* incomplete message, send rest */ #define IMPTYPE_RESET 10 /* reset complete */ /* non-blocking IMP interface */ #define IMPTYPE_RETRY 11 /* IMP refused, try again */ #define IMPTYPE_NOTIFY 12 /* IMP refused, will notify */ #define IMPTYPE_TRYING 13 /* IMP refused, still rexmt'ng */ #define IMPTYPE_READY 14 /* ready for next message */ /* * IMPTYPE_DOWN subtypes. */ #define IMPDOWN_GOING 0 /* 30 secs */ #define IMPDOWN_PM 1 /* hardware PM */ #define IMPDOWN_RELOAD 2 /* software reload */ #define IMPDOWN_RESTART 3 /* emergency restart */ /* * IMPTYPE_BADLEADER subtypes. */ #define IMPLEADER_ERR 0 /* error flip-flop set */ #define IMPLEADER_SHORT 1 /* leader < 80 bits */ #define IMPLEADER_TYPE 2 /* illegal type field */ #define IMPLEADER_OPPOSITE 3 /* opposite leader type */ /* * IMPTYPE_HOSTDEAD subtypes. */ #define IMPHOST_NORDY 1 /* ready-line negated */ #define IMPHOST_TARDY 2 /* tardy receiving mesgs */ #define IMPHOST_NOEXIST 3 /* NCC doesn't know host */ #define IMPHOST_IMPSOFT 4 /* IMP software won't allow mesgs */ #define IMPHOST_PM 5 /* host down for scheduled PM */ #define IMPHOST_HARDSCHED 6 /* " " " " hardware work */ #define IMPHOST_SOFTSCHED 7 /* " " " " software work */ #define IMPHOST_RESTART 8 /* host down for emergency restart */ #define IMPHOST_POWER 9 /* down because of power outage */ #define IMPHOST_BREAKPOINT 10 /* host stopped at a breakpoint */ #define IMPHOST_HARDWARE 11 /* hardware failure */ #define IMPHOST_NOTUP 12 /* host not scheduled to be up */ /* 13-14 currently unused */ #define IMPHOST_COMINGUP 15 /* host in process of coming up */ /* * IMPTYPE_HOSTUNREACH subtypes. */ #define IMPREACH_IMP 0 /* destination IMP can't be reached */ #define IMPREACH_HOSTUP 1 /* destination host isn't up */ #define IMPREACH_LEADER 2 /* host doesn't support long leader */ #define IMPREACH_PROHIBITED 3 /* communication is prohibited */ /* * IMPTYPE_INCOMPLETE subtypes. */ #define IMPCOMPLETE_SLOW 0 /* host didn't take data fast enough */ #define IMPCOMPLETE_TOOLONG 1 /* message was too long */ #define IMPCOMPLETE_TIMEOUT 2 /* mesg transmission time > 15 sec. */ #define IMPCOMPLETE_FAILURE 3 /* IMP/circuit failure */ #define IMPCOMPLETE_NOSPACE 4 /* no resources within 15 sec. */ #define IMPCOMPLETE_IMPIO 5 /* src IMP I/O failure during receipt */ /* * IMPTYPE_RETRY subtypes. */ #define IMPRETRY_BUFFER 0 /* IMP buffer wasn't available */ #define IMPRETRY_BLOCK 1 /* connection block unavailable */ /* * Data structure shared between IMP protocol module and hardware * interface driver. Used to allow layering of IMP routines on top * of varying device drivers. NOTE: there's a possible problem * with ambiguity in the ``unit'' definition which is implicitly * shared by the both IMP and device code. If we have two IMPs, * with each on top of a device of the same unit, things won't work. * The assumption is if you've got multiple IMPs, then they all run * on top of the same type of device, or they must have different units. */ struct impcb { char ic_oactive; /* output in progress */ int (*ic_init)(); /* hardware init routine */ int (*ic_start)(); /* hardware start output routine */ }; /* * State of an IMP. */ #define IMPS_DOWN 0 /* unavailable, don't use */ #define IMPS_GOINGDOWN 1 /* been told we go down soon */ #define IMPS_INIT 2 /* coming up */ #define IMPS_UP 3 /* ready to go */ #define IMPS_RESET 4 /* reset in progress */ #define IMPTV_DOWN (30*60) /* going down timer 30 secs */ #ifdef IMPLEADERS char *impleaders[IMPTYPE_READY+1] = { "DATA", "BADLEADER", "DOWN", "bad", "NOOP", "RFNM", "HOSTDEAD", "HOSTUNREACH", "BADDATA", "INCOMPLETE", "RESET", "RETRY", "NOTIFY", "TRYING", "READY" }; #endif b[li$ bE 8by} /* if_imphost.h 4.6 82/04/25 */ /* * Host structure used with IMP's. * Used to hold outgoing packets which * would exceed allowed RFNM count. * * These structures are packed into * mbuf's and kept as small as possible. */ struct host { struct mbuf *h_q; /* holding queue */ struct in_addr h_addr; /* host's address */ u_char h_qcnt; /* size of holding q */ u_char h_timer; /* used to stay off deletion */ u_char h_rfnm; /* # outstanding rfnm's */ u_char h_flags; /* see below */ }; /* * A host structure is kept around (even when there are no * references to it) for a spell to avoid constant reallocation * and also to reflect IMP status back to sites which aren't * directly connected to the IMP. When structures are marked * free, a timer is started; when the timer expires the structure * is scavenged. */ #define HF_INUSE 0x1 #define HF_DEAD (1<>8)+(a).s_net) % HPMBUF) #endif /* * In-line expansions for queuing operations on * host message holding queue. Queue is maintained * as circular list with the head pointing to the * last message in the queue. */ #define HOST_ENQUE(hp, m) { \ register struct mbuf *n; \ (hp)->h_qcnt++; \ if ((n = (hp)->h_q) == 0) \ (hp)->h_q = (m)->m_act = (m); \ else { \ (m)->m_act = n->m_act; \ (hp)->h_q = n->m_act = (m); \ } \ } #define HOST_DEQUE(hp, m) { \ if ((m) = (hp)->h_q) { \ if ((m)->m_act == (m)) \ (hp)->h_q = 0; \ else { \ (m) = (m)->m_act; \ (hp)->h_q->m_act = (m)->m_act; \ } \ (hp)->h_qcnt--; \ (m)->m_act = 0; \ } \ } struct hmbuf { int hm_count; /* # of struct's in use */ struct host hm_hosts[HPMBUF]; /* data structures proper */ }; #ifdef KERNEL struct host *hostlookup(); struct host *hostenter(); struct mbuf *hostdeque(); #endif b[  liӁ$ \b by/* acct.h 4.5 82/10/10 */ /* * Accounting structures; * these use a comp_t type which is a 3 bits base 8 * exponent, 13 bit fraction ``floating point'' number. */ typedef u_short comp_t; struct acct { char ac_comm[10]; /* Accounting command name */ comp_t ac_utime; /* Accounting user time */ comp_t ac_stime; /* Accounting system time */ comp_t ac_etime; /* Accounting elapsed time */ time_t ac_btime; /* Beginning time */ short ac_uid; /* Accounting user ID */ short ac_gid; /* Accounting group ID */ short ac_mem; /* average memory usage */ comp_t ac_io; /* number of disk IO blocks */ dev_t ac_tty; /* control typewriter */ char ac_flag; /* Accounting flag */ }; #define AFORK 0001 /* has executed fork, but no exec */ #define ASU 0002 /* used super-user privileges */ #define ACOMPAT 0004 /* used compatibility mode */ #define ACORE 0010 /* dumped core */ #define AXSIG 0020 /* killed by a signal */ #define ACCTLO 30 /* acctg off when space < this */ #define ACCTHI 100 /* acctg resumes at this level */ #ifdef KERNEL struct acct acctbuf; struct inode *acctp; #endif b[  l b by{/* %M% %I% %E% */ /* * Macro definition of bk.c/netinput(). * This is used to replace a call to * (*linesw[tp->t_line].l_rint)(c,tp); * with * * if (tp->t_line == NETLDISC) * BKINPUT(c, tp); * else * (*linesw[tp->t_line].l_rint)(c,tp); */ #define BKINPUT(c, tp) { \ if ((tp)->t_rec == 0) { \ *(tp)->t_cp++ = c; \ if (++(tp)->t_inbuf == 1024 || (c) == '\n') { \ (tp)->t_rec = 1; \ wakeup((caddr_t)&(tp)->t_rawq); \ } \ } \ } b[ liW؁$ b by/* buf.h 4.21 83/03/26 */ /* * The header for buffers in the buffer pool and otherwise used * to describe a block i/o request is given here. The routines * which manipulate these things are given in bio.c. * * Each buffer in the pool is usually doubly linked into 2 lists: * hashed into a chain by so it can be located in the cache, * and (usually) on (one of several) queues. These lists are circular and * doubly linked for easy removal. * * There are currently three queues for buffers: * one for buffers which must be kept permanently (super blocks) * one for buffers containing ``useful'' information (the cache) * one for buffers containing ``non-useful'' information * (and empty buffers, pushed onto the front) * The latter two queues contain the buffers which are available for * reallocation, are kept in lru order. When not on one of these queues, * the buffers are ``checked out'' to drivers which use the available list * pointers to keep track of them in their i/o active queues. */ /* * Bufhd structures used at the head of the hashed buffer queues. * We only need three words for these, so this abbreviated * definition saves some space. */ struct bufhd { long b_flags; /* see defines below */ struct buf *b_forw, *b_back; /* fwd/bkwd pointer in chain */ }; struct buf { long b_flags; /* too much goes here to describe */ struct buf *b_forw, *b_back; /* hash chain (2 way street) */ struct buf *av_forw, *av_back; /* position on free list if not BUSY */ #define b_actf av_forw /* alternate names for driver queue */ #define b_actl av_back /* head - isn't history wonderful */ long b_bcount; /* transfer count */ long b_bufsize; /* size of allocated buffer */ #define b_active b_bcount /* driver queue head: drive active */ short b_error; /* returned after I/O */ dev_t b_dev; /* major+minor device name */ union { caddr_t b_addr; /* low order core address */ int *b_words; /* words for clearing */ struct fs *b_fs; /* superblocks */ struct csum *b_cs; /* superblock summary information */ struct cg *b_cg; /* cylinder group block */ struct dinode *b_dino; /* ilist */ daddr_t *b_daddr; /* indirect block */ } b_un; daddr_t b_blkno; /* block # on device */ long b_resid; /* words not transferred after error */ #define b_errcnt b_resid /* while i/o in progress: # retries */ struct proc *b_proc; /* proc doing physical or swap I/O */ int (*b_iodone)(); /* function called by iodone */ int b_pfcent; /* center page when swapping cluster */ #ifdef sun caddr_t b_saddr; /* saved address */ short b_kmx; /* saved kernelmap index */ short b_npte; /* number of pte's mapped */ #endif }; #define BQUEUES 4 /* number of free buffer queues */ #define BQ_LOCKED 0 /* super-blocks &c */ #define BQ_LRU 1 /* lru, useful buffers */ #define BQ_AGE 2 /* rubbish */ #define BQ_EMPTY 3 /* buffer headers with no memory */ #ifdef KERNEL #define BUFHSZ 63 #define RND (MAXBSIZE/DEV_BSIZE) #define BUFHASH(dev, dblkno) \ ((struct buf *)&bufhash[((int)(dev)+(((int)(dblkno))/RND)) % BUFHSZ]) struct buf *buf; /* the buffer pool itself */ char *buffers; int nbuf; /* number of buffer headers */ int bufpages; /* number of memory pages in the buffer pool */ struct buf *swbuf; /* swap I/O headers */ int nswbuf; struct bufhd bufhash[BUFHSZ]; /* heads of hash lists */ struct buf bfreelist[BQUEUES]; /* heads of available lists */ struct buf bswlist; /* head of free swap header list */ struct buf *bclnlist; /* head of cleaned page list */ struct buf *alloc(); struct buf *realloccg(); struct buf *baddr(); struct buf *getblk(); struct buf *geteblk(); struct buf *getnewbuf(); struct buf *bread(); struct buf *breada(); unsigned minphys(); #endif /* * These flags are kept in b_flags. */ #define B_WRITE 0x000000 /* non-read pseudo-flag */ #define B_READ 0x000001 /* read when I/O occurs */ #define B_DONE 0x000002 /* transaction finished */ #define B_ERROR 0x000004 /* transaction aborted */ #define B_BUSY 0x000008 /* not on av_forw/back list */ #define B_PHYS 0x000010 /* physical IO */ #define B_XXX 0x000020 /* was B_MAP, alloc UNIBUS on pdp-11 */ #define B_WANTED 0x000040 /* issue wakeup when BUSY goes off */ #define B_AGE 0x000080 /* delayed write for correct aging */ #define B_ASYNC 0x000100 /* don't wait for I/O completion */ #define B_DELWRI 0x000200 /* write at exit of avail list */ #define B_TAPE 0x000400 /* this is a magtape (no bdwrite) */ #define B_UAREA 0x000800 /* add u-area to a swap operation */ #define B_PAGET 0x001000 /* page in/out of page table space */ #define B_DIRTY 0x002000 /* dirty page to be pushed out async */ #define B_PGIN 0x004000 /* pagein op, so swap() can count it */ #define B_CACHE 0x008000 /* did bread find us in the cache ? */ #define B_INVAL 0x010000 /* does not contain valid info */ #define B_LOCKED 0x020000 /* locked in core (not reusable) */ #define B_HEAD 0x040000 /* a buffer header, not a buffer */ #define B_BAD 0x100000 /* bad block revectoring in progress */ #define B_CALL 0x200000 /* call b_iodone from iodone */ /* * Insq/Remq for the buffer hash lists. */ #define bremhash(bp) { \ (bp)->b_back->b_forw = (bp)->b_forw; \ (bp)->b_forw->b_back = (bp)->b_back; \ } #define binshash(bp, dp) { \ (bp)->b_forw = (dp)->b_forw; \ (bp)->b_back = (dp); \ (dp)->b_forw->b_back = (bp); \ (dp)->b_forw = (bp); \ } /* * Insq/Remq for the buffer free lists. */ #define bremfree(bp) { \ (bp)->av_back->av_forw = (bp)->av_forw; \ (bp)->av_forw->av_back = (bp)->av_back; \ } #define binsheadfree(bp, dp) { \ (dp)->av_forw->av_back = (bp); \ (bp)->av_forw = (dp)->av_forw; \ (dp)->av_forw = (bp); \ (bp)->av_back = (dp); \ } #define binstailfree(bp, dp) { \ (dp)->av_back->av_forw = (bp); \ (bp)->av_back = (dp)->av_back; \ (dp)->av_back = (bp); \ (bp)->av_forw = (dp); \ } /* * Take a buffer off the free list it's on and * mark it as being use (B_BUSY) by a device. */ #define notavail(bp) { \ int x = spl6(); \ bremfree(bp); \ (bp)->b_flags |= B_BUSY; \ splx(x); \ } #define iodone biodone #define iowait biowait /* * Zero out a buffer's data portion. */ #define clrbuf(bp) { \ blkclr(bp->b_un.b_addr, bp->b_bcount); \ bp->b_resid = 0; \ } #ifdef sun /* * Declarations for buffer space rmaps */ struct map *buffermap; #define BUFMAPSIZE 256 /* * "Average" size of a buffer * nbuf*AVGBSIZE is total amount of buffer data */ #define AVGBSIZE 2048 /* * Unit of buffer space allocation */ #define BUFALLOCSIZE 1024 #endif b[ li^$ b by/* callout.h 4.6 81/04/18 */ /* * The callout structure is for * a routine arranging * to be called by the clock interrupt * (clock.c) with a specified argument, * in a specified amount of time. * Used, for example, to time tab * delays on typewriters. */ struct callout { int c_time; /* incremental time */ caddr_t c_arg; /* argument to routine */ int (*c_func)(); /* routine */ struct callout *c_next; }; #ifdef KERNEL struct callout *callfree, *callout, calltodo; int ncallout; #endif b[ liU$ b by/* clist.h 4.4 81/03/09 */ /* * Raw structures for the character list routines. */ struct cblock { struct cblock *c_next; char c_info[CBSIZE]; }; #ifdef KERNEL struct cblock *cfree; int nclist; struct cblock *cfreelist; int cfreecount; #endif b[li~H$ b by/* cmap.h 4.5 81/03/09 */ /* * core map entry */ struct cmap { unsigned int c_next:13, /* index of next free list entry */ c_prev:13, /* index of previous free list entry */ c_mdev:4, /* which mounted dev this is from */ c_lock:1, /* locked for raw i/o or pagein */ c_want:1, /* wanted */ c_page:16, /* virtual page number in segment */ c_hlink:13, /* hash link for */ c_intrans:1, /* intransit bit */ c_free:1, /* on the free list */ c_gone:1, /* associated page has been released */ c_type:2, /* type CSYS or CTEXT or CSTACK or CDATA */ c_blkno:20, /* disk block this is a copy of */ c_ndx:10; /* index of owner proc or text */ }; #define CMHEAD 0 /* * Shared text pages are not totally abandoned when a process * exits, but are remembered while in the free list hashed by * off the cmhash structure so that they can be reattached * if another instance of the program runs again soon. */ #define CMHSIZ 512 /* SHOULD BE DYNAMIC */ #define CMHASH(bn) ((bn)&(CMHSIZ-1)) #ifdef KERNEL struct cmap *cmap; struct cmap *ecmap; int ncmap; struct cmap *mfind(); int firstfree, maxfree; int ecmx; /* cmap index of ecmap */ short cmhash[CMHSIZ]; #endif /* bits defined in c_type */ #define CSYS 0 /* none of below */ #define CTEXT 1 /* belongs to shared text segment */ #define CDATA 2 /* belongs to data segment */ #define CSTACK 3 /* belongs to stack segment */ #define pgtocm(x) ((((x)-firstfree) / CLSIZE) + 1) #define cmtopg(x) ((((x)-1) * CLSIZE) + firstfree) b[ld<$ Sbrby/* conf.h 4.11 83/04/30 */ /* * Declaration of block device * switch. Each entry (row) is * the only link between the * main unix code and the driver. * The initialization of the * device switches is in the * file conf.c. */ struct bdevsw { int (*d_open)(); int (*d_close)(); int (*d_strategy)(); int (*d_dump)(); int d_flags; }; #ifdef KERNEL struct bdevsw bdevsw[]; #endif /* * Character device switch. */ struct cdevsw { int (*d_open)(); int (*d_close)(); int (*d_read)(); int (*d_write)(); int (*d_ioctl)(); int (*d_stop)(); int (*d_reset)(); struct tty *d_ttys; int (*d_select)(); int (*d_mmap)(); }; #ifdef KERNEL struct cdevsw cdevsw[]; #endif /* * tty line control switch. */ struct linesw { int (*l_open)(); int (*l_close)(); int (*l_read)(); int (*l_write)(); int (*l_ioctl)(); int (*l_rint)(); int (*l_rend)(); int (*l_meta)(); int (*l_start)(); int (*l_modem)(); }; #ifdef KERNEL struct linesw linesw[]; #endif /* * Swap device information */ struct swdevt { dev_t sw_dev; int sw_freed; int sw_nblks; }; #ifdef KERNEL struct swdevt swdevt[]; #endif b[ li~$ b by/* descrip.h 5.1 83/04/08 */ #define DNSTD 5 /* number of standard descriptors */ /* offsets of standard descriptors from dstd() */ #define DOFF_KERNEL 0 /* descriptor of kernel */ #define DOFF_IPC 1 /* UNIX ipc domain */ #define DOFF_ROOT 2 /* root directory */ #define DOFF_DOT 3 /* current directory */ #define DOFF_TERMINAL 4 /* terminal, used in /dev/tty */ /* types of descriptors */ #define DTYPE_KERNEL 1 /* handle to UNIX kernel */ #define DTYPE_FILESYS 2 /* handle to file system */ #define DTYPE_FILE 3 /* file */ #define DTYPE_DIR 4 /* directory */ #define DTYPE_BDEV 5 /* structured device */ #define DTYPE_CDEV 6 /* unstructured device */ #define DTYPE_PROCESS 7 /* process control handle */ #define DTYPE_SOCKET 8 /* communications endpoint */ #define DTYPE_DOMAIN 9 /* communications domain */ #define DTYPE_TERMINAL 10 /* terminal */ /* descriptor type structure for dtype and dwrap */ struct dtype { int dt_type; /* object type */ int dt_protocol; /* protocol implementing type */ }; #define DOPT_INPUT 0x1 /* apply to input */ #define DOPT_OUTPUT 0x2 /* apply to output */ #define DOPT_EXCEPT 0x4 /* apply to any exceptional conditions */ /* structure for get/setdopt */ struct dopt { int do_flags; /* see below */ int do_sig; /* see signal.h */ }; #define DOFLAG_DONTBLOCK 0x1 /* use non-blocking i/o */ #define DOFLAG_SIGNALPROC 0x2 /* send signal when i/o possible */ #define DOFLAG_SIGNALPGRP 0x4 /* signal process group */ b[#lixc$ b by/* dir.h 4.5 82/11/13 */ /* * A directory consists of some number of blocks of DIRBLKSIZ * bytes, where DIRBLKSIZ is chosen such that it can be transferred * to disk in a single atomic operation (e.g. 512 bytes on most machines). * * Each DIRBLKSIZ byte block contains some number of directory entry * structures, which are of variable length. Each directory entry has * a struct direct at the front of it, containing its inode number, * the length of the entry, and the length of the name contained in * the entry. These are followed by the name padded to a 4 byte boundary * with null bytes. All names are guaranteed null terminated. * The maximum length of a name in a directory is MAXNAMLEN. * * The macro DIRSIZ(dp) gives the amount of space required to represent * a directory entry. Free space in a directory is represented by * entries which have dp->d_reclen > DIRSIZ(dp). All DIRBLKSIZ bytes * in a directory block are claimed by the directory entries. This * usually results in the last entry in a directory having a large * dp->d_reclen. When entries are deleted from a directory, the * space is returned to the previous entry in the same directory * block by increasing its dp->d_reclen. If the first entry of * a directory block is free, then its dp->d_ino is set to 0. * Entries other than the first in a directory do not normally have * dp->d_ino set to 0. */ /* so user programs can just include dir.h */ #if !defined(KERNEL) && !defined(DEV_BSIZE) #define DEV_BSIZE 512 #endif #define DIRBLKSIZ DEV_BSIZE #define MAXNAMLEN 255 struct direct { u_long d_ino; /* inode number of entry */ u_short d_reclen; /* length of this record */ u_short d_namlen; /* length of string in d_name */ char d_name[MAXNAMLEN + 1]; /* name must be no longer than this */ }; /* * The DIRSIZ macro gives the minimum record length which will hold * the directory entry. This requires the amount of space in struct direct * without the d_name field, plus enough space for the name with a terminating * null byte (dp->d_namlen+1), rounded up to a 4 byte boundary. */ #undef DIRSIZ #define DIRSIZ(dp) \ ((sizeof (struct direct) - (MAXNAMLEN+1)) + (((dp)->d_namlen+1 + 3) &~ 3)) #ifndef KERNEL /* * Definitions for library routines operating on directories. */ typedef struct _dirdesc { int dd_fd; long dd_loc; long dd_size; char dd_buf[DIRBLKSIZ]; } DIR; #ifndef NULL #define NULL 0 #endif extern DIR *opendir(); extern struct direct *readdir(); extern long telldir(); extern void seekdir(); #define rewinddir(dirp) seekdir((dirp), (long)0) extern void closedir(); #endif #ifdef KERNEL /* * Template for manipulating directories. * Should use struct direct's, but the name field * is MAXNAMLEN - 1, and this just won't do. */ struct dirtemplate { u_long dot_ino; short dot_reclen; short dot_namlen; char dot_name[4]; /* must be multiple of 4 */ u_long dotdot_ino; short dotdot_reclen; short dotdot_namlen; char dotdot_name[4]; /* ditto */ }; #endif b['li$ }b by/* dk.h 4.2 81/02/19 */ /* * Instrumentation */ #define CPUSTATES 4 #define CP_USER 0 #define CP_NICE 1 #define CP_SYS 2 #define CP_IDLE 3 #define DK_NDRIVE 4 #ifdef KERNEL long cp_time[CPUSTATES]; int dk_busy; long dk_time[DK_NDRIVE]; long dk_seek[DK_NDRIVE]; long dk_xfer[DK_NDRIVE]; long dk_wds[DK_NDRIVE]; float dk_mspw[DK_NDRIVE]; long tk_nin; long tk_nout; #endif b[)li~$ =b by/* dkbad.h 4.3 81/05/10 */ /* * Definitions needed to perform bad sector * revectoring ala DEC STD 144. * * The bad sector information is located in the * first 5 even numbered sectors of the last * track of the disk pack. There are five * identical copies of the information, described * by the dkbad structure. * * Replacement sectors are allocated starting with * the first sector before the bad sector information * and working backwards towards the beginning of * the disk. A maximum of 126 bad sectors are supported. * The position of the bad sector in the bad sector table * determines which replacement sector it corresponds to. * * The bad sector information and replacement sectors * are conventionally only accessible through the * 'c' file system partition of the disk. If that * partition is used for a file system, the user is * responsible for making sure that it does not overlap * the bad sector information or any replacement sector.s */ struct dkbad { long bt_csn; /* cartridge serial number */ u_short bt_mbz; /* unused; should be 0 */ u_short bt_flag; /* -1 => alignment cartridge */ struct bt_bad { u_short bt_cyl; /* cylinder number of bad sector */ u_short bt_trksec; /* track and sector number */ } bt_bad[126]; }; #define ECC 0 #define SSE 1 #define BSE 2 #define CONT 3 b[,ld$ bwby+/* dmap.h 4.6 83/04/30 */ /* * Definitions for the mapping of vitual swap * space to the physical swap area - the disk map. */ #define NDMAP 16 /* size of the swap area map */ struct dmap { swblk_t dm_size; /* current size used by process */ swblk_t dm_alloc; /* amount of physical swap space allocated */ swblk_t dm_map[NDMAP]; /* first disk block number in each chunk */ }; #ifdef KERNEL struct dmap zdmap; int dmmin, dmmax, dmtext; #endif /* * The following structure is that ``returned'' * from a call to vstodb(). */ struct dblock { swblk_t db_base; /* base of physical contig drum block */ swblk_t db_size; /* size of block */ }; b[.li$  b byG/* domain.h 5.2 82/08/01 */ /* * Structure per communications domain. */ struct domain { int dom_family; /* AF_xxx */ char *dom_name; struct protosw *dom_protosw, *dom_protoswNPROTOSW; struct domain *dom_next; }; #ifdef KERNEL struct domain *domains; #endif b[0liu$ b by/* errno.h 4.1 82/12/28 */ /* * Error codes */ #define EPERM 1 /* Not owner */ #define ENOENT 2 /* No such file or directory */ #define ESRCH 3 /* No such process */ #define EINTR 4 /* Interrupted system call */ #define EIO 5 /* I/O error */ #define ENXIO 6 /* No such device or address */ #define E2BIG 7 /* Arg list too long */ #define ENOEXEC 8 /* Exec format error */ #define EBADF 9 /* Bad file number */ #define ECHILD 10 /* No children */ #define EAGAIN 11 /* No more processes */ #define ENOMEM 12 /* Not enough core */ #define EACCES 13 /* Permission denied */ #define EFAULT 14 /* Bad address */ #define ENOTBLK 15 /* Block device required */ #define EBUSY 16 /* Mount device busy */ #define EEXIST 17 /* File exists */ #define EXDEV 18 /* Cross-device link */ #define ENODEV 19 /* No such device */ #define ENOTDIR 20 /* Not a directory*/ #define EISDIR 21 /* Is a directory */ #define EINVAL 22 /* Invalid argument */ #define ENFILE 23 /* File table overflow */ #define EMFILE 24 /* Too many open files */ #define ENOTTY 25 /* Not a typewriter */ #define ETXTBSY 26 /* Text file busy */ #define EFBIG 27 /* File too large */ #define ENOSPC 28 /* No space left on device */ #define ESPIPE 29 /* Illegal seek */ #define EROFS 30 /* Read-only file system */ #define EMLINK 31 /* Too many links */ #define EPIPE 32 /* Broken pipe */ /* math software */ #define EDOM 33 /* Argument too large */ #define ERANGE 34 /* Result too large */ /* non-blocking and interrupt i/o */ #define EWOULDBLOCK 35 /* Operation would block */ #define EINPROGRESS 36 /* Operation now in progress */ #define EALREADY 37 /* Operation already in progress */ /* ipc/network software */ /* argument errors */ #define ENOTSOCK 38 /* Socket operation on non-socket */ #define EDESTADDRREQ 39 /* Destination address required */ #define EMSGSIZE 40 /* Message too long */ #define EPROTOTYPE 41 /* Protocol wrong type for socket */ #define ENOPROTOOPT 42 /* Protocol not available */ #define EPROTONOSUPPORT 43 /* Protocol not supported */ #define ESOCKTNOSUPPORT 44 /* Socket type not supported */ #define EOPNOTSUPP 45 /* Operation not supported on socket */ #define EPFNOSUPPORT 46 /* Protocol family not supported */ #define EAFNOSUPPORT 47 /* Address family not supported by protocol family */ #define EADDRINUSE 48 /* Address already in use */ #define EADDRNOTAVAIL 49 /* Can't assign requested address */ /* operational errors */ #define ENETDOWN 50 /* Network is down */ #define ENETUNREACH 51 /* Network is unreachable */ #define ENETRESET 52 /* Network dropped connection on reset */ #define ECONNABORTED 53 /* Software caused connection abort */ #define ECONNRESET 54 /* Connection reset by peer */ #define ENOBUFS 55 /* No buffer space available */ #define EISCONN 56 /* Socket is already connected */ #define ENOTCONN 57 /* Socket is not connected */ #define ESHUTDOWN 58 /* Can't send after socket shutdown */ #define ETOOMANYREFS 59 /* Too many references: can't splice */ #define ETIMEDOUT 60 /* Connection timed out */ #define ECONNREFUSED 61 /* Connection refused */ /* */ #define ELOOP 62 /* Too many levels of symbolic links */ #define ENAMETOOLONG 63 /* File name too long */ /* should be rearranged */ #define EHOSTDOWN 64 /* Host is down */ #define EHOSTUNREACH 65 /* No route to host */ #define ENOTEMPTY 66 /* Directory not empty */ /* quotas & mush */ #define EPROCLIM 67 /* Too many processes */ #define EUSERS 68 /* Too many users */ #define EDQUOT 69 /* Disc quota exceeded */ b[5lix؁$ !b by/* file.h 4.14 82/11/13 */ #ifdef KERNEL /* * Descriptor table entry. * One for each kernel object. */ struct file { short f_flag; /* see below */ short f_type; /* descriptor type */ char f_nbhow; /* state from dnblock */ char f_sighow; /* state from dsignal */ short f_count; /* reference count */ /* begin XXX */ struct inode *f_inode; /* inode */ union { struct f_in { off_t fi_offset; } f_in; struct f_so { struct socket *fs_socket; } f_so; } f_un; #define f_offset f_un.f_in.fi_offset #define f_socket f_un.f_so.fs_socket /* end XXX */ }; struct file *file, *fileNFILE; int nfile; struct file *getf(); struct file *falloc(); /* flags */ #define FREAD 0x001 /* descriptor read/receive'able */ #define FWRITE 0x002 /* descriptor write/send'able */ #define FAPPEND 0x004 /* append on each write */ /* the following defines the bits that users can set in f_flag */ #define FMODES (FREAD|FWRITE|FAPPEND) #endif /* * User visible desriptor attributes. * These are supplied at open or flock time. * FRDONLY, FWRONLY, and FRDWR are * converted to FREAD and FWRITE on open. */ #define FRDONLY 0x000 /* open for reading only */ #define FWRONLY 0x001 /* open for writing only */ #define FRDWR 0x002 /* open for reading and writing */ #define FAPPEND 0x004 /* append on each write */ #define FSHLOCK 0x008 /* apply shared lock */ #define FEXLOCK 0x010 /* apply exclusive lock */ #define FUNLOCK 0x100 /* release all locks */ #define FCREATE 0x200 /* create file if nonexistant */ #define FTRUNCATE 0x400 /* truncate file to size 0 on open */ #define FNBLOCK 0x800 /* don't block on open */ /* these are for 3.0 "compatibility" */ #define O_RDONLY FRDONLY /* open for read */ #define O_WRONLY FWRONLY /* open for writing */ #define O_RDWR FRDWR /* open for read & write */ #define O_NDELAY FNBLOCK /* non-blocking I/O */ #define O_APPEND FAPPEND /* append */ #define O_CREAT FCREATE /* open with file create */ #define O_TRUNC FTRUNCATE /* open with truncation */ #define O_EXCL FEXLOCK /* exclusive open */ /* flags supplied to access call */ #define FACCESS_EXISTS 0x0 /* does file exist */ #define FACCESS_EXECUTE 0x1 /* is it executable by caller */ #define FACCESS_WRITE 0x2 /* writable by caller */ #define FACCESS_READ 0x4 /* readable by caller */ /* flags supplies to lseek call */ #define FSEEK_ABSOLUTE 0x0 /* absolute offset */ #define FSEEK_RELATIVE 0x1 /* relative to current offset */ #define FSEEK_EOF 0x2 /* relative to end of file */ /* file types which may be specified to mknod */ #define FTYPE_CDEV 0x2000 /* character special device */ #define FTYPE_DIR 0x4000 /* directory */ #define FTYPE_BDEV 0x8000 /* block special device */ #define GETF(fp, fd) { \ if ((unsigned)(fd) >= NOFILE || ((fp) = u.u_ofile[fd]) == NULL) { \ u.u_error = EBADF; \ return; \ } \ } b[9li$ 8Mb by/* fs.h 4.8 83/04/08 */ /* * Each disk drive contains some number of file systems. * A file system consists of a number of cylinder groups. * Each cylinder group has inodes and data. * * A file system is described by its super-block, which in turn * describes the cylinder groups. The super-block is critical * data and is replicated in each cylinder group to protect against * catastrophic loss. This is done at mkfs time and the critical * super-block data does not change, so the copies need not be * referenced further unless disaster strikes. * * For file system fs, the offsets of the various blocks of interest * are given in the super block as: * [fs->fs_sblkno] Super-block * [fs->fs_cblkno] Cylinder group block * [fs->fs_iblkno] Inode blocks * [fs->fs_dblkno] Data blocks * The beginning of cylinder group cg in fs, is given by * the ``cgbase(fs, cg)'' macro. * * The first boot and super blocks are given in absolute disk addresses. */ #define BBSIZE 8192 #define SBSIZE 8192 #define BBLOCK ((daddr_t)(0)) #define SBLOCK ((daddr_t)(BBLOCK + BBSIZE / DEV_BSIZE)) /* * Addresses stored in inodes are capable of addressing fragments * of `blocks'. File system blocks of at most size MAXBSIZE can * be optionally broken into 2, 4, or 8 pieces, each of which is * addressible; these pieces may be DEV_BSIZE, or some multiple of * a DEV_BSIZE unit. * * Large files consist of exclusively large data blocks. To avoid * undue wasted disk space, the last data block of a small file may be * allocated as only as many fragments of a large block as are * necessary. The file system format retains only a single pointer * to such a fragment, which is a piece of a single large block that * has been divided. The size of such a fragment is determinable from * information in the inode, using the ``blksize(fs, ip, lbn)'' macro. * * The file system records space availability at the fragment level; * to determine block availability, aligned fragments are examined. * * The root inode is the root of the file system. * Inode 0 can't be used for normal purposes and * historically bad blocks were linked to inode 1, * thus the root inode is 2. (inode 1 is no longer used for * this purpose, however numerous dump tapes make this * assumption, so we are stuck with it) * The lost+found directory is given the next available * inode when it is created by ``mkfs''. */ #define ROOTINO ((ino_t)2) /* i number of all roots */ #define LOSTFOUNDINO (ROOTINO + 1) /* * Cylinder group related limits. * * For each cylinder we keep track of the availability of blocks at different * rotational positions, so that we can lay out the data to be picked * up with minimum rotational latency. NRPOS is the number of rotational * positions which we distinguish. With NRPOS 8 the resolution of our * summary information is 2ms for a typical 3600 rpm drive. */ #define NRPOS 8 /* number distinct rotational positions */ /* * MAXIPG bounds the number of inodes per cylinder group, and * is needed only to keep the structure simpler by having the * only a single variable size element (the free bit map). * * N.B.: MAXIPG must be a multiple of INOPB(fs). */ #define MAXIPG 2048 /* max number inodes/cyl group */ /* * MINBSIZE is the smallest allowable block size. * In order to insure that it is possible to create files of size * 2^32 with only two levels of indirection, MINBSIZE is set to 4096. * MINBSIZE must be big enough to hold a cylinder group block, * thus changes to (struct cg) must keep its size within MINBSIZE. * MAXCPG is limited only to dimension an array in (struct cg); * it can be made larger as long as that structures size remains * within the bounds dictated by MINBSIZE. * Note that super blocks are always of size MAXBSIZE, * and that MAXBSIZE must be >= MINBSIZE. */ #define MINBSIZE 4096 #define MAXCPG 32 /* maximum fs_cpg */ /* * The path name on which the file system is mounted is maintained * in fs_fsmnt. MAXMNTLEN defines the amount of space allocated in * the super block for this name. * The limit on the amount of summary information per file system * is defined by MAXCSBUFS. It is currently parameterized for a * maximum of two million cylinders. */ #define MAXMNTLEN 512 #define MAXCSBUFS 32 /* * Per cylinder group information; summarized in blocks allocated * from first cylinder group data blocks. These blocks have to be * read in from fs_csaddr (size fs_cssize) in addition to the * super block. * * N.B. sizeof(struct csum) must be a power of two in order for * the ``fs_cs'' macro to work (see below). */ struct csum { long cs_ndir; /* number of directories */ long cs_nbfree; /* number of free blocks */ long cs_nifree; /* number of free inodes */ long cs_nffree; /* number of free frags */ }; /* * Super block for a file system. */ #define FS_MAGIC 0x011954 struct fs { struct fs *fs_link; /* linked list of file systems */ struct fs *fs_rlink; /* used for incore super blocks */ daddr_t fs_sblkno; /* addr of super-block in filesys */ daddr_t fs_cblkno; /* offset of cyl-block in filesys */ daddr_t fs_iblkno; /* offset of inode-blocks in filesys */ daddr_t fs_dblkno; /* offset of first data after cg */ long fs_cgoffset; /* cylinder group offset in cylinder */ long fs_cgmask; /* used to calc mod fs_ntrak */ time_t fs_time; /* last time written */ long fs_size; /* number of blocks in fs */ long fs_dsize; /* number of data blocks in fs */ long fs_ncg; /* number of cylinder groups */ long fs_bsize; /* size of basic blocks in fs */ long fs_fsize; /* size of frag blocks in fs */ long fs_frag; /* number of frags in a block in fs */ /* these are configuration parameters */ long fs_minfree; /* minimum percentage of free blocks */ long fs_rotdelay; /* num of ms for optimal next block */ long fs_rps; /* disk revolutions per second */ /* these fields can be computed from the others */ long fs_bmask; /* ``blkoff'' calc of blk offsets */ long fs_fmask; /* ``fragoff'' calc of frag offsets */ long fs_bshift; /* ``lblkno'' calc of logical blkno */ long fs_fshift; /* ``numfrags'' calc number of frags */ /* these are configuration parameters */ long fs_maxcontig; /* max number of contiguous blks */ long fs_maxbpg; /* max number of blks per cyl group */ /* these fields can be computed from the others */ long fs_fragshift; /* block to frag shift */ long fs_fsbtodb; /* fsbtodb and dbtofsb shift constant */ long fs_sbsize; /* actual size of super block */ long fs_csmask; /* csum block offset */ long fs_csshift; /* csum block number */ long fs_nindir; /* value of NINDIR */ long fs_inopb; /* value of INOPB */ long fs_nspf; /* value of NSPF */ long fs_sparecon[6]; /* reserved for future constants */ /* sizes determined by number of cylinder groups and their sizes */ daddr_t fs_csaddr; /* blk addr of cyl grp summary area */ long fs_cssize; /* size of cyl grp summary area */ long fs_cgsize; /* cylinder group size */ /* these fields should be derived from the hardware */ long fs_ntrak; /* tracks per cylinder */ long fs_nsect; /* sectors per track */ long fs_spc; /* sectors per cylinder */ /* this comes from the disk driver partitioning */ long fs_ncyl; /* cylinders in file system */ /* these fields can be computed from the others */ long fs_cpg; /* cylinders per group */ long fs_ipg; /* inodes per group */ long fs_fpg; /* blocks per group * fs_frag */ /* this data must be re-computed after crashes */ struct csum fs_cstotal; /* cylinder summary information */ /* these fields are cleared at mount time */ char fs_fmod; /* super block modified flag */ char fs_clean; /* file system is clean flag */ char fs_ronly; /* mounted read-only flag */ char fs_flags; /* currently unused flag */ char fs_fsmnt[MAXMNTLEN]; /* name mounted on */ /* these fields retain the current block allocation info */ long fs_cgrotor; /* last cg searched */ struct csum *fs_csp[MAXCSBUFS];/* list of fs_cs info buffers */ long fs_cpc; /* cyl per cycle in postbl */ short fs_postbl[MAXCPG][NRPOS];/* head of blocks for each rotation */ long fs_magic; /* magic number */ u_char fs_rotbl[1]; /* list of blocks for each rotation */ /* actually longer */ }; /* * Convert cylinder group to base address of its global summary info. * * N.B. This macro assumes that sizeof(struct csum) is a power of two. */ #define fs_cs(fs, indx) \ fs_csp[(indx) >> (fs)->fs_csshift][(indx) & ~(fs)->fs_csmask] /* * MAXBPC bounds the size of the rotational layout tables and * is limited by the fact that the super block is of size SBSIZE. * The size of these tables is INVERSELY proportional to the block * size of the file system. It is aggravated by sector sizes that * are not powers of two, as this increases the number of cylinders * included before the rotational pattern repeats (fs_cpc). * Its size is derived from the number of bytes remaining in (struct fs) */ #define MAXBPC (SBSIZE - sizeof (struct fs)) /* * Cylinder group block for a file system. */ #define CG_MAGIC 0x090255 struct cg { struct cg *cg_link; /* linked list of cyl groups */ struct cg *cg_rlink; /* used for incore cyl groups */ time_t cg_time; /* time last written */ long cg_cgx; /* we are the cgx'th cylinder group */ short cg_ncyl; /* number of cyl's this cg */ short cg_niblk; /* number of inode blocks this cg */ long cg_ndblk; /* number of data blocks this cg */ struct csum cg_cs; /* cylinder summary information */ long cg_rotor; /* position of last used block */ long cg_frotor; /* position of last used frag */ long cg_irotor; /* position of last used inode */ long cg_frsum[MAXFRAG]; /* counts of available frags */ long cg_btot[MAXCPG]; /* block totals per cylinder */ short cg_b[MAXCPG][NRPOS]; /* positions of free blocks */ char cg_iused[MAXIPG/NBBY]; /* used inode map */ long cg_magic; /* magic number */ u_char cg_free[1]; /* free block map */ /* actually longer */ }; /* * MAXBPG bounds the number of blocks of data per cylinder group, * and is limited by the fact that cylinder groups are at most one block. * Its size is derived from the size of blocks and the (struct cg) size, * by the number of remaining bits. */ #define MAXBPG(fs) \ (fragstoblks((fs), (NBBY * ((fs)->fs_bsize - (sizeof (struct cg)))))) /* * Turn file system block numbers into disk block addresses. * This maps file system blocks to device size blocks. */ #define fsbtodb(fs, b) ((b) << (fs)->fs_fsbtodb) #define dbtofsb(fs, b) ((b) >> (fs)->fs_fsbtodb) /* * Cylinder group macros to locate things in cylinder groups. * They calc file system addresses of cylinder group data structures. */ #define cgbase(fs, c) ((daddr_t)((fs)->fs_fpg * (c))) #define cgstart(fs, c) \ (cgbase(fs, c) + (fs)->fs_cgoffset * ((c) & ~((fs)->fs_cgmask))) #define cgsblock(fs, c) (cgstart(fs, c) + (fs)->fs_sblkno) /* super blk */ #define cgtod(fs, c) (cgstart(fs, c) + (fs)->fs_cblkno) /* cg block */ #define cgimin(fs, c) (cgstart(fs, c) + (fs)->fs_iblkno) /* inode blk */ #define cgdmin(fs, c) (cgstart(fs, c) + (fs)->fs_dblkno) /* 1st data */ /* * Macros for handling inode numbers: * inode number to file system block offset. * inode number to cylinder group number. * inode number to file system block address. */ #define itoo(fs, x) ((x) % INOPB(fs)) #define itog(fs, x) ((x) / (fs)->fs_ipg) #define itod(fs, x) \ ((daddr_t)(cgimin(fs, itog(fs, x)) + \ (blkstofrags((fs), (((x) % (fs)->fs_ipg) / INOPB(fs)))))) /* * Give cylinder group number for a file system block. * Give cylinder group block number for a file system block. */ #define dtog(fs, d) ((d) / (fs)->fs_fpg) #define dtogd(fs, d) ((d) % (fs)->fs_fpg) /* * Extract the bits for a block from a map. * Compute the cylinder and rotational position of a cyl block addr. */ #define blkmap(fs, map, loc) \ (((map)[loc / NBBY] >> (loc % NBBY)) & (0xff >> (NBBY - (fs)->fs_frag))) #define cbtocylno(fs, bno) \ ((bno) * NSPF(fs) / (fs)->fs_spc) #define cbtorpos(fs, bno) \ ((bno) * NSPF(fs) % (fs)->fs_nsect * NRPOS / (fs)->fs_nsect) /* * The following macros optimize certain frequently calculated * quantities by using shifts and masks in place of divisions * modulos and multiplications. */ #define blkoff(fs, loc) /* calculates (loc % fs->fs_bsize) */ \ ((loc) & ~(fs)->fs_bmask) #define fragoff(fs, loc) /* calculates (loc % fs->fs_fsize) */ \ ((loc) & ~(fs)->fs_fmask) #define lblkno(fs, loc) /* calculates (loc / fs->fs_bsize) */ \ ((loc) >> (fs)->fs_bshift) #define numfrags(fs, loc) /* calculates (loc / fs->fs_fsize) */ \ ((loc) >> (fs)->fs_fshift) #define blkroundup(fs, size) /* calculates roundup(size, fs->fs_bsize) */ \ (((size) + (fs)->fs_bsize - 1) & (fs)->fs_bmask) #define fragroundup(fs, size) /* calculates roundup(size, fs->fs_fsize) */ \ (((size) + (fs)->fs_fsize - 1) & (fs)->fs_fmask) #define fragstoblks(fs, frags) /* calculates (frags / fs->fs_frag) */ \ ((frags) >> (fs)->fs_fragshift) #define blkstofrags(fs, blks) /* calculates (blks * fs->fs_frag) */ \ ((blks) << (fs)->fs_fragshift) /* * Determine the number of available frags given a * percentage to hold in reserve */ #define freespace(fs, percentreserved) \ (blkstofrags((fs), (fs)->fs_cstotal.cs_nbfree) + \ (fs)->fs_cstotal.cs_nffree - ((fs)->fs_dsize * (percentreserved) / 100)) /* * Determining the size of a file block in the file system. */ #define blksize(fs, ip, lbn) \ (((lbn) >= NDADDR || (ip)->i_size >= ((lbn) + 1) << (fs)->fs_bshift) \ ? (fs)->fs_bsize \ : (fragroundup(fs, blkoff(fs, (ip)->i_size)))) #define dblksize(fs, dip, lbn) \ (((lbn) >= NDADDR || (dip)->di_size >= ((lbn) + 1) << (fs)->fs_bshift) \ ? (fs)->fs_bsize \ : (fragroundup(fs, blkoff(fs, (dip)->di_size)))) /* * Number of disk sectors per block; assumes DEV_BSIZE byte sector size. */ #define NSPB(fs) ((fs)->fs_nspf << (fs)->fs_fragshift) #define NSPF(fs) ((fs)->fs_nspf) /* * INOPB is the number of inodes in a secondary storage block. */ #define INOPB(fs) ((fs)->fs_inopb) #define INOPF(fs) ((fs)->fs_inopb >> (fs)->fs_fragshift) /* * NINDIR is the number of indirects in a file system block. */ #define NINDIR(fs) ((fs)->fs_nindir) #ifdef KERNEL struct fs *getfs(); struct fs *mountfs(); #endif b[Ili{$ b by/* gprof.h 4.2 83/01/15 */ struct phdr { char *lpc; char *hpc; int ncnt; }; /* * histogram counters are unsigned shorts (according to the kernel). */ #define HISTCOUNTER unsigned short /* * fraction of text space to allocate for histogram counters * here, 1/2 */ #define HISTFRACTION 2 /* * Fraction of text space to allocate for from hash buckets. * The value of HASHFRACTION is based on the minimum number of bytes * of separation between two subroutine call points in the object code. * Given MIN_SUBR_SEPARATION bytes of separation the value of * HASHFRACTION is calculated as: * * HASHFRACTION = MIN_SUBR_SEPARATION / (2 * sizeof(short) - 1); * * For the VAX, the shortest two call sequence is: * * calls $0,(r0) * calls $0,(r0) * * which is separated by only three bytes, thus HASHFRACTION is * calculated as: * * HASHFRACTION = 3 / (2 * 2 - 1) = 1 * * Note that the division above rounds down, thus if MIN_SUBR_FRACTION * is less than three, this algorithm will not work! * * NB: for the kernel we assert that the shortest two call sequence is: * * calls $0,_name * calls $0,_name * * which is separated by seven bytes, thus HASHFRACTION is calculated as: * * HASHFRACTION = 7 / (2 * 2 - 1) = 2 */ #define HASHFRACTION 2 /* * percent of text space to allocate for tostructs * with a minimum. */ #define ARCDENSITY 2 #define MINARCS 50 struct tostruct { char *selfpc; long count; unsigned short link; }; /* * a raw arc, * with pointers to the calling site and the called site * and a count. */ struct rawarc { unsigned long raw_frompc; unsigned long raw_selfpc; long raw_count; }; /* * general rounding functions. */ #define ROUNDDOWN(x,y) (((x)/(y))*(y)) #define ROUNDUP(x,y) ((((x)+(y)-1)/(y))*(y)) b[Lli߁$ b by /* inline.h 4.5 82/06/08 */ /* * Definitions of inlines, and macro replacements * for them if UNFAST (latter only scantily tested). */ #ifndef UNFAST #define ilock(ip) \ { \ while ((ip)->i_flag & ILOCK) { \ (ip)->i_flag |= IWANT; \ sleep((caddr_t)(ip), PINOD); \ } \ (ip)->i_flag |= ILOCK; \ } #define iunlock(ip) \ { \ (ip)->i_flag &= ~ILOCK; \ if ((ip)->i_flag&IWANT) { \ (ip)->i_flag &= ~IWANT; \ wakeup((caddr_t)(ip)); \ } \ } #define GETF(fp, fd) { \ if ((unsigned)(fd) >= NOFILE || ((fp) = u.u_ofile[fd]) == NULL) { \ u.u_error = EBADF; \ return; \ } \ } #define IUPDAT(ip, t1, t2, waitfor) { \ if (ip->i_flag&(IUPD|IACC|ICHG)) \ iupdat(ip, t1, t2, waitfor); \ } #define ISSIG(p) ((p)->p_sig && \ ((p)->p_flag&STRC || ((p)->p_sig &~ (p)->p_ignsig)) && issig()) #else #define GETF(fp, fd) { \ (fp) = getf(fd); \ if ((fp) == NULL) \ return; \ } #define IUPDAT(ip, t1, t2, waitfor) iupdat(ip, t1, t2, waitfor) #define ISSIG(p) issig(p) #endif b[Nlia$ Eb by[/* inode.h 4.22 83/02/10 */ /* * The I node is the focus of all file activity in UNIX. * There is a unique inode allocated for each active file, * each current directory, each mounted-on file, text file, and the root. * An inode is 'named' by its dev/inumber pair. (iget/iget.c) * Data in icommon is read in from permanent inode on volume. */ #define NDADDR 12 /* direct addresses in inode */ #define NIADDR 3 /* indirect addresses in inode */ struct inode { struct inode *i_chain[2]; /* must be first */ u_short i_flag; u_short i_count; /* reference count */ dev_t i_dev; /* device where inode resides */ u_short i_shlockc; /* count of shared locks on inode */ u_short i_exlockc; /* count of exclusive locks on inode */ ino_t i_number; /* i number, 1-to-1 with device address */ struct fs *i_fs; /* file sys associated with this inode */ struct dquot *i_dquot; /* quota structure controlling this file */ union { daddr_t if_lastr; /* last read (read-ahead) */ struct socket *is_socket; struct { struct inode *if_freef; /* free list forward */ struct inode **if_freeb; /* free list back */ } i_fr; } i_un; struct icommon { u_short ic_mode; /* 0: mode and type of file */ short ic_nlink; /* 2: number of links to file */ short ic_uid; /* 4: owner's user id */ short ic_gid; /* 6: owner's group id */ quad ic_size; /* 8: number of bytes in file */ time_t ic_atime; /* 16: time last accessed */ long ic_atspare; time_t ic_mtime; /* 24: time last modified */ long ic_mtspare; time_t ic_ctime; /* 32: last time inode changed */ long ic_ctspare; daddr_t ic_db[NDADDR]; /* 40: disk block addresses */ daddr_t ic_ib[NIADDR]; /* 88: indirect blocks */ long ic_flags; /* 100: status, currently unused */ long ic_spare[6]; /* 104: reserved, currently unused */ } i_ic; }; struct dinode { union { struct icommon di_icom; char di_size[128]; } di_un; }; #define i_mode i_ic.ic_mode #define i_nlink i_ic.ic_nlink #define i_uid i_ic.ic_uid #define i_gid i_ic.ic_gid /* ugh! -- must be fixed */ #ifdef vax #define i_size i_ic.ic_size.val[0] #endif #ifdef sun #define i_size i_ic.ic_size.val[1] #endif #define i_db i_ic.ic_db #define i_ib i_ic.ic_ib #define i_atime i_ic.ic_atime #define i_mtime i_ic.ic_mtime #define i_ctime i_ic.ic_ctime #define i_rdev i_ic.ic_db[0] #define i_lastr i_un.if_lastr #define i_socket i_un.is_socket #define i_forw i_chain[0] #define i_back i_chain[1] #define i_freef i_un.i_fr.if_freef #define i_freeb i_un.i_fr.if_freeb #define di_ic di_un.di_icom #define di_mode di_ic.ic_mode #define di_nlink di_ic.ic_nlink #define di_uid di_ic.ic_uid #define di_gid di_ic.ic_gid #ifdef vax #define di_size di_ic.ic_size.val[0] #endif #ifdef sun #define di_size di_ic.ic_size.val[1] #endif #define di_db di_ic.ic_db #define di_ib di_ic.ic_ib #define di_atime di_ic.ic_atime #define di_mtime di_ic.ic_mtime #define di_ctime di_ic.ic_ctime #define di_rdev di_ic.ic_db[0] #ifdef KERNEL struct inode *inode; /* the inode table itself */ struct inode *inodeNINODE; /* the end of the inode table */ int ninode; /* number of slots in the table */ struct inode *rootdir; /* pointer to inode of root directory */ struct inode *ialloc(); struct inode *iget(); #ifdef notdef struct inode *ifind(); #endif struct inode *owner(); struct inode *maknode(); struct inode *namei(); ino_t dirpref(); #endif /* flags */ #define ILOCKED 0x1 /* inode is locked */ #define IUPD 0x2 /* file has been modified */ #define IACC 0x4 /* inode access time to be updated */ #define IMOUNT 0x8 /* inode is mounted on */ #define IWANT 0x10 /* some process waiting on lock */ #define ITEXT 0x20 /* inode is pure text prototype */ #define ICHG 0x40 /* inode has been changed */ #define ISHLOCK 0x80 /* file has shared lock */ #define IEXLOCK 0x100 /* file has exclusive lock */ #define ILWAIT 0x200 /* someone waiting on file lock */ /* modes */ #define IFMT 0170000 /* type of file */ #define IFCHR 0020000 /* character special */ #define IFDIR 0040000 /* directory */ #define IFBLK 0060000 /* block special */ #define IFREG 0100000 /* regular */ #define IFLNK 0120000 /* symbolic link */ #define IFSOCK 0140000 /* socket */ #define ISUID 04000 /* set user id on execution */ #define ISGID 02000 /* set group id on execution */ #define ISVTX 01000 /* save swapped text even after use */ #define IREAD 0400 /* read, write, execute permissions */ #define IWRITE 0200 #define IEXEC 0100 #define ILOCK(ip) { \ while ((ip)->i_flag & ILOCKED) { \ (ip)->i_flag |= IWANT; \ sleep((caddr_t)(ip), PINOD); \ } \ (ip)->i_flag |= ILOCKED; \ } #define IUNLOCK(ip) { \ (ip)->i_flag &= ~ILOCKED; \ if ((ip)->i_flag&IWANT) { \ (ip)->i_flag &= ~IWANT; \ wakeup((caddr_t)(ip)); \ } \ } #define IUPDAT(ip, t1, t2, waitfor) { \ if (ip->i_flag&(IUPD|IACC|ICHG)) \ iupdat(ip, t1, t2, waitfor); \ } b[Tl䁤 $b(Iby  /* ioctl.h 4.30 83/05/14 */ /* * Ioctl definitions */ #ifndef _IOCTL_ #define _IOCTL_ #ifdef KERNEL #include "../h/ttychars.h" #include "../h/ttydev.h" #else #include #include #endif #ifndef NOCOMPAT #include struct tchars { char t_intrc; /* interrupt */ char t_quitc; /* quit */ char t_startc; /* start output */ char t_stopc; /* stop output */ char t_eofc; /* end-of-file */ char t_brkc; /* input delimiter (like nl) */ }; struct ltchars { char t_suspc; /* stop process signal */ char t_dsuspc; /* delayed stop process signal */ char t_rprntc; /* reprint line */ char t_flushc; /* flush output (toggles) */ char t_werasc; /* word erase */ char t_lnextc; /* literal next character */ }; #endif #ifndef _IO /* * Ioctl's have the command encoded in the lower word, * and the size of any in or out parameters in the upper * word. The high 2 bits of the upper word are used * to encode the in/out status of the parameter; for now * we restrict parameters to at most 128 bytes. */ #define IOCPARM_MASK 0x7f /* parameters must be < 128 bytes */ #define IOC_VOID 0x20000000 /* no parameters */ #define IOC_OUT 0x40000000 /* copy out parameters */ #define IOC_IN 0x80000000 /* copy in parameters */ #define IOC_INOUT (IOC_IN|IOC_OUT) /* the 0x20000000 is so we can distinguish new ioctl's from old */ #define _IO(x,y) (IOC_VOID|('x'<<8)|y) #define _IOR(x,y,t) (IOC_OUT|((sizeof(t)&IOCPARM_MASK)<<16)|('x'<<8)|y) #define _IOW(x,y,t) (IOC_IN|((sizeof(t)&IOCPARM_MASK)<<16)|('x'<<8)|y) /* this should be _IORW, but stdio got there first */ #define _IOWR(x,y,t) (IOC_INOUT|((sizeof(t)&IOCPARM_MASK)<<16)|('x'<<8)|y) #endif /* * tty ioctl commands */ #define TIOCGETD _IOR(t, 0, int) /* get line discipline */ #define TIOCSETD _IOW(t, 1, int) /* set line discipline */ #define TIOCHPCL _IO(t, 2) /* hang up on last close */ #define TIOCMODG _IOR(t, 3, int) /* get modem control state */ #define TIOCMODS _IOW(t, 4, int) /* set modem control state */ #define TIOCGETP _IOR(t, 8,struct sgttyb)/* get parameters -- gtty */ #define TIOCSETP _IOW(t, 9,struct sgttyb)/* set parameters -- stty */ #define TIOCSETN _IOW(t,10,struct sgttyb)/* as above, but no flushtty */ #define TIOCEXCL _IO(t, 13) /* set exclusive use of tty */ #define TIOCNXCL _IO(t, 14) /* reset exclusive use of tty */ #define TIOCFLUSH _IOW(t, 16, int) /* flush buffers */ #define TIOCSETC _IOW(t,17,struct tchars)/* set special characters */ #define TIOCGETC _IOR(t,18,struct tchars)/* get special characters */ #define TIOCSET _IOW(t, 19, long) /* set tty flags */ #define TIOCBIS _IOW(t, 20, long) /* bis tty flags */ #define TIOCBIC _IOW(t, 21, long) /* bic tty flags */ #define TIOCGET _IOR(t, 22, long) /* get all tty flags */ #define TANDEM 0x00000001 /* send stopc on out q full */ #define CBREAK 0x00000002 /* half-cooked mode */ #define LCASE 0x00000004 /* simulate lower case */ #define ECHO 0x00000008 /* echo input */ #define CRMOD 0x00000010 /* map \r to \r\n on output */ #define RAW 0x00000020 /* no i/o processing */ #define ODDP 0x00000040 /* get/send odd parity */ #define EVENP 0x00000080 /* get/send even parity */ #define ANYP 0x000000c0 /* get any parity/send none */ #define NLDELAY 0x00000300 /* \n delay */ #define NL0 0x00000000 #define NL1 0x00000100 /* tty 37 */ #define NL2 0x00000200 /* vt05 */ #define NL3 0x00000300 #define TBDELAY 0x00000c00 /* horizontal tab delay */ #define TAB0 0x00000000 #define TAB1 0x00000400 /* tty 37 */ #define TAB2 0x00000800 #define XTABS 0x00000c00 /* expand tabs on output */ #define CRDELAY 0x00003000 /* \r delay */ #define CR0 0x00000000 #define CR1 0x00001000 /* tn 300 */ #define CR2 0x00002000 /* tty 37 */ #define CR3 0x00003000 /* concept 100 */ #define VTDELAY 0x00004000 /* vertical tab delay */ #define FF0 0x00000000 #define FF1 0x00004000 /* tty 37 */ #define BSDELAY 0x00008000 /* \b delay */ #define BS0 0x00000000 #define BS1 0x00008000 #define ALLDELAY (NLDELAY|TBDELAY|CRDELAY|VTDELAY|BSDELAY) #define CRTBS 0x00010000 /* do backspacing for crt */ #define PRTERA 0x00020000 /* \ ... / erase */ #define CRTERA 0x00040000 /* " \b " to wipe out char */ #define TILDE 0x00080000 /* hazeltine tilde kludge */ #define MDMBUF 0x00100000 /* start/stop output on carrier intr */ #define LITOUT 0x00200000 /* literal output */ #define TOSTOP 0x00400000 /* SIGSTOP on background output */ #define FLUSHO 0x00800000 /* flush output to terminal */ #define NOHANG 0x01000000 /* no SIGHUP on carrier drop */ #define L001000 0x02000000 #define CRTKIL 0x04000000 /* kill line with " \b " */ #define L004000 0x08000000 #define CTLECH 0x10000000 /* echo control chars as ^X */ #define PENDIN 0x20000000 /* tp->t_rawq needs reread */ #define DECCTQ 0x40000000 /* only ^Q starts after ^S */ #define NOFLSH 0x80000000 /* no output flush on signal */ #define TIOCCSET _IOW(t,23,struct ttychars)/* set special characters */ #define TIOCCGET _IOR(t,24,struct ttychars)/* get special characters */ /* locals, from 127 down */ #ifndef NOCOMPAT #define TIOCLBIS _IOW(t, 127, int) /* bis local mode bits */ #define TIOCLBIC _IOW(t, 126, int) /* bic local mode bits */ #define TIOCLSET _IOW(t, 125, int) /* set entire local mode word */ #define TIOCLGET _IOR(t, 124, int) /* get local modes */ #define LCRTBS (CRTBS>>16) #define LPRTERA (PRTERA>>16) #define LCRTERA (CRTERA>>16) #define LTILDE (TILDE>>16) #define LMDMBUF (MDMBUF>>16) #define LLITOUT (LITOUT>>16) #define LTOSTOP (TOSTOP>>16) #define LFLUSHO (FLUSHO>>16) #define LNOHANG (NOHANG>>16) #define LCRTKIL (CRTKIL>>16) #define LCTLECH (CTLECH>>16) #define LPENDIN (PENDIN>>16) #define LDECCTQ (DECCTQ>>16) #define LNOFLSH (NOFLSH>>16) #endif #define TIOCSBRK _IO(t, 123) /* set break bit */ #define TIOCCBRK _IO(t, 122) /* clear break bit */ #define TIOCSDTR _IO(t, 121) /* set data terminal ready */ #define TIOCCDTR _IO(t, 120) /* clear data terminal ready */ #define TIOCGPGRP _IOR(t, 119, int) /* get pgrp of tty */ #define TIOCSPGRP _IOW(t, 118, int) /* set pgrp of tty */ #define TIOCSLTC _IOW(t,117,struct ltchars)/* set local special chars */ #define TIOCGLTC _IOR(t,116,struct ltchars)/* get local special chars */ #define TIOCSTI _IOW(t, 114, char) /* simulate terminal input */ #define TIOCNOTTY _IO(t, 113) /* void tty association */ #define TIOCPKT _IOW(t, 112, int) /* pty: set/clear packet mode */ #define TIOCPKT_DATA 0x00 /* data packet */ #define TIOCPKT_FLUSHREAD 0x01 /* flush packet */ #define TIOCPKT_FLUSHWRITE 0x02 /* flush packet */ #define TIOCPKT_STOP 0x04 /* stop output */ #define TIOCPKT_START 0x08 /* start output */ #define TIOCPKT_NOSTOP 0x10 /* no more ^S, ^Q */ #define TIOCPKT_DOSTOP 0x20 /* now do ^S ^Q */ #define TIOCSTOP _IO(t, 111) /* stop output, like ^S */ #define TIOCSTART _IO(t, 110) /* start output, like ^Q */ #define TIOCMSET _IOW(t, 109, int) /* set all modem bits */ #define TIOCMBIS _IOW(t, 108, int) /* bis modem bits */ #define TIOCMBIC _IOW(t, 107, int) /* bic modem bits */ #define TIOCMGET _IOR(t, 106, int) /* get all modem bits */ #define TIOCM_LE 0001 /* line enable */ #define TIOCM_DTR 0002 /* data terminal ready */ #define TIOCM_RTS 0004 /* request to send */ #define TIOCM_ST 0010 /* secondary transmit */ #define TIOCM_SR 0020 /* secondary receive */ #define TIOCM_CTS 0040 /* clear to send */ #define TIOCM_CAR 0100 /* carrier detect */ #define TIOCM_CD TIOCM_CAR #define TIOCM_RNG 0200 /* ring */ #define TIOCM_RI TIOCM_RNG #define TIOCM_DSR 0400 /* data set ready */ #define TIOCREMOTE _IO(t, 105) /* remote input editing */ #define OTTYDISC 0 /* old, v7 std tty driver */ #define NETLDISC 1 /* line discip for berk net */ #define NTTYDISC 2 /* new tty discipline */ #define TABLDISC 3 /* hitachi tablet discipline */ #define NTABLDISC 4 /* gtco tablet discipline */ #define FIOCLEX _IO(f, 1) /* set exclusive use on fd */ #define FIONCLEX _IO(f, 2) /* remove exclusive use */ /* another local */ #define FIONREAD _IOR(f, 127, int) /* get # bytes to read */ #define FIONBIO _IOW(f, 126, int) /* set/clear non-blocking i/o */ #define FIOASYNC _IOW(f, 125, int) /* set/clear async i/o */ /* socket i/o controls */ #define SIOCSHIWAT _IOW(s, 0, int) /* set high watermark */ #define SIOCGHIWAT _IOR(s, 1, int) /* get high watermark */ #define SIOCSLOWAT _IOW(s, 2, int) /* set low watermark */ #define SIOCGLOWAT _IOR(s, 3, int) /* get low watermark */ #define SIOCATMARK _IOR(s, 7, int) /* at oob mark? */ #define SIOCSPGRP _IOW(s, 8, int) /* set process group */ #define SIOCGPGRP _IOR(s, 9, int) /* get process group */ #define SIOCADDRT _IOW(s, 10, struct rtentry) /* add route */ #define SIOCDELRT _IOW(s, 11, struct rtentry) /* delete route */ #define SIOCSIFADDR _IOW(s, 12, struct ifreq) /* set ifnet address */ #define SIOCGIFADDR _IOWR(s,13, struct ifreq) /* get ifnet address */ #define SIOCSIFDSTADDR _IOW(s, 14, struct ifreq) /* set p-p address */ #define SIOCGIFDSTADDR _IOWR(s,15, struct ifreq) /* get p-p address */ #define SIOCSIFFLAGS _IOW(s, 16, struct ifreq) /* set ifnet flags */ #define SIOCGIFFLAGS _IOWR(s,17, struct ifreq) /* get ifnet flags */ #define SIOCGIFCONF _IOWR(s,20, struct ifconf) /* get ifnet list */ #endif b[_li2$ b by/* kernel.h 4.7 82/10/21 */ /* * Global variables for the kernel */ long rmalloc(); /* 1.1 */ long hostid; char hostname[32]; int hostnamelen; /* 1.2 */ struct timeval boottime; struct timeval time; struct timezone tz; /* XXX */ int hz; int tick; int lbolt; /* awoken once a second */ int realitexpire(); double avenrun[3]; #ifdef GPROF extern int profiling; extern char *s_lowpc; extern u_long s_textsize; extern u_short *kcount; #endif b[ali}-$ `b by/* map.h 4.7 81/11/08 */ /* * Resource Allocation Maps. * * Associated routines manage sub-allocation of an address space using * an array of segment descriptors. The first element of this array * is a map structure, describing the arrays extent and the name * of the controlled object. Each additional structure represents * a free segment of the address space. * * A call to rminit initializes a resource map and may also be used * to free some address space for the map. Subsequent calls to rmalloc * and rmfree allocate and free space in the resource map. If the resource * map becomes too fragmented to be described in the available space, * then some of the resource is discarded. This may lead to critical * shortages, but is better than not checking (as the previous versions * of these routines did) or giving up and calling panic(). The routines * could use linked lists and call a memory allocator when they run * out of space, but that would not solve the out of space problem when * called at interrupt time. * * N.B.: The address 0 in the resource address space is not available * as it is used internally by the resource map routines. */ struct map { struct mapent *m_limit; /* address of last slot in map */ char *m_name; /* name of resource */ /* we use m_name when the map overflows, in warning messages */ }; struct mapent { int m_size; /* size of this segment of the map */ int m_addr; /* resource-space addr of start of segment */ }; #ifdef KERNEL struct map *swapmap; int nswapmap; struct map *argmap; #define ARGMAPSIZE 16 struct map *kernelmap; struct map *mbmap; #endif b[dliu}$ b by/* mbuf.h 4.18 83/04/08 */ /* * Constants related to memory allocator. */ #define MSIZE 128 /* size of an mbuf */ #define MMINOFF 12 /* mbuf header length */ #define MTAIL 4 #define MMAXOFF (MSIZE-MTAIL) /* offset where data ends */ #define MLEN (MSIZE-MMINOFF-MTAIL) /* mbuf data length */ #define NMBCLUSTERS 256 #define NMBPCL (CLBYTES/MSIZE) /* # mbufs per cluster */ /* * Macros for type conversion */ /* network cluster number to virtual address, and back */ #define cltom(x) ((struct mbuf *)((int)mbutl + ((x) << CLSHIFT))) #define mtocl(x) (((int)x - (int)mbutl) >> CLSHIFT) /* address in mbuf to mbuf head */ #define dtom(x) ((struct mbuf *)((int)x & ~(MSIZE-1))) /* mbuf head, to typed data */ #define mtod(x,t) ((t)((int)(x) + (x)->m_off)) struct mbuf { struct mbuf *m_next; /* next buffer in chain */ u_long m_off; /* offset of data */ short m_len; /* amount of data in this mbuf */ short m_type; /* mbuf type (0 == free) */ u_char m_dat[MLEN]; /* data storage */ struct mbuf *m_act; /* link in higher-level mbuf list */ }; /* mbuf types */ #define MT_FREE 0 /* should be on free list */ #define MT_DATA 1 /* dynamic (data) allocation */ #define MT_HEADER 2 /* packet header */ #define MT_SOCKET 3 /* socket structure */ #define MT_PCB 4 /* protocol control block */ #define MT_RTABLE 5 /* routing tables */ #define MT_HTABLE 6 /* IMP host tables */ #define MT_ATABLE 7 /* address resolution tables */ #define MT_SONAME 8 /* socket name */ #define MT_ZOMBIE 9 /* zombie proc status */ #define MT_SOOPTS 10 /* socket options */ #define MT_FTABLE 11 /* fragment reassembly header */ /* flags to m_get */ #define M_DONTWAIT 0 #define M_WAIT 1 /* flags to m_pgalloc */ #define MPG_MBUFS 0 /* put new mbufs on free list */ #define MPG_CLUSTERS 1 /* put new clusters on free list */ #define MPG_SPACE 2 /* don't free; caller wants space */ /* length to m_copy to copy all */ #define M_COPYALL 1000000000 #define MGET(m, i, t) \ { int ms = splimp(); \ if ((m)=mfree) \ { if ((m)->m_type != MT_FREE) panic("mget"); (m)->m_type = t; \ mbstat.m_mbfree--; mbstat.m_mtypes[t]++; \ mfree = (m)->m_next; (m)->m_next = 0; \ (m)->m_off = MMINOFF; } \ else \ (m) = m_more(i, t); \ splx(ms); } #define MCLGET(m, i) \ { int ms = splimp(); \ if ((m)=mclfree) \ {++mclrefcnt[mtocl(m)];mbstat.m_clfree--;mclfree = (m)->m_next;} \ splx(ms); } #define MFREE(m, n) \ { int ms = splimp(); \ if ((m)->m_type == MT_FREE) panic("mfree"); \ mbstat.m_mtypes[(m)->m_type]--; (m)->m_type = MT_FREE; \ if ((m)->m_off > MSIZE) { \ (n) = (struct mbuf *)(mtod(m, int)&~CLOFSET); \ if (--mclrefcnt[mtocl(n)] == 0) \ { (n)->m_next = mclfree;mclfree = (n);mbstat.m_clfree++;} \ } \ (n) = (m)->m_next; (m)->m_next = mfree; \ (m)->m_off = 0; (m)->m_act = 0; mfree = (m); mbstat.m_mbfree++; \ splx(ms); } /* * Mbuf statistics. */ struct mbstat { short m_mbufs; /* mbufs obtained from page pool */ short m_mbfree; /* mbufs on our free list */ short m_clusters; /* clusters obtained from page pool */ short m_clfree; /* free clusters */ short m_drops; /* times failed to find space */ short m_mtypes[256]; /* type specific mbuf allocations */ }; #ifdef KERNEL extern struct mbuf mbutl[]; /* virtual address of net free mem */ extern struct pte Mbmap[]; /* page tables to map Netutl */ struct mbstat mbstat; int nmbclusters; struct mbuf *mfree, *mclfree; char mclrefcnt[NMBCLUSTERS]; struct mbuf *m_get(),*m_getclr(),*m_free(),*m_more(),*m_copy(),*m_pullup(); caddr_t m_clalloc(); #endif b[i li$ b by/* mman.h 4.2 82/09/04 */ /* protections are chosen from these bits, or-ed together */ #define PROT_READ 0x1 /* pages can be read */ #define PROT_WRITE 0x2 /* pages can be written */ #define PROT_EXEC 0x4 /* pages can be executed */ /* sharing types: choose either SHARED or PRIVATE */ #define MAP_SHARED 1 /* share changes */ #define MAP_PRIVATE 2 /* changes are private */ /* advice to madvise */ #define MADV_NORMAL 0 /* no further special treatment */ #define MADV_RANDOM 1 /* expect random page references */ #define MADV_SEQUENTIAL 2 /* expect sequential page references */ #define MADV_WILLNEED 3 /* will need these pages */ #define MADV_DONTNEED 4 /* dont need these pages */ b[k!li$ b byg/* mount.h 4.4 82/07/19 */ /* * Mount structure. * One allocated on every mount. * Used to find the super block. */ struct mount { dev_t m_dev; /* device mounted */ struct buf *m_bufp; /* pointer to superblock */ struct inode *m_inodp; /* pointer to mounted on inode */ struct inode *m_qinod; /* QUOTA: pointer to quota file */ }; #ifdef KERNEL struct mount mount[NMOUNT]; #endif b[m"li$ b by/* msgbuf.h 4.3 81/08/30 */ #define MSG_MAGIC 0x063060 #define MSG_BSIZE (4096 - 2 * sizeof (long)) struct msgbuf { long msg_magic; long msg_bufx; char msg_bufc[MSG_BSIZE]; }; #ifdef KERNEL struct msgbuf msgbuf; #endif b[o#li}7$ 4b by/* mtio.h 4.10 83/01/17 */ /* * Structures and definitions for mag tape io control commands */ /* structure for MTIOCTOP - mag tape op command */ struct mtop { short mt_op; /* operations defined below */ daddr_t mt_count; /* how many of them */ }; /* operations */ #define MTWEOF 0 /* write an end-of-file record */ #define MTFSF 1 /* forward space file */ #define MTBSF 2 /* backward space file */ #define MTFSR 3 /* forward space record */ #define MTBSR 4 /* backward space record */ #define MTREW 5 /* rewind */ #define MTOFFL 6 /* rewind and put the drive offline */ #define MTNOP 7 /* no operation, sets status only */ /* structure for MTIOCGET - mag tape get status command */ struct mtget { short mt_type; /* type of magtape device */ /* the following two registers are grossly device dependent */ short mt_dsreg; /* ``drive status'' register */ short mt_erreg; /* ``error'' register */ /* end device-dependent registers */ short mt_resid; /* residual count */ /* the following two are not yet implemented */ daddr_t mt_fileno; /* file number of current position */ daddr_t mt_blkno; /* block number of current position */ /* end not yet implemented */ }; /* * Constants for mt_type byte */ #define MT_ISTS 0x01 #define MT_ISHT 0x02 #define MT_ISTM 0x03 #define MT_ISMT 0x04 #define MT_ISUT 0x05 #define MT_ISCPC 0x06 #define MT_ISAR 0x07 /* mag tape io control commands */ #define MTIOCTOP _IOW(m, 1, struct mtop) /* do a mag tape op */ #define MTIOCGET _IOR(m, 2, struct mtget) /* get tape status */ #ifndef KERNEL #define DEFTAPE "/dev/rmt12" #endif b[r$li|,$ 3b by/* mu_msg.h Melb 4.2 82/10/20 */ /* * Melb Uni trivial IPC mechanism */ #ifdef MUSH #ifndef DATA_T /* so people can make a union/struct if they want */ #define DATA_T long #endif typedef struct { #ifdef vax /* this isn't important, just nice */ u_short msg_uid : 15; /* effective sender uid (or code if pid==0) */ u_short msg_val : 1; /* msg is valid, ie: really sent by someone */ u_short msg_pid : 15; /* rcv: proc id of sender, snd: dest addr */ u_short msg_rply: 1; /* rcv: reply required, snd: recv reply only */ #else u_short msg_rply: 1; u_short msg_pid : 15; u_short msg_val : 1; u_short msg_uid : 15; #endif DATA_T msg_data; } mmsgbuf; /* * The following relate to the mu_msg() sys call */ typedef enum { MSG_ENAB, /* enable input msgs to process */ MSG_DISB, /* no more messages */ MSG_RECV, /* get a message */ MSG_SEND, /* send a message */ MSG_SNDW, /* send a msg then get one */ MSG_RPLY, /* send a reply */ } msg_type; #define MSG_W_RCV 0x0001 /* wait for message to be received */ #define MSG_W_POST 0x0002 /* wait till queued to receiver */ #define MSG_W_DLV 0x0004 /* wait till delivered (not impl) */ #define MSG_W_Q 0x0008 /* wait if process queues full (not impl) */ #define MSG_W_ENAB 0x0010 /* wait till rcvr enables messages (not impl) */ #ifdef KERNEL /* * Some of this stuff belongs other places, but ... */ #define MSGENAB 0x0001 /* process has messages enabled */ #define MSGOK 0x0002 /* process is waiting for msg */ #define MSGWRPLY 0x0004 /* message process is waiting for is a reply */ #define MSGRPLY 0x0008 /* process must reply to last msg */ #define MSGWAIT 0x0010 /* some process is waiting on our msgbuf */ #define MSGPRI (PZERO+4) /* Interruptible */ struct proc *mu_send(); #endif #define SIGMESG 28 /* sig sent to MSGENAB'd proc if msg arrives */ #endif b[u%li~ȁ$ b by/* mush.h Melb 4.1 82/07/16 */ /* * MUSH * * format of messages sent from the system to the mush daemon (pid 3) */ #define MUSHPID 3 typedef union { struct d_s { char D_req; char D_info; short D_uid; union { struct { short D_sdat; short D_xdat; } d_us; long D_ldat; float D_fdat; } d_u; } d_s; char d_c[sizeof(struct d_s)]; } data_t; #define d_req d_s.D_req #define d_info d_s.D_info #define d_uid d_s.D_uid #define d_sdat d_s.d_u.d_us.D_sdat #define d_xdat d_s.d_u.d_us.D_xdat #define d_ldat d_s.d_u.D_ldat #define d_fdat d_s.d_u.D_fdat #define DATA_T data_t /* * MUSH messages (D_req values) - to MUSH from kernel */ #define MM_PROC1 1 /* first process created for uid */ #define MM_PROCX 2 /* last process for uid exited */ #define MM_LOGIN 3 /* additional login for uid */ #define MM_LOGOUT 4 /* user login proc exited (not last proc) */ #define MM_ATJOB 5 /* at job has started for uid */ #define MM_NOCPU 6 /* user isn't getting any cpu time */ /* * nb: the preceding msgs are ignored if they concern uid 0 * the ones that follow are not */ #define MM_NEWCLASS 9 /* current class has (might have) altered */ b[x&li=$ b byw/* nami.h 4.2 82/11/13 */ struct namidata { int ni_offset; int ni_count; struct inode *ni_pdir; struct direct ni_dent; }; enum nami_op { NAMI_LOOKUP, NAMI_CREATE, NAMI_DELETE }; /* this is temporary until the namei interface changes */ #define LOOKUP 0 /* perform name lookup only */ #define CREATE 1 /* setup for file creation */ #define DELETE 2 /* setup for file deletion */ #define LOCKPARENT 0x10 /* see the top of namei */ b[z'li^$ b  by/* param.h 4.32 83/04/19 */ /* * Machine type dependent parameters. */ #ifdef KERNEL #include "../machine/param.h" #else #include #endif #define NPTEPG (NBPG/(sizeof (struct pte))) /* * Machine-independent constants */ #define NMOUNT 15 /* number of mountable file systems */ #define MSWAPX 15 /* pseudo mount table index for swapdev */ #define MAXUPRC 25 /* max processes per user */ #define NOFILE 20 /* max open files per process */ /* NOFILE MUST NOT BE >= 31; SEE pte.h */ #define CANBSIZ 256 /* max size of typewriter line */ #define NCARGS 10240 /* # characters in exec arglist */ #define NGROUPS 8 /* max number groups */ #define NOGROUP -1 /* marker for empty group set member */ /* * Priorities */ #define PSWP 0 #define PINOD 10 #define PRIBIO 20 #define PRIUBA 24 #define PZERO 25 #define PPIPE 26 #define PWAIT 30 #define PLOCK 35 #define PSLEP 40 #define PUSER 50 #define NZERO 20 /* * Signals */ #ifndef NSIG #include #endif #define ISSIG(p) ((p)->p_sig && \ ((p)->p_flag&STRC || ((p)->p_sig &~ (p)->p_ignsig)) && issig()) /* * Fundamental constants of the implementation. */ #define NBBY 8 /* number of bits in a byte */ #define NBPW sizeof(int) /* number of bytes in an integer */ #define NULL 0 #define CMASK 0 /* default mask for file creation */ #define NODEV (dev_t)(-1) /* * Clustering of hardware pages on machines with ridiculously small * page sizes is done here. The paging subsystem deals with units of * CLSIZE pte's describing NBPG (from vm.h) pages each... BSIZE must * be CLSIZE*NBPG in the current implementation, that is the paging subsystem * deals with the same size blocks that the file system uses. * * NOTE: SSIZE, SINCR and UPAGES must be multiples of CLSIZE */ #define CLBYTES (CLSIZE*NBPG) #define CLOFSET (CLSIZE*NBPG-1) /* for clusters, like PGOFSET */ #define claligned(x) ((((int)(x))&CLOFSET)==0) #define CLOFF CLOFSET #define CLSHIFT (PGSHIFT+CLSIZELOG2) #if CLSIZE==1 #define clbase(i) (i) #define clrnd(i) (i) #else /* give the base virtual address (first of CLSIZE) */ #define clbase(i) ((i) &~ (CLSIZE-1)) /* round a number of clicks up to a whole cluster */ #define clrnd(i) (((i) + (CLSIZE-1)) &~ (CLSIZE-1)) #endif #ifndef INTRLVE /* macros replacing interleaving functions */ #define dkblock(bp) ((bp)->b_blkno) #define dkunit(bp) (minor((bp)->b_dev) >> 3) #endif #define CBSIZE 28 /* number of chars in a clist block */ #define CROUND 0x1F /* clist rounding; sizeof(int *) + CBSIZE -1*/ #ifndef KERNEL #include #else #ifndef LOCORE #include "../h/types.h" #endif #endif /* * File system parameters and macros. * * The file system is made out of blocks of at most MAXBSIZE units, * with smaller units (fragments) only in the last direct block. * MAXBSIZE primarily determines the size of buffers in the buffer * pool. It may be made larger without any effect on existing * file systems; however making it smaller make make some file * systems unmountable. * * Note that the blocked devices are assumed to have DEV_BSIZE * "sectors" and that fragments must be some multiple of this size. * Block devices are read in BLKDEV_IOSIZE units. This number must * be a power of two and in the range of * DEV_BSIZE <= BLKDEV_IOSIZE <= MAXBSIZE * This size has no effect upon the file system, but is usually set * to the block size of the root file system, so as to maximize the * speed of ``fsck''. */ #define MAXBSIZE 8192 #define DEV_BSIZE 512 #define BLKDEV_IOSIZE 2048 #define MAXFRAG 8 /* * Map a ``block device block'' to a file system block. * This should be device dependent, and will be after we * add an entry to cdevsw for that purpose. For now though * just use DEV_BSIZE. */ #define bdbtofsb(bn) ((bn) / (BLKDEV_IOSIZE/DEV_BSIZE)) /* * MAXPATHLEN defines the longest permissable path length * after expanding symbolic links. It is used to allocate * a temporary buffer from the buffer pool in which to do the * name expansion, hence should be a power of two, and must * be less than or equal to MAXBSIZE. * MAXSYMLINKS defines the maximum number of symbolic links * that may be expanded in a path name. It should be set high * enough to allow all legitimate uses, but halt infinite loops * reasonably quickly. */ #define MAXPATHLEN 1024 #define MAXSYMLINKS 8 /* * bit map related macros */ #define setbit(a,i) ((a)[(i)/NBBY] |= 1<<((i)%NBBY)) #define clrbit(a,i) ((a)[(i)/NBBY] &= ~(1<<((i)%NBBY))) #define isset(a,i) ((a)[(i)/NBBY] & (1<<((i)%NBBY))) #define isclr(a,i) (((a)[(i)/NBBY] & (1<<((i)%NBBY))) == 0) /* * Macros for fast min/max. */ #define MIN(a,b) (((a)<(b))?(a):(b)) #define MAX(a,b) (((a)>(b))?(a):(b)) /* * Macros for counting and rounding. */ #define howmany(x, y) (((x)+((y)-1))/(y)) #define roundup(x, y) ((((x)+((y)-1))/(y))*(y)) b[(li^$ b  by /* proc.h 4.21 83/03/26 */ /* * One structure allocated per active * process. It contains all data needed * about the process while the * process may be swapped out. * Other per process data (user.h) * is swapped with the process. */ struct proc { struct proc *p_link; /* linked list of running processes */ struct proc *p_rlink; struct pte *p_addr; /* u-area kernel map address */ char p_usrpri; /* user-priority based on p_cpu and p_nice */ char p_pri; /* priority, negative is high */ char p_cpu; /* cpu usage for scheduling */ char p_stat; char p_time; /* resident time for scheduling */ char p_nice; /* nice for cpu usage */ char p_slptime; /* time since last block */ char p_cursig; long p_sig; /* signals pending to this process */ long p_siga0; /* low bit of 2 bit signal action */ long p_siga1; /* high bit of 2 bit signal action */ #define p_ignsig p_siga0 /* ignored signal mask */ int p_flag; short p_uid; /* user id, used to direct tty signals */ short p_pgrp; /* name of process group leader */ short p_pid; /* unique process id */ short p_ppid; /* process id of parent */ u_short p_xstat; /* Exit status for wait */ struct rusage *p_ru; /* mbuf holding exit information */ short p_poip; /* page outs in progress */ short p_szpt; /* copy of page table size */ size_t p_tsize; /* size of text (clicks) */ size_t p_dsize; /* size of data space (clicks) */ size_t p_ssize; /* copy of stack size (clicks) */ size_t p_rssize; /* current resident set size in clicks */ size_t p_maxrss; /* copy of u.u_limit[MAXRSS] */ size_t p_swrss; /* resident set size before last swap */ swblk_t p_swaddr; /* disk address of u area when swapped */ caddr_t p_wchan; /* event process is awaiting */ struct text *p_textp; /* pointer to text structure */ struct pte *p_p0br; /* page table base P0BR */ struct proc *p_xlink; /* linked list of procs sharing same text */ short p_cpticks; /* ticks of cpu time */ float p_pctcpu; /* %cpu for this process during p_time */ short p_ndx; /* proc index for memall (because of vfork) */ short p_idhash; /* hashed based on p_pid for kill+exit+... */ struct proc *p_pptr; /* pointer to process structure of parent */ struct proc *p_cptr; /* pointer to youngest living child */ struct proc *p_osptr; /* pointer to older sibling processes */ struct proc *p_ysptr; /* pointer to younger siblings */ struct itimerval p_realtimer; #ifdef sun struct context *p_ctx; /* pointer to current context */ #endif #ifdef QUOTA struct quota *p_quota; /* quotas for this process (MUSH) */ #endif #ifdef MUSH mmsgbuf p_mb; /* pending message */ int p_msgflgs; /* message flags */ #endif }; #define PIDHSZ 63 #define PIDHASH(pid) ((pid) % PIDHSZ) #ifdef KERNEL short pidhash[PIDHSZ]; struct proc *pfind(); #endif #ifdef KERNEL struct proc *proc, *procNPROC; /* the proc table itself */ int nproc; #define NQS 32 /* 32 run queues */ struct prochd { struct proc *ph_link; /* linked list of running processes */ struct proc *ph_rlink; } qs[NQS]; int whichqs; /* bit mask summarizing non-empty qs's */ #endif /* stat codes */ #define SSLEEP 1 /* awaiting an event */ #define SWAIT 2 /* (abandoned state) */ #define SRUN 3 /* running */ #define SIDL 4 /* intermediate state in process creation */ #define SZOMB 5 /* intermediate state in process termination */ #define SSTOP 6 /* process being traced */ /* flag codes */ #define SLOAD 0x0000001 /* in core */ #define SSYS 0x0000002 /* swapper or pager process */ #define SLOCK 0x0000004 /* process being swapped out */ #define SSWAP 0x0000008 /* save area flag */ #define STRC 0x0000010 /* process is being traced */ #define SWTED 0x0000020 /* another tracing flag */ #define SULOCK 0x0000040 /* user settable lock in core */ #define SPAGE 0x0000080 /* process in page wait state */ #define SKEEP 0x0000100 /* another flag to prevent swap out */ /* was SDLYU */ #define SWEXIT 0x0000400 /* working on exiting */ #define SPHYSIO 0x0000800 /* doing physical i/o (bio.c) */ #define SVFORK 0x0001000 /* process resulted from vfork() */ #define SVFDONE 0x0002000 /* another vfork flag */ #define SNOVM 0x0004000 /* no vm, parent in a vfork() */ #define SPAGI 0x0008000 /* init data space on demand, from inode */ #define SSEQL 0x0010000 /* user warned of sequential vm behavior */ #define SUANOM 0x0020000 /* user warned of random vm behavior */ #define STIMO 0x0040000 /* timing out during sleep */ /* was SDETACH */ #define SNUSIG 0x0100000 /* using new signal mechanism */ #define SOWEUPC 0x0200000 /* owe process an addupc() call at next ast */ #define SSEL 0x0400000 /* selecting; wakeup/waiting danger */ #define SLOGIN 0x0800000 /* a login process (legit child of init) */ #define SPTECHG 0x1000000 /* pte's for process have changed */ b[)liX$ db  by$,/* protosw.h 4.14 82/11/13 */ /* * Protocol switch table. * * Each protocol has a handle initializing one of these structures, * which is used for protocol-protocol and system-protocol communication. * * A protocol is called through the pr_init entry before any other. * Thereafter it is called every 200ms through the pr_fasttimo entry and * every 500ms through the pr_slowtimo for timer based actions. * The system will call the pr_drain entry if it is low on space and * this should throw away any non-critical data. * * Protocols pass data between themselves as chains of mbufs using * the pr_input and pr_output hooks. Pr_input passes data up (towards * UNIX) and pr_output passes it down (towards the imps); control * information passes up and down on pr_ctlinput and pr_ctloutput. * The protocol is responsible for the space occupied by any the * arguments to these entries and must dispose it. * * The userreq routine interfaces protocols to the system and is * described below. */ struct protosw { short pr_type; /* socket type used for */ short pr_family; /* protocol family */ short pr_protocol; /* protocol number */ short pr_flags; /* see below */ /* protocol-protocol hooks */ int (*pr_input)(); /* input to protocol (from below) */ int (*pr_output)(); /* output to protocol (from above) */ int (*pr_ctlinput)(); /* control input (from below) */ int (*pr_ctloutput)(); /* control output (from above) */ /* user-protocol hook */ int (*pr_usrreq)(); /* user request: see list below */ /* utility hooks */ int (*pr_init)(); /* initialization hook */ int (*pr_fasttimo)(); /* fast timeout (200ms) */ int (*pr_slowtimo)(); /* slow timeout (500ms) */ int (*pr_drain)(); /* flush any excess space possible */ }; #define PR_SLOWHZ 2 /* 2 slow timeouts per second */ #define PR_FASTHZ 5 /* 5 fast timeouts per second */ /* * Values for pr_flags */ #define PR_ATOMIC 0x01 /* exchange atomic messages only */ #define PR_ADDR 0x02 /* addresses given with messages */ /* in the current implementation, PR_ADDR needs PR_ATOMIC to work */ #define PR_CONNREQUIRED 0x04 /* connection required by protocol */ #define PR_WANTRCVD 0x08 /* want PRU_RCVD calls */ /* * The arguments to usrreq are: * (*protosw[].pr_usrreq)(up, req, m, nam, opt); * where up is a (struct socket *), req is one of these requests, * m is a optional mbuf chain containing a message, * nam is an optional mbuf chain containing an address, * and opt is a pointer to a socketopt structure or nil. * The protocol is responsible for disposal of the mbuf chain m, * the caller is responsible for any space held by nam and opt. * A non-zero return from usrreq gives an * UNIX error number which should be passed to higher level software. */ #define PRU_ATTACH 0 /* attach protocol to up */ #define PRU_DETACH 1 /* detach protocol from up */ #define PRU_BIND 2 /* bind socket to address */ #define PRU_LISTEN 3 /* listen for connection */ #define PRU_CONNECT 4 /* establish connection to peer */ #define PRU_ACCEPT 5 /* accept connection from peer */ #define PRU_DISCONNECT 6 /* disconnect from peer */ #define PRU_SHUTDOWN 7 /* won't send any more data */ #define PRU_RCVD 8 /* have taken data; more room now */ #define PRU_SEND 9 /* send this data */ #define PRU_ABORT 10 /* abort (fast DISCONNECT, DETATCH) */ #define PRU_CONTROL 11 /* control operations on protocol */ #define PRU_SENSE 12 /* return status into m */ #define PRU_RCVOOB 13 /* retrieve out of band data */ #define PRU_SENDOOB 14 /* send out of band data */ #define PRU_SOCKADDR 15 /* fetch socket's address */ /* begin for protocols internal use */ #define PRU_FASTTIMO 16 /* 200ms timeout */ #define PRU_SLOWTIMO 17 /* 500ms timeout */ #define PRU_PROTORCV 18 /* receive from below */ #define PRU_PROTOSEND 19 /* send to below */ #define PRU_NREQ 20 #ifdef PRUREQUESTS char *prurequests[] = { "ATTACH", "DETACH", "BIND", "LISTEN", "CONNECT", "ACCEPT", "DISCONNECT", "SHUTDOWN", "RCVD", "SEND", "ABORT", "CONTROL", "SENSE", "RCVOOB", "SENDOOB", "SOCKADDR", "FASTTIMO", "SLOWTIMO", "PROTORCV", "PROTOSEND", }; #endif /* * The arguments to the ctlinput routine are * (*protosw[].pr_ctlinput)(cmd, arg); * where cmd is one of the commands below, and arg is * an optional argument (caddr_t). * * N.B. The IMP code, in particular, pressumes the values * of some of the commands; change with extreme care. * TODO: * spread out codes so new ICMP codes can be * accomodated more easily */ #define PRC_IFDOWN 0 /* interface transition */ #define PRC_ROUTEDEAD 1 /* select new route if possible */ #define PRC_QUENCH 4 /* some said to slow down */ #define PRC_MSGSIZE 5 /* message size forced drop */ #define PRC_HOSTDEAD 6 /* normally from IMP */ #define PRC_HOSTUNREACH 7 /* ditto */ #define PRC_UNREACH_NET 8 /* no route to network */ #define PRC_UNREACH_HOST 9 /* no route to host */ #define PRC_UNREACH_PROTOCOL 10 /* dst says bad protocol */ #define PRC_UNREACH_PORT 11 /* bad port # */ #define PRC_UNREACH_SRCFAIL 12 /* source route failed */ #define PRC_REDIRECT_NET 13 /* net routing redirect */ #define PRC_REDIRECT_HOST 14 /* host routing redirect */ #define PRC_REDIRECT_TOSNET 15 /* redirect for type of service & net */ #define PRC_REDIRECT_TOSHOST 16 /* redirect for tos & host */ #define PRC_TIMXCEED_INTRANS 17 /* packet lifetime expired in transit */ #define PRC_TIMXCEED_REASS 18 /* lifetime expired on reass q */ #define PRC_PARAMPROB 19 /* header incorrect */ #define PRC_NCMDS 20 #ifdef PRCREQUESTS char *prcrequests[] = { "IFDOWN", "ROUTEDEAD", "#2", "#3", "QUENCH", "MSGSIZE", "HOSTDEAD", "HOSTUNREACH", "NET-UNREACH", "HOST-UNREACH", "PROTO-UNREACH", "PORT-UNREACH", "SRCFAIL-UNREACH", "NET-REDIRECT", "HOST-REDIRECT", "TOSNET-REDIRECT", "TOSHOST-REDIRECT","TX-INTRANS", "TX-REASS", "PARAMPROB" }; #endif #ifdef KERNEL extern struct protosw *pffindproto(), *pffindtype(); #endif b[*liS$ _b  by(0/* quota.h Melb 4.2 82/10/20 */ #ifdef QUOTA /* * Various junk to do with various quotas (etc) imposed upon * the average user (big brother finally hits unix) * * The following structure exists in core for each logged on user * It contains global junk relevant to that user's quotas * * The u_quota field of each user struct contains a pointer to * the quota struct relevant to the current process, this is changed * by 'setuid' sys call, &/or by the Q_SETUID quota() call */ typedef long class_t; struct quinfo { u_short qu_shares; /* allocated shares (MUSH) */ short qu_plim; /* process limit */ long qu_syflags; /* system permission flags */ float qu_usage; /* current resource usage (MUSH) */ class_t qu_class; /* user classes (MUSH) */ }; #ifdef KERNEL struct quota { struct quota *q_forw; /* hash chain - MUST be first */ struct quota *q_back; /* hash chain - MUST be last */ char q_flg; /* struct management flags */ char q_lcnt; /* count of logins for user */ short q_cnt; /* ref count (# processes) */ short q_uid; /* real uid of owner */ short q_nice; /* nice added to p_cpu (MUSH) */ short q_acnt; /* count of 'at' processes (MUSH) */ union { struct { long Q_rate; /* recent work rate (MUSH) */ long Q_cost; /* cost in recent period (MUSH) */ } q_s1; struct { struct quota *Q_freef; struct quota **Q_freeb; } q_s2; } q_u; struct quinfo q_uinfo; /* user limits & usage (MUSH) */ struct dquot *q_dq[NMOUNT]; /* disc quotas for mounted filesys's */ }; #define NOQUOT ((struct quota *) 0) #define q_rate q_u.q_s1.Q_rate #define q_cost q_u.q_s1.Q_cost #define q_freef q_u.q_s2.Q_freef #define q_freeb q_u.q_s2.Q_freeb #define q_shares q_uinfo.qu_shares #define q_plim q_uinfo.qu_plim #define q_syflags q_uinfo.qu_syflags #define q_usage q_uinfo.qu_usage #define q_class q_uinfo.qu_class #endif #define QF_KASYNC 0x02 /* kill async procs at logout */ #define QF_FASTTY 0x04 /* permitted to raise tty speed */ #define QF_NASYNC 0x08 /* nice async procs at logout */ #define QF_MODTTY 0x10 /* permitted to modify other tty */ #define QF_UMASK 0x20 /* not permitted to alter umask */ #ifdef KERNEL struct quota *quota, *quotaNQUOTA; int nquota; struct quota *getquota(), *qfind(); #endif /* q_flg flags */ #define Q_LOCK 0x01 /* quota struct locked (for disc i/o) */ #define Q_WANT 0x02 /* issue a wakeup when lock goes off */ #define Q_NEW 0x04 /* new quota - no proc1 msg sent yet */ #define Q_NDQ 0x08 /* account has NO disc quota */ /* * The following structure defines the format of the disc quota file * (as it appears on disc) - the file is an array of these structures * indexed by user number. A sys call (setquota) establishes the * inode for each applicable file (a pointer is retained in the mount * structure) * * nb: warning fields contain the number of warnings left before * allocation is halted completely */ typedef unsigned short dlim_t; struct dqblk { dlim_t dqb_ilim; /* max num allocated inodes + 1 */ dlim_t dqb_iq; /* preferred inode limit */ dlim_t dqb_inod; /* current num allocated inodes */ dlim_t dqb_iwarn; /* # warnings about excessive inodes */ dlim_t dqb_blim; /* abs limit on disc blks alloc */ dlim_t dqb_quot; /* preferred limit on disc blks */ dlim_t dqb_blks; /* current block count */ dlim_t dqb_dwarn; /* # warnings about excessive disc use */ }; #define MAX_IQ_WARN 3 #define MAX_DQ_WARN 3 /* * The following structure records disc usage for a user on a filesystem * There is one allocated for each quota that exists on any filesystem * for the current user. A cache is kept of other recently used entries. */ struct dquot { struct dquot *dq_forw; /* MUST be first entry */ struct dquot *dq_back; /* MUST be second entry */ union { struct quota *Dq_own; /* the quota that points to this */ struct { struct dquot *Dq_freef; /* forward free chain ptr */ struct dquot **Dq_freeb;/* backward free chain ptr */ } dq_f; } dq_u; short dq_flg; short dq_cnt; /* count of active references */ short dq_uid; /* user this applies to */ dev_t dq_dev; /* filesystem this relates to */ struct dqblk dq_dqb; /* actual usage & quotas */ }; #define dq_own dq_u.Dq_own #define dq_freef dq_u.dq_f.Dq_freef #define dq_freeb dq_u.dq_f.Dq_freeb #define dq_ilim dq_dqb.dqb_ilim #define dq_iq dq_dqb.dqb_iq #define dq_inod dq_dqb.dqb_inod #define dq_iwarn dq_dqb.dqb_iwarn #define dq_blim dq_dqb.dqb_blim #define dq_quot dq_dqb.dqb_quot #define dq_blks dq_dqb.dqb_blks #define dq_dwarn dq_dqb.dqb_dwarn #define NODQUOT ((struct dquot *) 0) #define LOSTDQUOT ((struct dquot *) 1) #ifdef KERNEL struct dquot *dquot, *dquotNDQUOT; int ndquot; struct dquot *discquota(), *inoquota(), *dqalloc(); #endif /* dq_flg flags */ #define DQ_LOCK 0x01 /* this quota locked (no MODS) */ #define DQ_WANT 0x02 /* wakeup on unlock */ #define DQ_MOD 0x04 /* this quota modified since read */ #define DQ_FAKE 0x08 /* no limits here, just usage */ #define DQ_BLKS 0x10 /* has been warned about blk limit */ #define DQ_INODS 0x20 /* has been warned about inode limit */ /* * Commands for the 'quota' system call */ #define Q_SETDLIM 1 /* set disc limits & usage */ #define Q_GETDLIM 2 /* get disc limits & usage */ #define Q_SETDUSE 3 /* set disc usage only */ #define Q_SYNC 4 /* update disc copy if quota usages */ #define Q_LOGIN 5 /* Count this as a login process */ #define Q_LCOUNT 6 /* get count of login processes */ #define Q_PCOUNT 7 /* get count of processes */ #define Q_USAGE 8 /* get current usage */ #define Q_SFLAGS 9 /* set system flags */ #define Q_SUSAGE 10 /* set usage */ #define Q_SPLIMIT 11 /* set process limit */ #define Q_ISLOGIN 12 /* is this a login process ?? */ #define Q_SCLASS 13 /* set user class */ #define Q_SCURCL 14 /* set current system classes */ #define Q_GCURCL 15 /* get current system classes */ #define Q_SETUID 16 /* change proc to use quotas for uid */ #define Q_FLOGIN 17 /* "fake" login (counts as 1, but isn't) */ #define Q_SETCOST 18 /* set system charge rates */ #define Q_GETCOST 19 /* get system charge rates */ #define Q_SSHARE 20 /* set shares */ #define Q_SUINFO 21 /* set user info */ #define Q_GUINFO 22 /* get user info */ #define Q_ATJOB 23 /* this process is an 'at' job (background) */ #define Q_ACOUNT 24 /* return count of procs descended from ATJ */ #define Q_SETWARN 25 /* alter inode/block warning counts */ #define Q_DOWARN 26 /* warn user about excessive space/inodes */ #define Q_KILL 27 /* send signal to procs attatched to quota */ #define Q_NICE 28 /* set niceness for procs attatched to quota */ /* * current class information * * records sched biasing for classes that are to have priority * enhanced or degraded */ #define NCLASS 8 struct qclass { class_t class; /* classes this applies to */ long cost; /* +/- mod to cost incurred */ short maxn; /* in this class, no nice > this */ short minn; /* in this class, no nice < this */ }; #ifdef KERNEL struct qclass curclass[NCLASS]; #endif /* * Flag definitions for u_qflags in user struct (u_qflags) */ #define QUF_LOGIN 0x0001 /* this process incremented login cnt */ #define QUF_ATJ 0x0002 /* this process descended from atrun */ #endif QUOTA b[+li0$ =b by/* reboot.h 4.3 82/10/31 */ /* * Arguments to reboot system call. * These are passed to boot program in r11, * and on to init. */ #define RB_AUTOBOOT 0 /* flags for system auto-booting itself */ #define RB_ASKNAME 0x01 /* ask for file name to reboot from */ #define RB_SINGLE 0x02 /* reboot to single user only */ #define RB_NOSYNC 0x04 /* dont sync before reboot */ #define RB_HALT 0x08 /* don't reboot, just halt */ #define RB_INITNAME 0x10 /* name given for /etc/init */ #define RB_PANIC 0 /* reboot due to panic */ #define RB_BOOT 1 /* reboot due to boot() */ b[,liȁ$ {b by/* seg.h 4.2 81/02/19 */ /* * Mapper addresses and bits */ #define RO PG_URKR /* access abilities */ #define RW PG_UW b[-li|$ ab by./* share.h (Melb/Basser) 4.1 82/07/16 */ /* * MUSH Share scheduling parameters */ struct sh_consts { short sc_fl; /* scheduling flags */ short sc_maxnice; /* maximum nice cut-off */ float sc_usagfactor; /* fudge factor */ float sc_ratefactor; /* fudge factor */ long sc_syscall; /* cost of system call */ long sc_bio; /* " " logical block i/o */ long sc_tio; /* " " terminal i/o */ long sc_tic; /* " " cpu tick */ long sc_click; /* " " memory */ long sc_pgin; /* " " hard page fault */ float sc_usage; /* current share per usage */ float sc_rate; /* current share per rate */ float sc_usagk; /* usage decay rate */ long sc_cost; /* total costs last period */ short sc_users; /* number of real users */ short sc_umin; /* minimum users for min share calc */ float sc_ksmin; /* constant for min share */ short sc_cpuwait; /* maximum period to wait for cpu */ }; #ifdef KERNEL int callshare; extern struct sh_consts shconsts; #endif #define shareflags shconsts.sc_fl #define Totusage shconsts.sc_usage #define Avrate shconsts.sc_rate #define maxnice shconsts.sc_maxnice #define USAGEFACTOR shconsts.sc_usagfactor #define RATEFACTOR shconsts.sc_ratefactor #define Usagek shconsts.sc_usagk #define Totusers shconsts.sc_users #define Totcost shconsts.sc_cost #define MINSHK shconsts.sc_ksmin #define MINUSERS shconsts.sc_umin #define CPUWAIT shconsts.sc_cpuwait #define NOSHARE 1 #define NONICE 2 #define MINNICE 0 #define BLOODYNICE 40 #define MINUSAGE (1.0e6) #define USAGEK 0.9999834 /* decay usage 40% per day */ #define CHARGE(cost) (u.u_quota->q_cost += shconsts.cost) b[.lit$ Qb by4/* socket.h 4.26 83/03/30 */ /* * Externally visible attributes of sockets. */ /* * Socket types. * * The kernel implement these abstract (session-layer) socket * services, with extra protocol on top of network services * if necessary. */ #define SOCK_STREAM 1 /* stream socket */ #define SOCK_DGRAM 2 /* datagram socket */ #define SOCK_RAW 3 /* raw-protocol interface */ #define SOCK_RDM 4 /* reliably-delivered message */ /* * Option flags per-socket. */ #define SO_DEBUG 0x01 /* turn on debugging info recording */ #define SO_ACCEPTCONN 0x02 /* willing to accept connections */ #define SO_REUSEADDR 0x04 /* allow local address reuse (gag) */ #define SO_KEEPALIVE 0x08 /* keep connections alive */ #define SO_DONTROUTE 0x10 /* just use interface addresses */ #define SO_NEWFDONCONN 0x20 /* give new fd on connection */ #define SO_USELOOPBACK 0x40 /* bypass hardware when possible */ #define SO_LINGER 0x80 /* linger on close if data present */ #define SO_DONTLINGER (~SO_LINGER) /* ~SO_LINGER */ /* * Generic socket protocol format. * * Each process is normally operating in a protocol family, * whose protocols are used unless the process specifies otherwise. * Most families supply protocols to the basic socket types. When * protocols are not present in the family, the higher level (roughly * ISO session layer) code in the system layers on the protocols * to support the socket types. */ struct sockproto { u_short sp_family; /* protocol family */ u_short sp_protocol; /* protocol within family */ }; #define PF_UNSPEC 0 /* unspecified */ #define PF_UNIX 1 /* UNIX internal protocol */ #define PF_INET 2 /* internetwork: UDP, TCP, etc. */ #define PF_IMPLINK 3 /* imp link protocols */ #define PF_PUP 4 /* pup protocols: e.g. BSP */ #define PF_CHAOS 5 /* mit CHAOS protocols */ #define PF_OISCP 6 /* ois communication protocols */ #define PF_NBS 7 /* nbs protocols */ #define PF_ECMA 8 /* european computer manufacturers */ #define PF_DATAKIT 9 /* datakit protocols */ #define PF_CCITT 10 /* CCITT protocols, X.25 etc */ /* * Generic socket address format. * * Each process is also operating in an address family, whose * addresses are assigned unless otherwise requested. The address * family used affects address properties: whether addresses are * externalized or internalized, location dependent or independent, etc. * The address can be defined directly if it fits in 14 bytes, or * a pointer and length can be given to variable length data. * We give these as two different structures to allow initialization. */ struct sockaddr { u_short sa_family; /* address family */ char sa_data[14]; /* up to 14 bytes of direct address */ }; /* * The first few address families correspond to protocol * families. Address families unrelated to protocol families * are also possible. */ #define AF_UNSPEC 0 /* unspecified */ #define AF_UNIX 1 /* local to host (pipes, portals) */ #define AF_INET 2 /* internetwork: UDP, TCP, etc. */ #define AF_IMPLINK 3 /* arpanet imp addresses */ #define AF_PUP 4 /* pup protocols: e.g. BSP */ #define AF_CHAOS 5 /* mit CHAOS protocols */ #define AF_OISCP 6 /* ois communication protocols */ #define AF_NBS 7 /* nbs protocols */ #define AF_ECMA 8 /* european computer manufacturers */ #define AF_DATAKIT 9 /* datakit protocols */ #define AF_CCITT 10 /* CCITT protocols, X.25 etc */ #define AF_MAX 11 #define SOL_SOCKET 0xffff /* options for socket level */ #define SOF_OOB 0x1 /* send/recv out-of-band data */ #define SOF_PREVIEW 0x2 /* look at data, but don't read */ #define SOF_DONTROUTE 0x4 /* send without routing data */ b[/li]?$ bb by8@/* socketvar.h 4.19 82/07/24 */ /* * Kernel structure per socket. * Contains send and receive buffer queues, * handle on protocol and pointer to protocol * private data and error information. */ struct socket { short so_type; /* generic type, see socket.h */ short so_options; /* from socket call, see socket.h */ short so_linger; /* time to linger while closing */ short so_state; /* internal state flags SS_*, below */ caddr_t so_pcb; /* protocol control block */ struct protosw *so_proto; /* protocol handle */ /* * Variables for connection queueing. * Socket where accepts occur is so_head in all subsidiary sockets. * If so_head is 0, socket is not related to an accept. * For head socket so_q0 queues partially completed connections, * while so_q is a queue of connections ready to be accepted. * If a connection is aborted and it has so_head set, then * it has to be pulled out of either so_q0 or so_q. * We allow connections to queue up based on current queue lengths * and limit on number of queued connections for this socket. */ struct socket *so_head; /* back pointer to accept socket */ struct socket *so_q0; /* queue of partial connections */ short so_q0len; /* partials on so_q0 */ struct socket *so_q; /* queue of incoming connections */ short so_qlen; /* number of connections on so_q */ short so_qlimit; /* max number queued connections */ /* * Variables for socket buffering. */ struct sockbuf { short sb_cc; /* actual chars in buffer */ short sb_hiwat; /* max actual char count */ short sb_mbcnt; /* chars of mbufs used */ short sb_mbmax; /* max chars of mbufs to use */ short sb_lowat; /* low water mark (not used yet) */ short sb_timeo; /* timeout (not used yet) */ struct mbuf *sb_mb; /* the mbuf chain */ struct proc *sb_sel; /* process selecting read/write */ short sb_flags; /* flags, see below */ } so_rcv, so_snd; #define SB_LOCK 0x01 /* lock on data queue (so_rcv only) */ #define SB_WANT 0x02 /* someone is waiting to lock */ #define SB_WAIT 0x04 /* someone is waiting for data/space */ #define SB_SEL 0x08 /* buffer is selected */ #define SB_COLL 0x10 /* collision selecting */ short so_timeo; /* connection timeout */ u_short so_error; /* error affecting connection */ short so_oobmark; /* chars to oob mark */ short so_pgrp; /* pgrp for signals */ }; /* * Socket state bits. */ #define SS_NOFDREF 0x001 /* no file table ref any more */ #define SS_ISCONNECTED 0x002 /* socket connected to a peer */ #define SS_ISCONNECTING 0x004 /* in process of connecting to peer */ #define SS_ISDISCONNECTING 0x008 /* in process of disconnecting */ #define SS_CANTSENDMORE 0x010 /* can't send more data to peer */ #define SS_CANTRCVMORE 0x020 /* can't receive more data from peer */ #define SS_RCVATMARK 0x040 /* at mark on input */ #define SS_PRIV 0x080 /* privileged for broadcast, raw... */ #define SS_NBIO 0x100 /* non-blocking ops */ #define SS_ASYNC 0x200 /* async i/o notify */ /* * Macros for sockets and socket buffering. */ /* how much space is there in a socket buffer (so->so_snd or so->so_rcv) */ #define sbspace(sb) \ (MIN((sb)->sb_hiwat-(sb)->sb_cc, ((sb)->sb_mbmax-(sb)->sb_mbcnt))) /* do we have to send all at once on a socket? */ #define sosendallatonce(so) \ (((so)->so_state & SS_NBIO) || ((so)->so_proto->pr_flags & PR_ATOMIC)) /* can we read something from so? */ #define soreadable(so) \ ((so)->so_rcv.sb_cc || ((so)->so_state & SS_CANTRCVMORE) || (so)->so_qlen) /* can we write something to so? */ #define sowriteable(so) \ (sbspace(&(so)->so_snd) > 0 && \ (((so)->so_state&SS_ISCONNECTED) || \ ((so)->so_proto->pr_flags&PR_CONNREQUIRED)==0) || \ ((so)->so_state & SS_CANTSENDMORE)) /* adjust counters in sb reflecting allocation of m */ #define sballoc(sb, m) { \ (sb)->sb_cc += (m)->m_len; \ (sb)->sb_mbcnt += MSIZE; \ if ((m)->m_off > MMAXOFF) \ (sb)->sb_mbcnt += CLBYTES; \ } /* adjust counters in sb reflecting freeing of m */ #define sbfree(sb, m) { \ (sb)->sb_cc -= (m)->m_len; \ (sb)->sb_mbcnt -= MSIZE; \ if ((m)->m_off > MMAXOFF) \ (sb)->sb_mbcnt -= CLBYTES; \ } /* set lock on sockbuf sb */ #define sblock(sb) { \ while ((sb)->sb_flags & SB_LOCK) { \ (sb)->sb_flags |= SB_WANT; \ sleep((caddr_t)&(sb)->sb_flags, PZERO+1); \ } \ (sb)->sb_flags |= SB_LOCK; \ } /* release lock on sockbuf sb */ #define sbunlock(sb) { \ (sb)->sb_flags &= ~SB_LOCK; \ if ((sb)->sb_flags & SB_WANT) { \ (sb)->sb_flags &= ~SB_WANT; \ wakeup((caddr_t)&(sb)->sb_flags); \ } \ } #define sorwakeup(so) sbwakeup(&(so)->so_rcv) #define sowwakeup(so) sbwakeup(&(so)->so_snd) #ifdef KERNEL struct socket *sonewconn(); #endif b[0li$ b byA/* stat.h 4.6 82/12/23 */ struct stat { dev_t st_dev; ino_t st_ino; unsigned short st_mode; short st_nlink; short st_uid; short st_gid; dev_t st_rdev; off_t st_size; time_t st_atime; int st_spare1; time_t st_mtime; int st_spare2; time_t st_ctime; int st_spare3; long st_blksize; long st_spare4[3]; }; #define S_IFMT 0170000 /* type of file */ #define S_IFDIR 0040000 /* directory */ #define S_IFCHR 0020000 /* character special */ #define S_IFBLK 0060000 /* block special */ #define S_IFREG 0100000 /* regular */ #define S_IFLNK 0120000 /* symbolic link */ #define S_IFSOCK 0140000/* socket */ #define S_ISUID 0004000 /* set user id on execution */ #define S_ISGID 0002000 /* set group id on execution */ #define S_ISVTX 0001000 /* save swapped text even after use */ #define S_IREAD 0000400 /* read permission, owner */ #define S_IWRITE 0000200 /* write permission, owner */ #define S_IEXEC 0000100 /* execute/search permission, owner */ b[1liz"$ b by</* systm.h 4.34 83/04/08 */ /* * Random set of variables * used by more than one * routine. */ int hand; /* current index into coremap used by daemon */ extern char version[]; /* system version */ /* * Nblkdev is the number of entries * (rows) in the block switch. It is * set in binit/bio.c by making * a pass over the switch. * Used in bounds checking on major * device numbers. */ int nblkdev; /* * Number of character switch entries. * Set by cinit/prim.c */ int nchrdev; int nswdev; /* number of swap devices */ int mpid; /* generic for unique process id's */ char runin; /* scheduling flag */ char runout; /* scheduling flag */ int runrun; /* scheduling flag */ char kmapwnt; /* kernel map want flag */ char curpri; /* more scheduling */ int maxmem; /* actual max memory per process */ int physmem; /* physical memory on this CPU */ int nswap; /* size of swap space */ int updlock; /* lock for sync */ daddr_t rablock; /* block to be read ahead */ int rasize; /* size of block in rablock */ extern int intstack[]; /* stack for interrupts */ dev_t rootdev; /* device of the root */ dev_t dumpdev; /* device to take dumps on */ long dumplo; /* offset into dumpdev */ dev_t swapdev; /* swapping device */ dev_t argdev; /* device for argument lists */ #ifdef vax extern int icode[]; /* user init code */ extern int szicode; /* its size */ #endif #ifdef MUSH extern int mcode[]; /* MUSH: startup code */ extern int szmcode; /* & its size */ #endif daddr_t bmap(); caddr_t calloc(); unsigned max(); unsigned min(); int memall(); int uchar(), schar(); int vmemall(); caddr_t wmemall(); swblk_t vtod(); /* * Structure of the system-entry table */ extern struct sysent { int sy_narg; /* total number of arguments */ int (*sy_call)(); /* handler */ } sysent[]; int noproc; /* no one is running just now */ char *panicstr; int wantin; int boothowto; /* reboot flags, from console subsystem */ int selwait; extern char vmmap[]; /* poor name! */ /* casts to keep lint happy */ #define insque(q,p) _insque((caddr_t)q,(caddr_t)p) #define remque(q) _remque((caddr_t)q) #define queue(q,p) _queue((caddr_t)q,(caddr_t)p) #define dequeue(q) _dequeue((caddr_t)q) b[2li~$ >b byB/* text.h 4.4 81/03/09 */ /* * Text structure. * One allocated per pure * procedure on swap device. * Manipulated by text.c */ #define NXDAD 12 /* param.h:MAXTSIZ / dmap.h:DMTEXT */ struct text { swblk_t x_daddr[NXDAD]; /* disk addresses of DMTEXT-page segments */ swblk_t x_ptdaddr; /* disk address of page table */ size_t x_size; /* size (clicks) */ struct proc *x_caddr; /* ptr to linked proc, if loaded */ struct inode *x_iptr; /* inode of prototype */ short x_rssize; short x_swrss; char x_count; /* reference count */ char x_ccount; /* number of loaded references */ char x_flag; /* traced, written flags */ char x_slptime; short x_poip; /* page out in progress count */ }; #ifdef KERNEL struct text *text, *textNTEXT; int ntext; #endif #define XTRC 01 /* Text may be written, exclusive use */ #define XWRIT 02 /* Text written into, must swap out */ #define XLOAD 04 /* Currently being read from file */ #define XLOCK 010 /* Being swapped in or out */ #define XWANT 020 /* Wanted for swapping */ #define XPAGI 040 /* Page in on demand from inode */ b[3li}$ b byD/* time.h 4.1 83/02/10 */ /* * Structure returned by gettimeofday(2) system call, * and used in other calls. */ struct timeval { long tv_sec; /* seconds */ long tv_usec; /* and microseconds */ }; struct timezone { int tz_minuteswest; /* minutes west of Greenwich */ int tz_dsttime; /* type of dst correction */ }; #define DST_NONE 0 /* not on dst */ #define DST_USA 1 /* usa style dst */ /* * Operations on timevals. */ #define timerisset(tvp) ((tvp)->tv_sec || (tvp)->tv_usec) #define timercmp(tvp, uvp, cmp) \ ((tvp)->tv_sec cmp (uvp)->tv_sec || \ (tvp)->tv_sec == (uvp)->tv_sec && (tvp)->tv_usec cmp (uvp)->tv_usec) #define timerclear(tvp) (tvp)->tv_sec = (tvp)->tv_usec = 0 /* * Names of the interval timers, and structure * defining a timer setting. */ #define ITIMER_REAL 0 #define ITIMER_VIRTUAL 1 #define ITIMER_PROF 2 struct itimerval { struct timeval it_interval; /* timer interval */ struct timeval it_value; /* current value */ }; /* * Structure returned by gmtime and localtime calls (see ctime(3)). */ struct tm { int tm_sec; int tm_min; int tm_hour; int tm_mday; int tm_mon; int tm_year; int tm_wday; int tm_yday; int tm_isdst; }; #ifndef KERNEL extern struct tm *gmtime(), *localtime(); extern char *asctime(), *ctime(); #endif b[4li$ b by?/* timeb.h 4.2 81/02/19 */ /* * Structure returned by ftime system call */ struct timeb { time_t time; unsigned short millitm; short timezone; short dstflag; }; b[5li$ b byF/* times.h 4.2 81/02/19 */ /* * Structure returned by times() */ struct tms { time_t tms_utime; /* user time */ time_t tms_stime; /* system time */ time_t tms_cutime; /* user time, children */ time_t tms_cstime; /* system time, children */ }; b[6liyf$ =b byH/* trace.h 4.9 82/05/31 */ /* * File system buffer tracing points; all trace */ #define TR_BREADHIT 0 /* buffer read found in cache */ #define TR_BREADMISS 1 /* buffer read not in cache */ #define TR_BWRITE 2 /* buffer written */ #define TR_BREADHITRA 3 /* buffer read-ahead found in cache */ #define TR_BREADMISSRA 4 /* buffer read-ahead not in cache */ #define TR_XFODMISS 5 /* exe fod read */ #define TR_XFODHIT 6 /* exe fod read */ #define TR_BRELSE 7 /* brelse */ /* * Memory allocator trace points; all trace the amount of memory involved */ #define TR_MALL 10 /* memory allocated */ /* * Paging trace points: all are */ #define TR_INTRANS 20 /* page intransit block */ #define TR_EINTRANS 21 /* page intransit wait done */ #define TR_FRECLAIM 22 /* reclaim from free list */ #define TR_RECLAIM 23 /* reclaim from loop */ #define TR_XSFREC 24 /* reclaim from free list instead of drum */ #define TR_XIFREC 25 /* reclaim from free list instead of fsys */ #define TR_WAITMEM 26 /* wait for memory in pagein */ #define TR_EWAITMEM 27 /* end memory wait in pagein */ #define TR_ZFOD 28 /* zfod page fault */ #define TR_EXFOD 29 /* exec fod page fault */ #define TR_VRFOD 30 /* vread fod page fault */ #define TR_CACHEFOD 31 /* fod in file system cache */ #define TR_SWAPIN 32 /* drum page fault */ #define TR_PGINDONE 33 /* page in done */ #define TR_SWAPIO 34 /* swap i/o request arrives */ /* * System call trace points. */ #define TR_VADVISE 40 /* vadvise occurred with */ /* * Miscellaneous */ #define TR_STAMP 50 /* user said vtrace(VTR_STAMP, value); */ /* * This defines the size of the trace flags array. */ #define TR_NFLAGS 100 /* generous */ #define TRCSIZ 4096 /* * Specifications of the vtrace() system call, which takes one argument. */ #define VTRACE 64+51 #define VTR_DISABLE 0 /* set a trace flag to 0 */ #define VTR_ENABLE 1 /* set a trace flag to 1 */ #define VTR_VALUE 2 /* return value of a trace flag */ #define VTR_UALARM 3 /* set alarm to go off (sig 16) */ /* in specified number of hz */ #define VTR_STAMP 4 /* user specified stamp */ #ifdef KERNEL #ifdef TRACE char traceflags[TR_NFLAGS]; struct proc *traceproc; int tracebuf[TRCSIZ]; unsigned tracex; int tracewhich; #define trace(a,b,c) if (traceflags[a]) trace1(a,b,c) #else #define trace(a,b,b) ; #endif #endif b[7li_$ Fb byLG/* tty.h 4.13 82/12/19 */ #ifdef KERNEL #include "../h/ttychars.h" #include "../h/ttydev.h" #else #include #include #endif /* * A clist structure is the head of a linked list queue * of characters. The characters are stored in blocks * containing a link and CBSIZE (param.h) characters. * The routines in tty_subr.c manipulate these structures. */ struct clist { int c_cc; /* character count */ char *c_cf; /* pointer to first char */ char *c_cl; /* pointer to last char */ }; /* * Per-tty structure. * * Should be split in two, into device and tty drivers. * Glue could be masks of what to echo and circular buffer * (low, high, timeout). */ struct tty { union { struct { struct clist T_rawq; struct clist T_canq; } t_t; #define t_rawq t_nu.t_t.T_rawq /* raw characters or partial line */ #define t_canq t_nu.t_t.T_canq /* raw characters or partial line */ struct { struct buf *T_bufp; char *T_cp; int T_inbuf; int T_rec; } t_n; #define t_bufp t_nu.t_n.T_bufp /* buffer allocated to protocol */ #define t_cp t_nu.t_n.T_cp /* pointer into the ripped off buffer */ #define t_inbuf t_nu.t_n.T_inbuf /* number chars in the buffer */ #define t_rec t_nu.t_n.T_rec /* have a complete record */ } t_nu; struct clist t_outq; /* device */ int (*t_oproc)(); /* device */ struct proc *t_rsel; /* tty */ struct proc *t_wsel; caddr_t T_LINEP; /* ### */ caddr_t t_addr; /* ??? */ dev_t t_dev; /* device */ int t_flags; /* some of both */ int t_state; /* some of both */ short t_pgrp; /* tty */ char t_delct; /* tty */ char t_line; /* glue */ char t_col; /* tty */ char t_ispeed, t_ospeed; /* device */ char t_rocount, t_rocol; /* tty */ struct ttychars t_chars; /* tty */ /* be careful of tchars & co. */ #define t_erase t_chars.tc_erase #define t_kill t_chars.tc_kill #define t_intrc t_chars.tc_intrc #define t_quitc t_chars.tc_quitc #define t_startc t_chars.tc_startc #define t_stopc t_chars.tc_stopc #define t_eofc t_chars.tc_eofc #define t_brkc t_chars.tc_brkc #define t_suspc t_chars.tc_suspc #define t_dsuspc t_chars.tc_dsuspc #define t_rprntc t_chars.tc_rprntc #define t_flushc t_chars.tc_flushc #define t_werasc t_chars.tc_werasc #define t_lnextc t_chars.tc_lnextc }; #define TTIPRI 28 #define TTOPRI 29 /* limits */ #define NSPEEDS 16 #define TTMASK 15 #define OBUFSIZ 100 #define TTYHOG 255 #ifdef KERNEL short tthiwat[NSPEEDS], ttlowat[NSPEEDS]; #define TTHIWAT(tp) tthiwat[(tp)->t_ospeed&TTMASK] #define TTLOWAT(tp) ttlowat[(tp)->t_ospeed&TTMASK] extern struct ttychars ttydefaults; #endif /* internal state bits */ #define TS_TIMEOUT 0x000001 /* delay timeout in progress */ #define TS_WOPEN 0x000002 /* waiting for open to complete */ #define TS_ISOPEN 0x000004 /* device is open */ #define TS_FLUSH 0x000008 /* outq has been flushed during DMA */ #define TS_CARR_ON 0x000010 /* software copy of carrier-present */ #define TS_BUSY 0x000020 /* output in progress */ #define TS_ASLEEP 0x000040 /* wakeup when output done */ #define TS_XCLUDE 0x000080 /* exclusive-use flag against open */ #define TS_TTSTOP 0x000100 /* output stopped by ctl-s */ #define TS_HUPCLS 0x000200 /* hang up upon last close */ #define TS_TBLOCK 0x000400 /* tandem queue blocked */ #define TS_RCOLL 0x000800 /* collision in read select */ #define TS_WCOLL 0x001000 /* collision in write select */ #define TS_NBIO 0x002000 /* tty in non-blocking mode */ #define TS_ASYNC 0x004000 /* tty in async i/o mode */ /* state for intra-line fancy editing work */ #define TS_BKSL 0x010000 /* state for lowercase \ work */ #define TS_QUOT 0x020000 /* last character input was \ */ #define TS_ERASE 0x040000 /* within a \.../ for PRTRUB */ #define TS_LNCH 0x080000 /* next character is literal */ #define TS_TYPEN 0x100000 /* retyping suspended input (PENDIN) */ #define TS_CNTTB 0x200000 /* counting tab width; leave FLUSHO alone */ #define TS_LOCAL (TS_BKSL|TS_QUOT|TS_ERASE|TS_LNCH|TS_TYPEN|TS_CNTTB) /* define partab character types */ #define ORDINARY 0 #define CONTROL 1 #define BACKSPACE 2 #define NEWLINE 3 #define TAB 4 #define VTAB 5 #define RETURN 6 b[8li~$ lb byP/* ttychars.h 4.3 83/04/03 */ /* * User visible structures and constants * related to terminal handling. */ #ifndef _TTYCHARS_ #define _TTYCHARS_ struct ttychars { char tc_erase; /* erase last character */ char tc_kill; /* erase entire line */ char tc_intrc; /* interrupt */ char tc_quitc; /* quit */ char tc_startc; /* start output */ char tc_stopc; /* stop output */ char tc_eofc; /* end-of-file */ char tc_brkc; /* input delimiter (like nl) */ char tc_suspc; /* stop process signal */ char tc_dsuspc; /* delayed stop process signal */ char tc_rprntc; /* reprint line */ char tc_flushc; /* flush output (toggles) */ char tc_werasc; /* word erase */ char tc_lnextc; /* literal next character */ }; #define CTRL(c) ('c'&037) /* default special characters */ #define CERASE 0177 /* DEL */ #define CKILL CTRL(u) #define CINTR CTRL(c) #define CQUIT 034 /* FS, ^\ */ #define CSTART CTRL(q) #define CSTOP CTRL(s) #define CEOF CTRL(d) #define CEOT CEOF #define CBRK 0377 #define CSUSP CTRL(z) #define CDSUSP CTRL(y) #define CRPRNT CTRL(r) #define CFLUSH CTRL(o) #define CWERASE CTRL(w) #define CLNEXT CTRL(v) #endif b[9li($ bb byK/* ttydev.h 4.3 83/02/16 */ /* * Terminal definitions related to underlying hardware. */ #ifndef _TTYDEV_ #define _TTYDEV_ /* * Speeds */ #define B0 0 #define B50 1 #define B75 2 #define B110 3 #define B134 4 #define B150 5 #define B200 6 #define B300 7 #define B600 8 #define B1200 9 #define B1800 10 #define B2400 11 #define B4800 12 #define B9600 13 #define EXTA 14 #define EXTB 15 #ifdef KERNEL /* * Hardware bits. * SHOULD NOT BE HERE. */ #define DONE 0200 #define IENABLE 0100 /* * Modem control commands. */ #define DMSET 0 #define DMBIS 1 #define DMBIC 2 #define DMGET 3 #endif #endif b[:l] b(I2byR/* types.h 4.10 83/05/14 */ /* * Basic system types and major/minor device constructing/busting macros. */ /* major part of a device */ #define major(x) ((int)(((unsigned)(x)>>8)&0377)) /* minor part of a device */ #define minor(x) ((int)((x)&0377)) /* make a device number */ #define makedev(x,y) ((dev_t)(((x)<<8) | (y))) typedef unsigned char u_char; typedef unsigned short u_short; typedef unsigned int u_int; typedef unsigned long u_long; typedef unsigned short ushort; /* sys III compat */ #ifdef vax typedef struct _physadr { int r[1]; } *physadr; typedef struct label_t { int val[14]; } label_t; #endif #ifdef sun typedef struct _physadr { short r[1]; } *physadr; typedef struct label_t { int val[13]; } label_t; #endif typedef struct _quad { long val[2]; } quad; typedef long daddr_t; typedef char * caddr_t; typedef u_long ino_t; typedef long swblk_t; typedef int size_t; typedef int time_t; typedef short dev_t; typedef int off_t; typedef struct fd_set { int fds_bits[1]; } fd_set; b[;li$ b byS/* uio.h 4.1 82/09/04 */ struct iovec { caddr_t iov_base; int iov_len; }; struct uio { struct iovec *uio_iov; int uio_iovcnt; int uio_offset; int uio_segflg; int uio_resid; }; enum uio_rw { UIO_READ, UIO_WRITE }; b[<lí$ b byT/* un.h 5.1 82/08/02 */ /* * Definitions for UNIX IPC domain. */ struct sockaddr_un { short sun_family; /* AF_UNIX */ char sun_path[14]; /* path name */ }; b[=li}$ Qb  byU/* unpcb.h 5.3 82/11/13 */ /* * Protocol control block for an active * instance of a UNIX internal protocol. * * A socket may be associated with an inode in the * file system. If so, the unp_inode pointer holds * a reference count to this inode, which should be irele'd * when the socket goes away. * * A socket may be connected to another socket, in which * case the control block of the socket to which it is connected * is given by unp_conn. * * A socket may be referenced by a number of sockets (e.g. several * sockets may be connected to a datagram socket.) These sockets * are in a linked list starting with unp_refs, linked through * unp_nextref and null-terminated. Note that a socket may be referenced * by a number of other sockets and may also reference a socket (not * necessarily one which is referencing it). This generates * the need for unp_refs and unp_nextref to be separate fields. */ struct unpcb { struct socket *unp_socket; /* pointer back to socket */ struct inode *unp_inode; /* if associated with file */ struct unpcb *unp_conn; /* control block of connected socket */ struct unpcb *unp_refs; /* referencing socket linked list */ struct unpcb *unp_nextref; /* link in unp_refs list */ struct mbuf *unp_remaddr; /* address of connected socket */ }; #define sotounpcb(so) ((struct unpcb *)((so)->so_pcb)) b[>lT$ Mb!!byXW/* user.h 4.25 83/05/01 */ #ifdef KERNEL #include "../machine/pcb.h" #include "../h/dmap.h" #else #include #include #endif #include #include /* * Per process structure containing data that * isn't needed in core when the process is swapped out. */ #define SHSIZE 32 struct user { struct pcb u_pcb; struct proc *u_procp; /* pointer to proc structure */ int *u_ar0; /* address of users saved R0 */ char u_comm[MAXNAMLEN + 1]; /* syscall parameters, results and catches */ int u_arg[8]; /* arguments to current system call */ int *u_ap; /* pointer to arglist */ label_t u_qsave; /* for non-local gotos on interrupts */ char u_error; /* return error code */ union { /* syscall return values */ struct { int R_val1; int R_val2; } u_rv; #define r_val1 u_rv.R_val1 #define r_val2 u_rv.R_val2 off_t r_off; time_t r_time; } u_r; char u_eosys; /* special action on end of syscall */ /* 1.1 - processes and protection */ short u_uid; /* effective user id */ short u_gid; /* effective group id */ int u_groups[NGROUPS]; /* groups, 0 terminated */ short u_ruid; /* real user id */ short u_rgid; /* real group id */ /* 1.2 - memory management */ size_t u_tsize; /* text size (clicks) */ size_t u_dsize; /* data size (clicks) */ size_t u_ssize; /* stack size (clicks) */ struct dmap u_dmap; /* disk map for data segment */ struct dmap u_smap; /* disk map for stack segment */ struct dmap u_cdmap, u_csmap; /* shadows of u_dmap, u_smap, for use of parent during fork */ label_t u_ssave; /* label variable for swapping */ size_t u_odsize, u_ossize; /* for (clumsy) expansion swaps */ time_t u_outime; /* user time at last sample */ /* 1.3 - signal management */ int (*u_signal[NSIG])(); /* disposition of signals */ long u_sigmask[NSIG]; /* signals to be blocked */ int u_code; /* ``code'' to trap */ caddr_t u_sigstack; /* 0 means no sigstack */ int u_onsigstack; /* 1.4 - descriptor management */ struct file *u_ofile[NOFILE]; /* file structures for open files */ char u_pofile[NOFILE]; /* per-process flags of open files */ #define UF_EXCLOSE 0x1 /* auto-close on exec */ #define UF_SHLOCK 0x2 /* shared lock present */ #define UF_EXLOCK 0x4 /* exclusive lock present */ #define UF_MAPPED 0x8 struct inode *u_cdir; /* current directory */ struct inode *u_rdir; /* root directory of current process */ struct tty *u_ttyp; /* controlling tty pointer */ dev_t u_ttyd; /* controlling tty dev */ short u_cmask; /* mask for file creation */ /* 1.5 - timing and statistics */ struct rusage u_ru; /* stats for this proc */ struct rusage u_cru; /* sum of stats for reaped children */ struct itimerval u_timer[3]; int u_XXX[3]; time_t u_start; short u_acflag; /* 1.6 - resource controls */ struct rlimit u_rlimit[RLIM_NLIMITS]; struct quota *u_quota; /* user's quota structure */ int u_qflags; /* per process quota flags */ /* BEGIN TRASH */ char u_segflg; /* 0:user D; 1:system; 2:user I */ caddr_t u_base; /* base address for IO */ unsigned int u_count; /* bytes remaining for IO */ off_t u_offset; /* offset in file for IO */ union { struct { /* header of executable file */ int Ux_mag; /* magic number */ unsigned Ux_tsize; /* text size */ unsigned Ux_dsize; /* data size */ unsigned Ux_bsize; /* bss size */ unsigned Ux_ssize; /* symbol table size */ unsigned Ux_entloc; /* entry location */ unsigned Ux_unused; unsigned Ux_relflg; } Ux_A; char ux_shell[SHSIZE]; /* #! and name of interpreter */ } u_exdata; #define ux_mag Ux_A.Ux_mag #define ux_tsize Ux_A.Ux_tsize #define ux_dsize Ux_A.Ux_dsize #define ux_bsize Ux_A.Ux_bsize #define ux_ssize Ux_A.Ux_ssize #define ux_entloc Ux_A.Ux_entloc #define ux_unused Ux_A.Ux_unused #define ux_relflg Ux_A.Ux_relflg caddr_t u_dirp; /* pathname pointer */ struct direct u_dent; /* current directory entry */ struct inode *u_pdir; /* inode of parent directory of dirp */ /* END TRASH */ struct uprof { /* profile arguments */ short *pr_base; /* buffer base */ unsigned pr_size; /* buffer size */ unsigned pr_off; /* pc offset */ unsigned pr_scale; /* pc scaling */ } u_prof; #ifdef sun int u_lofault; /* catch faults in locore.s */ #endif int u_stack[1]; }; /* u_eosys values */ #define JUSTRETURN 0 #define RESTARTSYS 1 #define SIMULATERTI 2 #define REALLYRETURN 3 /* u_error codes */ #include #ifdef KERNEL extern struct user u; extern struct user swaputl; extern struct user forkutl; extern struct user xswaputl; extern struct user xswap2utl; extern struct user pushutl; extern struct user vfutl; #endif b[?li$ b" by\/* vadvise.h 4.1 83/02/10 */ /* * Parameters to vadvise() to tell system of particular paging * behaviour: * VA_NORM Normal strategy * VA_ANOM Sampling page behaviour is not a win, don't bother * Suitable during GCs in LISP, or sequential or random * page referencing. * VA_SEQL Sequential behaviour expected. * VA_FLUSH Invalidate all page table entries. */ #define VA_NORM 0 #define VA_ANOM 1 #define VA_SEQL 2 #define VA_FLUSH 3 b[@li3$ b# by]/* vcmd.h 4.4 83/01/20 */ #define VPRINT 0100 #define VPLOT 0200 #define VPRINTPLOT 0400 #define VPC_TERMCOM 0040 #define VPC_FFCOM 0020 #define VPC_EOTCOM 0010 #define VPC_CLRCOM 0004 #define VPC_RESET 0002 #define VGETSTATE _IOR(v, 0, int) #define VSETSTATE _IOW(v, 1, int) b[AliU$ b$ by^/* vlimit.h 4.3 81/04/13 */ /* * Limits for u.u_limit[i], per process, inherited. */ #define LIM_NORAISE 0 /* if <> 0, can't raise limits */ #define LIM_CPU 1 /* max secs cpu time */ #define LIM_FSIZE 2 /* max size of file created */ #define LIM_DATA 3 /* max growth of data space */ #define LIM_STACK 4 /* max growth of stack */ #define LIM_CORE 5 /* max size of ``core'' file */ #define LIM_MAXRSS 6 /* max desired data+stack core usage */ #define NLIMITS 6 #define INFINITY 0x7fffffff b[BliÁ$ {b$ by_/* vm.h 4.3 81/04/23 */ /* * #include "../h/vm.h" * or #include in a user program * is a quick way to include all the vm header files. */ #ifdef KERNEL #include "../h/vmparam.h" #include "../h/vmmac.h" #include "../h/vmmeter.h" #include "../h/vmsystm.h" #else #include #include #include #include #endif b[Clirm$ b& byd/* vmmac.h 4.6 83/04/02 */ /* * Virtual memory related conversion macros */ /* Core clicks to number of pages of page tables needed to map that much */ #define ctopt(x) (((x)+NPTEPG-1)/NPTEPG) /* Virtual page numbers to text|data|stack segment page numbers and back */ #define vtotp(p, v) ((int)(v)-LOWPAGES) #define vtodp(p, v) ((int)((v) - stoc(ctos((p)->p_tsize)) - LOWPAGES)) #define vtosp(p, v) ((int)(btop(USRSTACK) - 1 - (v))) #define tptov(p, i) ((unsigned)(i) + LOWPAGES) #define dptov(p, i) ((unsigned)(stoc(ctos((p)->p_tsize)) + (i) + LOWPAGES)) #define sptov(p, i) ((unsigned)(btop(USRSTACK) - 1 - (i))) /* Tell whether virtual page numbers are in text|data|stack segment */ #define isassv(p, v) ((v) >= btop(USRSTACK) - (p)->p_ssize) #define isatsv(p, v) (((v) - LOWPAGES) < (p)->p_tsize) #define isadsv(p, v) (((v) - LOWPAGES) >= stoc(ctos((p)->p_tsize)) && \ !isassv(p, v)) /* Tell whether pte's are text|data|stack */ #define isaspte(p, pte) ((pte) > sptopte(p, (p)->p_ssize)) #define isatpte(p, pte) ((pte) < dptopte(p, 0)) #define isadpte(p, pte) (!isaspte(p, pte) && !isatpte(p, pte)) /* Text|data|stack pte's to segment page numbers and back */ #define ptetotp(p, pte) ((pte) - (p)->p_p0br) #define ptetodp(p, pte) ((pte) - ((p)->p_p0br + (p)->p_tsize)) #define ptetosp(p, pte) \ (((p)->p_p0br + (p)->p_szpt*NPTEPG - UPAGES - 1) - (pte)) #define tptopte(p, i) ((p)->p_p0br + (i)) #define dptopte(p, i) ((p)->p_p0br + (p)->p_tsize + (i)) #define sptopte(p, i) \ (((p)->p_p0br + (p)->p_szpt*NPTEPG - UPAGES - 1) - (i)) /* Bytes to pages without rounding, and back */ #define btop(x) (((unsigned)(x)) >> PGSHIFT) #define ptob(x) ((caddr_t)((x) << PGSHIFT)) /* Turn virtual addresses into kernel map indices */ #define kmxtob(a) (usrpt + (a) * NPTEPG) #define btokmx(b) (((b) - usrpt) / NPTEPG) /* User area address and pcb bases */ #define uaddr(p) (&((p)->p_p0br[(p)->p_szpt * NPTEPG - UPAGES])) #ifdef vax #define pcbb(p) ((p)->p_addr[0].pg_pfnum) #endif #ifdef sun #define pcbb(p) ((p)->p_addr) #endif /* Average new into old with aging factor time */ #define ave(smooth, cnt, time) \ smooth = ((time - 1) * (smooth) + (cnt)) / (time) /* Abstract machine dependent operations */ #ifdef vax #define setp0br(x) (u.u_pcb.pcb_p0br = (x), mtpr(P0BR, x)) #define setp0lr(x) (u.u_pcb.pcb_p0lr = \ (x) | (u.u_pcb.pcb_p0lr & AST_CLR), \ mtpr(P0LR, x)) #define setp1br(x) (u.u_pcb.pcb_p1br = (x), mtpr(P1BR, x)) #define setp1lr(x) (u.u_pcb.pcb_p1lr = (x), mtpr(P1LR, x)) #define initp1br(x) ((x) - P1PAGES) #endif #ifdef sun #define setp0br(x) u.u_pcb.pcb_p0br = (x) #define setp0lr(x) u.u_pcb.pcb_p0lr = (x) #define setp1br(x) u.u_pcb.pcb_p1br = (x) #define setp1lr(x) u.u_pcb.pcb_p1lr = (x) #define initp1br(x) ((x) - P1PAGES - UPAGES) #endif #define outofmem() wakeup((caddr_t)&proc[2]); /* * Page clustering macros. * * dirtycl(pte) is the page cluster dirty? * anycl(pte,fld) does any pte in the cluster has fld set? * zapcl(pte,fld) = val set all fields fld in the cluster to val * distcl(pte) distribute high bits to cluster; note that * distcl copies everything but pg_pfnum, * INCLUDING pg_m!!! * * In all cases, pte must be the low pte in the cluster, even if * the segment grows backwards (e.g. the stack). */ #define H(pte) ((struct hpte *)(pte)) #if CLSIZE==1 #define dirtycl(pte) dirty(pte) #define anycl(pte,fld) ((pte)->fld) #define zapcl(pte,fld) (pte)->fld #define distcl(pte) #endif #if CLSIZE==2 #define dirtycl(pte) (dirty(pte) || dirty((pte)+1)) #define anycl(pte,fld) ((pte)->fld || (((pte)+1)->fld)) #define zapcl(pte,fld) (pte)[1].fld = (pte)[0].fld #endif #if CLSIZE==4 #define dirtycl(pte) \ (dirty(pte) || dirty((pte)+1) || dirty((pte)+2) || dirty((pte)+3)) #define anycl(pte,fld) \ ((pte)->fld || (((pte)+1)->fld) || (((pte)+2)->fld) || (((pte)+3)->fld)) #define zapcl(pte,fld) \ (pte)[3].fld = (pte)[2].fld = (pte)[1].fld = (pte)[0].fld #endif #ifndef distcl #define distcl(pte) zapcl(H(pte),pg_high) #endif b[Dlivm$ b' byh /* vmmeter.h 4.6 4/24/81 */ /* * Virtual memory related instrumentation */ struct vmmeter { #define v_first v_swtch unsigned v_swtch; /* context switches */ unsigned v_trap; /* calls to trap */ unsigned v_syscall; /* calls to syscall() */ unsigned v_intr; /* device interrupts */ unsigned v_pdma; /* pseudo-dma interrupts */ unsigned v_pswpin; /* pages swapped in */ unsigned v_pswpout; /* pages swapped out */ unsigned v_pgin; /* pageins */ unsigned v_pgout; /* pageouts */ unsigned v_pgpgin; /* pages paged in */ unsigned v_pgpgout; /* pages paged out */ unsigned v_intrans; /* intransit blocking page faults */ unsigned v_pgrec; /* total page reclaims */ unsigned v_xsfrec; /* found in free list rather than on swapdev */ unsigned v_xifrec; /* found in free list rather than in filsys */ unsigned v_exfod; /* pages filled on demand from executables */ unsigned v_zfod; /* pages zero filled on demand */ unsigned v_vrfod; /* fills of pages mapped by vread() */ unsigned v_nexfod; /* number of exfod's created */ unsigned v_nzfod; /* number of zfod's created */ unsigned v_nvrfod; /* number of vrfod's created */ unsigned v_pgfrec; /* page reclaims from free list */ unsigned v_faults; /* total faults taken */ unsigned v_scan; /* scans in page out daemon */ unsigned v_rev; /* revolutions of the hand */ unsigned v_seqfree; /* pages taken from sequential programs */ unsigned v_dfree; /* pages freed by daemon */ #define v_last v_dfree unsigned v_swpin; /* swapins */ unsigned v_swpout; /* swapouts */ }; #ifdef KERNEL struct vmmeter cnt, rate, sum; #endif /* systemwide totals computed every five seconds */ struct vmtotal { short t_rq; /* length of the run queue */ short t_dw; /* jobs in ``disk wait'' (neg priority) */ short t_pw; /* jobs in page wait */ short t_sl; /* jobs sleeping in core */ short t_sw; /* swapped out runnable/short block jobs */ int t_vm; /* total virtual memory */ int t_avm; /* active virtual memory */ short t_rm; /* total real memory in use */ short t_arm; /* active real memory */ int t_vmtxt; /* virtual memory used by text */ int t_avmtxt; /* active virtual memory used by text */ short t_rmtxt; /* real memory used by text */ short t_armtxt; /* active real memory used by text */ short t_free; /* free memory pages */ }; #ifdef KERNEL struct vmtotal total; #endif /* * Optional instrumentation. */ #ifdef PGINPROF #define NDMON 128 #define NSMON 128 #define DRES 20 #define SRES 5 #define PMONMIN 20 #define PRES 50 #define NPMON 64 #define RMONMIN 130 #define RRES 5 #define NRMON 64 /* data and stack size distribution counters */ unsigned int dmon[NDMON+1]; unsigned int smon[NSMON+1]; /* page in time distribution counters */ unsigned int pmon[NPMON+2]; /* reclaim time distribution counters */ unsigned int rmon[NRMON+2]; int pmonmin; int pres; int rmonmin; int rres; unsigned rectime; /* accumulator for reclaim times */ unsigned pgintime; /* accumulator for page in times */ #endif b[Eliw$ b( by/* vmparam.h 4.13 82/12/17 */ /* * Machine dependent constants */ #ifdef KERNEL #include "../machine/vmparam.h" #else #include #endif #if defined(KERNEL) && !defined(LOCORE) int klseql; int klsdist; int klin; int kltxt; int klout; #endif b[Fli|$ <b( byb/* vmsystm.h 4.3 81/04/23 */ /* * Miscellaneous virtual memory subsystem variables and structures. */ #ifdef KERNEL int freemem; /* remaining blocks of free memory */ int avefree; /* moving average of remaining free blocks */ int avefree30; /* 30 sec (avefree is 5 sec) moving average */ int deficit; /* estimate of needs of new swapped in procs */ int nscan; /* number of scans in last second */ int multprog; /* current multiprogramming degree */ int desscan; /* desired pages scanned per second */ /* writable copies of tunables */ int maxpgio; /* max paging i/o per sec before start swaps */ int maxslp; /* max sleep time before very swappable */ int lotsfree; /* max free before clock freezes */ int minfree; /* minimum free pages before swapping begins */ int desfree; /* no of pages to try to keep free via daemon */ int saferss; /* no pages not to steal; decays with slptime */ #endif /* * Fork/vfork accounting. */ struct forkstat { int cntfork; int cntvfork; int sizfork; int sizvfork; }; #ifdef KERNEL struct forkstat forkstat; #endif /* * Swap kind accounting. */ struct swptstat { int pteasy; /* easy pt swaps */ int ptexpand; /* pt expansion swaps */ int ptshrink; /* pt shrinking swaps */ int ptpack; /* pt swaps involving spte copying */ }; #ifdef KERNEL struct swptstat swptstat; #endif b[Gli$ b) byk/* vtimes.h 4.4 82/10/21 */ /* * Structure returned by vtimes() and in vwait(). * In vtimes() two of these are returned, one for the process itself * and one for all its children. In vwait() these are combined * by adding componentwise (except for maxrss, which is max'ed). */ struct vtimes { int vm_utime; /* user time (60'ths) */ int vm_stime; /* system time (60'ths) */ /* divide next two by utime+stime to get averages */ unsigned vm_idsrss; /* integral of d+s rss */ unsigned vm_ixrss; /* integral of text rss */ int vm_maxrss; /* maximum rss */ int vm_majflt; /* major page faults */ int vm_minflt; /* minor page faults */ int vm_nswap; /* number of swaps */ int vm_inblk; /* block reads */ int vm_oublk; /* block writes */ }; #ifdef KERNEL #endif b[HliyQ$ b* byl/* wait.h 4.1 83/02/10 */ /* * This file holds definitions relevent to the wait system call. * Some of the options here are available only through the ``wait3'' * entry point; the old entry point with one argument has more fixed * semantics, never returning status of unstopped children, hanging until * a process terminates if any are outstanding, and never returns * detailed information about process resource utilization (). */ /* * Structure of the information in the first word returned by both * wait and wait3. If w_stopval==WSTOPPED, then the second structure * describes the information returned, else the first. See WUNTRACED below. */ union wait { int w_status; /* used in syscall */ /* * Terminated process status. */ struct { unsigned short w_Termsig:7; /* termination signal */ unsigned short w_Coredump:1; /* core dump indicator */ unsigned short w_Retcode:8; /* exit code if w_termsig==0 */ } w_T; /* * Stopped process status. Returned * only for traced children unless requested * with the WUNTRACED option bit. */ struct { unsigned short w_Stopval:8; /* == W_STOPPED if stopped */ unsigned short w_Stopsig:8; /* signal that stopped us */ } w_S; }; #define w_termsig w_T.w_Termsig #define w_coredump w_T.w_Coredump #define w_retcode w_T.w_Retcode #define w_stopval w_S.w_Stopval #define w_stopsig w_S.w_Stopsig #define WSTOPPED 0177 /* value of s.stopval if process is stopped */ /* * Option bits for the second argument of wait3. WNOHANG causes the * wait to not hang if there are no stopped or terminated processes, rather * returning an error indication in this case (pid==0). WUNTRACED * indicates that the caller should receive status about untraced children * which stop due to signals. If children are stopped and a wait without * this option is done, it is as though they were still running... nothing * about them is returned. */ #define WNOHANG 1 /* dont hang in wait */ #define WUNTRACED 2 /* tell about stopped, untraced children */ #define WIFSTOPPED(x) ((x).w_stopval == WSTOPPED) #define WIFSIGNALED(x) ((x).w_stopval != WSTOPPED && (x).w_termsig != 0) #define WIFEXITED(x) ((x).w_stopval != WSTOPPED && (x).w_termsig == 0) b[Ili|$ bI <by/* clock.h 4.2 83/03/26 */ #ifdef SUN1 /* * SUN-1 clock registers */ #ifdef LOCORE #define CLKADDR 0x800000 #else struct clk { short clk_data; /* data register */ short clk_cmd; /* command register */ }; #define CLKADDR ((struct clk *)(0x800000)) #endif #define SECDAY ((unsigned)(24*60*60)) /* seconds per day */ /* * Carefully define the basic CPU clock rate so * that time-of-day calculations don't float */ #define CLK_BASIC 19660800 #define CLK_RATE 1000 /* rate we use, 1 ms., for mouse */ #define CLK_F1 0xB00 /* F1 = pulse/1 */ #define CLK_F2 0xC00 /* F2 = pulse/16 */ #define CLK_F3 0xD00 /* F3 = pulse/256 */ #define CLK_F4 0xE00 /* F4 = pulse/4096 */ #define CLK_F5 0xF00 /* F5 = pulse/65536 */ #define CLK_F1DIV 1 #define CLK_F2DIV 16 #define CLK_F3DIV 256 #define CLK_F4DIV 4096 #define CLK_F5DIV 65536 #define CLK_LMODE 0xFF00 /* Command to load the mode register */ #define CLK_LLOAD 0xFF08 /* Command to load the load register */ #define CLK_LHOLD 0xFF10 /* Command to load the hold register */ #define CLK_TICK_MODE (CLK_F2+0x22) /* F2 + Operating mode D */ #define CLK_UART_MODE (CLK_F1+0x22) /* F1 + Operating mode D */ #define CLK_HZ(hz) ((CLK_BASIC/(4*CLK_F2DIV))/hz) /* hz to clk conv */ #define CLK_GO 0xFF20 /* Command to arm counter 2 */ #define CLK_REFR 0xFFE2 /* Command to re-enable clock */ #define CLKTIMER 2 /* Timer 2 */ #define UARTTIMER 4 /* first timer for UARTS */ #endif b[Jli{ف$ bJ >by/* cpu.h 4.11 83/03/26 */ #ifndef LOCORE #include #endif #define SUN_1 1 #define SUN_2 2 #define SUN_MAX 2 #ifndef LOCORE #ifdef KERNEL int cpu; #endif #endif #ifndef LOCORE /* * The context structure is used to allocate * contexts and maintains the lru linked list * of processes using contexts. */ struct context { struct context *ctx_forw; /* linked list of free or use */ struct context *ctx_back; /* linked list of free or use */ struct proc *ctx_procp; /* back pointer to proc structure */ struct pmeg *ctx_pmeg[NSEGMAP];/* pmeg allocation for this context */ u_short ctx_context; /* bits to load into context register */ }; #ifdef KERNEL extern struct context context[]; extern struct context ctxfreelist, ctxhead; extern struct pte Ctxmap[]; extern struct user ctxutl; #endif #define CSEG 60 /* segment for manipulation of contexts */ #define setseg (*RomVecPtr->v_SetSeg) /* * The pmeg structure allocates the hardware page map * entry groups and other stuff. */ struct pmeg { struct pmeg *pm_forw; /* forward link */ struct pmeg *pm_back; /* backward link */ struct proc *pm_procp; /* back pointer to proc using */ struct pte *pm_pte; /* pointer to pte's mapping */ short pm_seg; /* segment with process address space */ short pm_count; /* number of valid pte's in group */ }; #ifdef KERNEL extern struct pmeg pmeg[]; extern struct pmeg pmeghead; extern int kernpmeg; #endif #endif !LOCORE b[KlDM$ dbKbby/* dkio.h 4.8 83/06/02 */ /* * Structures and definitions for disk io control commands */ /* Disk identification */ struct dk_info { int dki_ctlr; /* controller address */ short dki_unit; /* unit (slave) address */ short dki_ctype; /* controller type */ short dki_flags; /* flags */ }; /* controller types */ #define DKC_UNKNOWN 0 #define DKC_SMD2180 1 #define DKC_WDC2880 2 #define DKC_SMD2181 3 #define DKC_XY440 4 #define DKC_DSD5215 5 #define DKC_XY450 6 /* flags */ #define DKI_BAD144 01 /* use DEC std 144 bad sector fwding */ #define DKI_MAPTRK 02 /* controller does track mapping */ #define DKI_FMTTRK 04 /* formats only full track at a time */ /* Definition of a disk's geometry */ struct dk_geom { unsigned short dkg_ncyl; /* # of data cylinders */ unsigned short dkg_acyl; /* # of alternate cylinders */ unsigned short dkg_bcyl; /* cyl offset (for fixed head area) */ unsigned short dkg_nhead; /* # of heads */ unsigned short dkg_bhead; /* head offset (for Larks, etc.) */ unsigned short dkg_nsect; /* # of sectors per track */ unsigned short dkg_intrlv; /* interleave factor */ unsigned short dkg_gap1; /* gap 1 size */ unsigned short dkg_gap2; /* gap 2 size */ unsigned short dkg_extra[10]; /* for compatible expansion */ }; /* Disk format request */ struct dk_fmt { daddr_t dkf_blkno; /* starting block */ daddr_t dkf_nblk; /* # of blocks */ u_char dkf_fill; /* fill data */ }; /* Disk re-map request */ struct dk_mapr { daddr_t dkm_fblk; /* from block */ daddr_t dkm_tblk; /* to block */ daddr_t dkm_nblk; /* # blocks */ u_char dkm_fill; /* fill data */ }; /* disk io control commands */ #define DKIOCHDR _IO(d, 1) /* next I/O will read/write header */ #define DKIOCGGEOM _IOR(d, 2, struct dk_geom) /* Get geometry */ #define DKIOCSGEOM _IOW(d, 3, struct dk_geom) /* Set geometry */ #define DKIOCGPART _IOR(d, 4, struct dk_map) /* Get partition info */ #define DKIOCSPART _IOW(d, 5, struct dk_map) /* Set partition info */ #define DKIOCFMT _IOW(d, 6, struct dk_fmt) /* Format */ #define DKIOCMAP _IOW(d, 7, struct dk_mapr) /* Map */ #define DKIOCINFO _IOR(d, 8, struct dk_info) /* Get info */ b[Lli{$ bL Aby/* dklabel.h 4.3 83/01/15 */ /* * Format of a SUN SMD disk label * Resides in cylinder 0, sector 0 on each head which is the first * head of a physical partition (e.g., heads 0 and 2 for a CDC Lark). * dkl_ppart gives the physical partition number (currently only 0 or 1). * dkl_bhead must match the head on which the label is found; * otherwise the label was probably overwritten by another. * * sizeof(struct dk_label) should be 512 (sector size) */ #define NDKMAP 8 /* # of logical partitions */ struct dk_label { char dkl_asciilabel[128]; /* for compatibility */ char dkl_pad[512-(128+8*8+11*2)]; unsigned short dkl_gap1; /* size of gap 1 */ unsigned short dkl_gap2; /* size of gap 2 */ unsigned short dkl_intrlv; /* interleave factor */ unsigned short dkl_ncyl; /* # of data cylinders */ unsigned short dkl_acyl; /* # of alternate cylinders */ unsigned short dkl_nhead; /* # of heads in this partition */ unsigned short dkl_nsect; /* # of 512 byte sectors per track */ unsigned short dkl_bhead; /* identifies proper label location */ unsigned short dkl_ppart; /* physical partition # */ /* */ struct dk_map { /* logical partitions */ daddr_t dkl_cylno; /* starting cylinder */ daddr_t dkl_nblk; /* number of blocks */ } dkl_map[NDKMAP]; unsigned short dkl_magic; /* identifies this label format */ unsigned short dkl_cksum; /* xor checksum of sector */ }; #define DKL_MAGIC 0xDABE b[MlTB$ bM!by/* fault.h 4.3 83/05/01 */ /* * Where to go on fault in kernel mode * Zero means fault was unexpected */ label_t *nofault; /* longjmp vector */ b[Nliǁ$ bN Dby/* kbio.h 4.3 83/01/15 */ /* * Keyboard related ioctls */ #define KIOCTRANS _IOW(k,0, int) /* set keyboard translation */ #define KIOCSKEYB _IO(k,1) /* set struct keyboard */ b[Olixo$ bO Eby/* mmu.h 4.1 83/01/15 */ /* * Sun-1 Context register access. * Context number is in the high nibble * of shorts read and written to RCONTEXT * and WCONTEXT, respectively. */ #define RCONTEXT 0xC00000 #define WCONTEXT 0xE00000 #define KCONTEXT 0 /* Kernel's context */ #define NCONTEXT 16 /* Number of contexts */ #define MAXOBMEM 0x200000 /* Maximum on-board memory address */ #define MAXMBMEM 0x100000 /* Maximum Multibus memory address */ /* * Hardware segment and page registers and constants. */ #define SEGBASE 0xC00000 #define SEGSIZE 0x8000 /* 32K */ #define NSEGMAP 64 /* # of segments per context */ #define MAXKSEG 56 /* # of segments that we remap(up to 1c0000) */ #define vtoseg(v) (union hseg *)(((int)(v)&0x1FFFF0)+SEGBASE) #define SEGZERO 0x0500 /* segment zero - all kernel access */ #define SEGINV 0x0000 /* invalid segment - no access */ #define SEG_KW 5 /* kernel RW protection */ #define SEG_KR 3 /* kernel RO protection */ #define PAGBASE 0xA00000 #define PAGSIZE 0x800 /* 2K */ #define NPAGSEG 16 /* # of pages per segment */ #define NPAGMAP 1024 /* # of pages total */ #define vtopag(v) ((union hpag *)(((int)(v)&0x1FFFF0)+PAGBASE)) #define vtop(v) ((vtopag(v)->hpag_ent.hpag_ppag<hpag_ent.hpag_type == 2) #define ismbio(v) (vtopag(v)->hpag_ent.hpag_type == 3) #define NPME 1024 /* number of hardware page map entries */ #define NPMEG (NPME/NPAGSEG) /* # of pme groups (segment allocation) */ #define PAGINV 0x1FFF /* invalid page */ #define vsegtopag(v) ((v)<<4) /* virtual segment to virtual page */ #ifndef LOCORE union hseg { struct hsegent { unsigned hseg_ctxt : 4; /* context on read */ unsigned hseg_prot : 4; /* protection bits */ unsigned : 2; /* unused */ unsigned hseg_pmap : 6; /* page map index */ } hseg_ent; unsigned short hseg_all; char hseg_size[SEGSIZE]; }; union hpag { struct hpagent { unsigned hpag_acc : 1; /* accessed */ unsigned hpag_mod : 1; /* modified */ unsigned hpag_type : 2; /* memory type */ unsigned hpag_ppag : 12; /* physical page # */ } hpag_ent; unsigned short hpag_all; char hpag_size[PAGSIZE]; }; #ifdef KERNEL extern union hseg hsegmap[]; extern union hpag hpagmap[]; #endif #endif !LOCORE b[PlNf$ bP(Ipby/* ndio.h 1.5 83/05/13 */ /* * External definitions for network disk driver. */ /* * ioctl's */ #define NDIOCSON _IO(n, 0) /* server on */ #define NDIOCSOFF _IO(n, 1) /* server off */ #define NDIOCUSER _IOW(n, 3, struct ndiocuser) /* set user parameters */ #define NDIOCSAT _IOW(n, 4, int) /* server at ipaddress */ #define NDIOCCLEAR _IO(n, 5) /* clear table of reg. users */ #define NDIOCFLUSH _IO(n, 6) /* flush local RO public blocks */ #define NDIOCVER _IOW(n, 7, int) /* version number */ #define NDIOCETHER _IOW(n, 8, struct ndiocether) /* set ether address */ /* * NDIOCUSER request structure */ struct ndiocuser { struct in_addr nu_addr; /* net address of client */ int nu_hisunit; /* his minor device unit number */ int nu_mydev; /* fd of my serving device (block device) */ int nu_myoff; /* offset of subpartition */ int nu_mysize; /* size of subpartition */ int nu_mylunit; /* my local unit number */ }; /* * NDIOCETHER request structure */ struct ndiocether { struct in_addr ne_addr; /* net address of client */ int ne_ehi; /* hi 3 bytes of ether address */ int ne_elo; /* lo 3 bytes of ether address */ }; /* * kernel driver statistics area */ struct ndstat { int ns_rpacks; /* total received packets */ int ns_xpacks; /* total transmitted packets */ int ns_notuser; /* request received from an invalid user */ int ns_noumatch; /* DONE or ERROR doesnt match any request */ int ns_rexmits; /* retransmits */ int ns_nobufs; /* no buffer available */ int ns_lbusy; /* "local" buffer busy */ int ns_operrors; /* NDOPERRORs */ int ns_rseq; /* bad read or write sequencing */ int ns_wseq; int ns_badreq; /* bad request */ int ns_stimo; /* server timeouts */ int ns_utimo; /* user timeouts */ int ns_mbmem; /* mb memory in use */ int ns_iseq; /* bad initial sequence number */ int ns_nombmem; /* hit mb mem limit */ }; /* * Minor device bit decoding. * the 8 bit minor device number for /dev/nd* is decoded: * L P UUUUUU where: * L = local, P = read only public, U = user relative unit number. * e.g. /dev/nd0 = 0, /dev/ndp0 = 0100, /dev/ndl0 = 0200. * */ #define NDMINLOCAL 0200 /* local device */ #define NDMINPUBLIC 0100 /* public device */ #define NDMINUNIT 077 /* unit number */ #if NND > 0 /* * "nd" protocol packet format. */ struct ndpack { struct ip np_ip; /* ip header, proto IPPROTO_ND */ u_char np_op; /* operation code, see below */ u_char np_min; /* minor device */ char np_error; /* b_error */ char np_ver; /* version number */ long np_seq; /* sequence number */ long np_blkno; /* b_blkno, disk block number */ long np_bcount; /* b_bcount, byte count */ long np_resid; /* b_resid, residual byte count */ long np_caddr; /* current byte offset of this packet */ long np_ccount; /* current byte count of this packet */ }; /* data follows */ #endif NND /* np_op operation codes. */ #define NDOPREAD 1 /* read */ #define NDOPWRITE 2 /* write */ #define NDOPERROR 3 /* error */ #define NDOPCODE 7 /* op code mask */ #define NDOPWAIT 010 /* waiting for DONE or next request */ #define NDOPDONE 020 /* operation done */ /* misc protocol defines. */ #define NDMAXDATA 1024 /* max data per packet (if 1370, would allow 4K disk block to fit in 3 ether packets; but would mess up clusters) */ #define NDMAXPACKS 6 /* max packets before acknowledgement */ #define NDMAXIO 32*1024 /* max np_bcount */ #define NDXTIMER (2*2) /* rexmit interval (secs*2 for slowtimo) */ #define NDFTIMER (60*60*2) /* flush public fs interval */ b[ Qli}i$ bQ Hby/* param.h 4.1 82/12/01 */ /* * Machine dependent constants for sun. */ #define NBPG 2048 /* bytes/page */ #define PGOFSET (NBPG-1) /* byte offset into page */ #define PGSHIFT 11 /* LOG2(NBPG) */ #define CLSIZE 1 #define CLSIZELOG2 0 #define SSIZE 1 /* initial stack size/NBPG */ #define SINCR 1 /* increment of stack/NBPG */ #define UPAGES 3 /* pages of u-area */ /* * Some macros for units conversion */ /* Core clicks (2048 bytes) to segments and vice versa */ #define ctos(x) (((x)+15)>>4) #define stoc(x) ((x)<<4) /* Core clicks (2048 bytes) to disk blocks and vice versa */ #define ctod(x) ((x)<<2) #define dtoc(x) (((x)+3)>>2) #define dtob(x) ((x)<<9) /* clicks to bytes */ #define ctob(x) ((x)<<11) /* bytes to clicks */ #define btoc(x) ((((unsigned)(x)+2047)>>11)) /* * Macros to decode processor status word. */ #define USERMODE(ps) (((ps) & SR_SMODE) == 0) #define BASEPRI(ps) (((ps) & SR_INTPRI) == 0) #define DELAY(n) { register int N = (n)>>1; while (--N > 0); } b[Rli~$ bR Iby/* pcb.h 4.8 83/03/26 */ /* * SUN software process control block */ struct pcb { label_t pcb_regs; /* saved registers (MUST BE FIRST) */ int pcb_sr; /* program status word */ struct pte *pcb_p0br; /* pseudo-P0BR for sun */ int pcb_p0lr; /* pseudo-P0LR for sun */ struct pte *pcb_p1br; /* pseudo-P1BR for sun */ int pcb_p1lr; /* pseudo-P1LR for sun */ int pcb_szpt; /* number of pages of user page table */ int *pcb_sswap; }; #define AST_USER 0x40000000 #define TRACE_USER 0x20000000 #define AST_CLR 0x60000000 #define PME_CLR 0 #define AST_NONE 0 #define isaston() ((u.u_pcb.pcb_p0lr & AST_USER) ? 1 : 0) #define istraceon() ((u.u_pcb.pcb_p0lr & TRACE_USER) ? 1 : 0) b[Sli~$ bS Jby/* psl.h 4.2 83/01/15 */ /* * Definition of bits in the 68000 status register (SR) */ #define SR_TRACE 0x8000 /* trace mode */ #define SR_SMODE 0x2000 /* system mode */ #define SR_INTPRI 0x0700 /* interrupt priority bits */ #define SR_CC 0x001F /* all condition code bits */ /* Handy values for SR */ #define SR_HIGH 0x2700 /* supervisor, high prio */ #define SR_LOW 0x2000 /* supervisor, low prio */ #define SR_USER 0x0000 /* User, low prio */ #define PSL_USERSET SR_USER /* must set for user */ #define PSL_USERCLR (SR_SMODE|SR_INTPRI) /* must clear for user */ #define PSL_ALLCC SR_CC /* condition code bits */ #define PSL_T SR_TRACE /* trace bit */ b[Tlix $ -bT Lby/* pte.h 4.12 83/03/26 */ /* * Sun software page table entry * * There are two major kinds of pte's: those which have ever existed (and are * thus either now in core or on the swap device), and those which have * never existed, but which will be filled on demand at first reference. * There is a structure describing each. There is also an ancillary * structure used in page clustering (never used on the Sun). */ #ifdef KERNEL #include "../sun/mmu.h" #else #include #endif #ifndef LOCORE struct pte { unsigned int pg_v:1, /* valid bit */ pg_prot:4, /* access control */ pg_fod:1, /* is fill on demand (=0) */ :10; struct hpagent pg_hpagent; /* hardware page table entry */ }; struct hpte { unsigned int pg_high:9, /* special for clustering */ :7; struct hpagent pg_hpagent; /* hardware page table entry */ }; struct fpte { unsigned int pg_v:1, pg_prot:4, pg_fod:1, /* is fill on demand (=1) */ :1, pg_fileno:5, /* file mapped from or TEXT or ZERO */ pg_blkno:20; /* file system block number */ }; #define pg_m pg_hpagent.hpag_mod #define pg_r pg_hpagent.hpag_acc #define pg_space pg_hpagent.hpag_type #define pg_pfnum pg_hpagent.hpag_ppag #endif #define PG_V 0x80000000 #define PG_PROT 0x78000000 #define PG_FOD 0x02000000 #define PG_R 0x00008000 #define PG_M 0x00004000 #define PG_PFNUM 0x00003fff /* XXX - includes type field */ #define PG_PROTSHFT 27 /* bit position where prot starts */ #define PG_FZERO (NOFILE) #define PG_FTEXT (NOFILE+1) #define PG_FMAX (PG_FTEXT) #define PG_NOACC 0 #define PG_KW 0x28000000 #define PG_KR 0x18000000 #define PG_UW 0x78000000 #define PG_URKW 0x68000000 #define PG_URKR 0x60000000 #define PGSP_OBMEM 0x0000 #define PGSP_INVAL 0x1000 #define PGSP_MBMEM 0x2000 #define PGSP_MBIO 0x3000 /* * Pte related macros */ #define dirty(pte) ((pte)->pg_fod == 0 && (pte)->pg_pfnum && (pte)->pg_m) #ifndef LOCORE #ifdef KERNEL struct pte *vtopte(); /* utilities defined in locore.s */ extern struct pte Sysmap[]; extern struct pte Usrptmap[]; extern struct pte usrpt[]; extern struct pte Swapmap[]; extern struct pte Forkmap[]; extern struct pte Xswapmap[]; extern struct pte Xswap2map[]; extern struct pte Pushmap[]; extern struct pte Vfmap[]; extern struct pte mmap[]; extern struct pte msgbufmap[]; extern struct pte camap[]; #endif #endif b[Uliz$ bU Mby/* reg.h 4.7 83/04/02 */ /* * Location of the users' stored * registers relative to R0. * Usage is u.u_ar0[XX]. */ #define R0 (0) #define R1 (1) #define R2 (2) #define R3 (3) #define R4 (4) #define R5 (5) #define R6 (6) #define R7 (7) #define AR0 (8) #define AR1 (9) #define AR2 (10) #define AR3 (11) #define AR4 (12) #define AR5 (13) #define AR6 (14) #define AR7 (15) #define SP (15) #define PS (16) #define PC (17) /* * And now for something completely the same... * * NOTE: function code, access address, and instruction register * are valid only for bus and address error traps. */ #ifndef LOCORE #define u_short unsigned short /* XXX */ #define u_int unsigned int /* XXX */ struct regs { int r_dreg[8]; /* data registers */ #define r_r0 r_dreg[0] /* r0 for portability */ int r_areg[8]; /* address registers */ #define r_sp r_areg[7] /* user stack pointer */ u_short r_context; /* context */ u_short r_sr; /* status register */ int r_pc; /* program counter */ u_int r_stkfmt : 4; /* stack format */ u_int : 2; u_int r_vector : 10; /* vector offset */ u_int r_rerun : 1; /* rerun bus cycle */ u_int : 1; u_int r_ifetch : 1; /* inst fetch (1=true) */ u_int r_dfetch : 1; /* data fetch */ u_int r_rmw : 1; /* read/modify/write */ u_int r_hibyte : 1; /* high byte transfer */ u_int r_bytex : 1; /* byte transfer */ u_int r_rw : 1; /* read=1,write=0 */ u_int : 4; u_int r_fcode : 4; /* function code */ int r_accaddr; /* access address */ u_int : 16; /* undefined */ short r_dob; /* data output buffer */ u_int : 16; /* undefined */ short r_dib; /* data input buffer */ u_int : 16; /* undefined */ short r_irc; /* inst buffer */ short r_maskpc; /* chip mask # & micropc */ short r_undef[15]; /* undefined */ }; #undef u_short #undef u_int #endif b[Vli|$ bV Oby/* scb.h 4.5 82/12/17 */ /* * SUN System control block layout */ struct scb { int scb_issp; /* 00 - initial SSP */ int (*scb_ipc)(); /* 04 - initial PC */ int (*scb_buserr)(); /* 08 - bus error */ int (*scb_addrerr)(); /* 0c - address error */ int (*scb_illinst)(); /* 10 - illegal instruction */ int (*scb_zerodiv)(); /* 14 - zero divide */ int (*scb_chk)(); /* 18 - CHK instruction */ int (*scb_trapv)(); /* 1c - TRAPV instruction */ int (*scb_priv)(); /* 20 - privilege violation */ int (*scb_trace)(); /* 24 - trace trap */ int (*scb_e1010)(); /* 28 - line 1010 emulator */ int (*scb_e1111)(); /* 2c - line 1111 emulator */ int (*scb_res30)(); /* 30 - reserved */ int (*scb_res34)(); /* 34 - reserved */ int (*scb_fmterr)(); /* 38 - RTE format error */ int (*scb_uninit)(); /* 3c - unitialized intr */ int (*scb_res1[8])(); /* 40-5c - reserved */ int (*scb_stray)(); /* 60 - spurious interrupt */ int (*scb_autovec[7])(); /* 64-7c - level 1-7 autovectors */ int (*scb_trap[16])(); /* 80-bc - trap instruction vectors */ int (*scb_res2[16])(); /* c0-fc - reserved */ }; #ifdef KERNEL extern struct scb scb, protoscb; #endif b[Wli~$ #bW Pby/* sir.h 4.3 83/01/15 */ /* * Software controlled (and implemented) interrupts * Vector table for software interrupts is sirtab in locore.s */ #define SIR_MAX 16 /* # of soft intr levels (must fit in mask) */ #define SIR_CONSOUT 1 /* level for console output */ #define SIR_NET 2 /* level for network code */ #define SIR_MBCOPY 3 /* level to copy data to/from Multibus */ #define SIR_SOFTCLOCK 4 /* level for softclock interrupts */ #define siron(sirn) (sirmask |= (1<<(sirn))) #if defined(KERNEL) && !defined(LOCORE) int sirmask; #endif b[Xli}M$ bX Rby/* trap.h 4.9 83/01/15 */ /* * Trap type values */ #define T_BUSERR 0x08 #define T_ADDRERR 0x0c #define T_ILLINST 0x10 #define T_ZERODIV 0x14 #define T_CHKINST 0x18 #define T_TRAPV 0x1c #define T_PRIVVIO 0x20 #define T_TRACE 0x24 #define T_EMU1010 0x28 #define T_EMU1111 0x2c #define T_FMTERR 0x38 #define T_SPURIOUS 0x60 #define T_LEVEL1 0x64 #define T_LEVEL2 0x68 #define T_LEVEL3 0x6c #define T_LEVEL4 0x70 #define T_LEVEL5 0x74 #define T_LEVEL6 0x78 #define T_LEVEL7 0x7c #define T_SYSCALL 0x80 #define T_TRAP1 0x84 #define T_TRAP2 0x88 #define T_TRAP3 0x8c #define T_TRAP4 0x90 #define T_TRAP5 0x94 #define T_TRAP6 0x98 #define T_TRAP7 0x9c #define T_TRAP8 0xa0 #define T_TRAP9 0xa4 #define T_TRAP10 0xa8 #define T_TRAP11 0xac #define T_TRAP12 0xb0 #define T_TRAP13 0xb4 #define T_TRAP14 0xb8 #define T_BRKPT 0xbc #define T_BADTRAP 0xf0 /* trap 1-14 in 68000 */ /* * VOR value which requests popping of bus error info */ #define T_FIXSTACK 0xff b[ YlitT$ bY Sby/* vmparam.h 4.3 83/03/31 */ /* * Machine dependent constants for SUN */ #define NPTEPG (NBPG/(sizeof (struct pte))) /* * USRTEXT is the start of the user text/data space, while USRSTACK * is the top (end) of the user stack. LOWPAGES and HIGHPAGES are * the number of pages from the beginning of the P0 region to the * beginning of the text and from the end of the stack to the end of the P1 * region respectively. */ #define USRTEXT 0x8000 #define USRSTACK 0x200000 #define P1PAGES btoc(USRSTACK) #define LOWPAGES btoc(USRTEXT) #define HIGHPAGES 0 /* * Virtual memory related constants */ #define SLOP 32 #define MAXTSIZ (768-SLOP) /* max text size (clicks) */ #define MAXDSIZ (btoc(USRSTACK)-SLOP) /* max data size (clicks) */ #define MAXSSIZ (btoc(USRSTACK)-SLOP) /* max stack size (clicks) */ /* * Sizes of the system and user portions of the system page table. */ #define SYSPTSIZE (0x80000/NBPG) #define USRPTSIZE (0x80000/NBPG) /* * The size of the clock loop. */ #define LOOPPAGES (maxfree - firstfree) /* * The time for a process to be blocked before being very swappable. * This is a number of seconds which the system takes as being a non-trivial * amount of real time. You probably shouldn't change this; * it is used in subtle ways (fractions and multiples of it are, that is, like * half of a ``long time'', almost a long time, etc.) * It is related to human patience and other factors which don't really * change over time. */ #define MAXSLP 20 /* * A swapped in process is given a small amount of core without being bothered * by the page replacement algorithm. Basically this says that if you are * swapped in you deserve some resources. We protect the last SAFERSS * pages against paging and will just swap you out rather than paging you. * Note that each process has at least UPAGES+CLSIZE pages which are not * paged anyways (this is currently 8+2=10 pages or 5k bytes), so this * number just means a swapped in process is given around 25k bytes. * Just for fun: current memory prices are 4600$ a megabyte on VAX (4/22/81), * so we loan each swapped in process memory worth 100$, or just admit * that we don't consider it worthwhile and swap it out to disk which costs * $30/mb or about $0.75. */ #define SAFERSS 8 /* nominal ``small'' resident set size protected against replacement */ /* * DISKRPM is used to estimate the number of paging i/o operations * which one can expect from a single disk controller. */ #define DISKRPM 60 /* * Klustering constants. Klustering is the gathering * of pages together for pagein/pageout, while clustering * is the treatment of hardware page size as though it were * larger than it really is. * * KLMAX gives maximum cluster size in CLSIZE page (cluster-page) * units. Note that KLMAX*CLSIZE must be <= DMMIN in dmap.h. */ #define KLMAX (8/CLSIZE) #define KLSEQL (4/CLSIZE) /* in klust if vadvise(VA_SEQL) */ #define KLIN (2/CLSIZE) /* default data/stack in klust */ #define KLTXT (1/CLSIZE) /* default text in klust */ #define KLOUT (8/CLSIZE) /* * KLSDIST is the advance or retard of the fifo reclaim for sequential * processes data space. */ #define KLSDIST 3 /* klusters advance/retard for seq. fifo */ b[%ZliN?$ bw wby/* conf.c 4.16 83/03/31 */ #include "../h/param.h" #include "../h/systm.h" #include "../h/buf.h" #include "../h/tty.h" #include "../h/conf.h" #include "../h/text.h" #include "../h/dir.h" #include "../h/user.h" #include "../h/proc.h" #include "../h/file.h" #include "../h/inode.h" #include "../h/acct.h" int nulldev(); int nodev(); #include "ip.h" #if NIP > 0 int ipopen(),ipstrategy(),ipread(),ipwrite(),ipdump(),ipioctl(); #else #define ipopen nodev #define ipstrategy nodev #define ipread nodev #define ipwrite nodev #define ipdump nodev #define ipioctl nodev #endif #include "xy.h" #if NXY > 0 int xyopen(),xystrategy(),xyread(),xywrite(),xydump(),xyioctl(); #else #define xyopen nodev #define xystrategy nodev #define xyread nodev #define xywrite nodev #define xydump nodev #define xyioctl nodev #endif #include "dd.h" #if NDD > 0 int ddopen(),ddstrategy(),ddread(),ddwrite(),dddump(),ddioctl(); #else #define ddopen nodev #define ddstrategy nodev #define ddread nodev #define ddwrite nodev #define dddump nodev #define ddioctl nodev #endif #include "mt.h" #if NMT > 0 int tmopen(),tmclose(),tmstrategy(),tmread(),tmwrite(),tmdump(),tmioctl(); #else #define tmopen nodev #define tmclose nodev #define tmstrategy nodev #define tmread nodev #define tmwrite nodev #define tmdump nodev #define tmioctl nodev #endif #include "ar.h" #if NAR > 0 int aropen(),arclose(),arstrategy(),arread(),arwrite(),arioctl(); #define ardump nodev #else #define aropen nodev #define arclose nodev #define arstrategy nodev #define arread nodev #define arwrite nodev #define ardump nodev #define arioctl nodev #endif #include "nd.h" #if NND > 0 int ndopen(),ndstrategy(),ndread(),ndwrite(),nddump(),ndioctl(); #else #define ndopen nodev #define ndstrategy nodev #define ndread nodev #define ndwrite nodev #define nddump nodev #define ndioctl nodev #endif int swstrategy(),swread(),swwrite(); struct bdevsw bdevsw[] = { ipopen, nulldev, ipstrategy, ipdump, 0, /*0*/ tmopen, tmclose, tmstrategy, tmdump, B_TAPE, /*1*/ aropen, arclose, arstrategy, nodev, B_TAPE, /*2*/ xyopen, nulldev, xystrategy, xydump, 0, /*3*/ nodev, nodev, swstrategy, nodev, 0, /*4*/ ndopen, nulldev, ndstrategy, nddump, 0, /*5*/ ddopen, nulldev, ddstrategy, dddump, 0, /*6*/ }; int nblkdev = sizeof (bdevsw) / sizeof (bdevsw[0]); int cnopen(),cnclose(),cnread(),cnwrite(),cnioctl(),cnmmap(); struct tty cons; #include "oct.h" #if NOCT > 0 int octopen(),octclose(),octread(),octwrite(),octioctl(),octreset(); struct tty oct_tty[]; #else #define octopen nodev #define octclose nodev #define octread nodev #define octwrite nodev #define octioctl nodev #define octreset nulldev #define oct_tty 0 #endif int syopen(),syread(),sywrite(),syioctl(),syselect(); int mmread(),mmwrite(),mmmmap(); #define mmselect seltrue #include "vp.h" #if NVP > 0 int vpopen(),vpclose(),vpwrite(),vpioctl(); #else #define vpopen nodev #define vpclose nodev #define vpwrite nodev #define vpioctl nodev #endif #include "su.h" #if NSU > 0 int suopen(),suclose(),suread(),suwrite(),suioctl(); struct tty su_tty[]; #else #define suopen nodev #define suclose nodev #define suread nodev #define suwrite nodev #define suioctl nodev #define su_tty 0 #endif #include "pty.h" #if NPTY > 0 int ptsopen(),ptsclose(),ptsread(),ptswrite(),ptsstop(); int ptcopen(),ptcclose(),ptcread(),ptcwrite(),ptcselect(); int ptyioctl(); struct tty pt_tty[]; #else #define ptsopen nodev #define ptsclose nodev #define ptsread nodev #define ptswrite nodev #define ptcopen nodev #define ptcclose nodev #define ptcread nodev #define ptcwrite nodev #define ptyioctl nodev #define pt_tty 0 #define ptcselect nodev #define ptsstop nulldev #endif #include "efs.h" #if NEFS > 0 int efsopen(), efsclose(), efsread(), efswrite(), efsioctl(), efsreset(); #else #define efsopen nodev #define efsclose nodev #define efsread nodev #define efswrite nodev #define efsioctl nodev #define efsreset nodev #endif #include "ms.h" #if NMS > 0 int msopen(), msclose(), msread(), msioctl(), msmmap(); struct tty mstty; #else #define msopen nodev #define msclose nodev #define msread nodev #define msioctl nodev #define msmmap nodev #define mstty (*(struct tty*)0) #endif #include "cg.h" #if NCG > 0 int cgopen(), cgmmap(); #else #define cgopen nodev #define cgmmap nodev #endif #include "win.h" #if NWIN > 0 int winopen(),winclose(),winread(),winioctl(),winselect(); #else #define winopen nodev #define winclose nodev #define winread nodev #define winioctl nodev #define winselect nodev #endif int ttselect(), seltrue(); struct cdevsw cdevsw[] = { { cnopen, cnclose, cnread, cnwrite, /*0*/ cnioctl, nulldev, nulldev, &cons, ttselect, cnmmap, }, { octopen, octclose, octread, octwrite, /*1*/ octioctl, nulldev, octreset, oct_tty, ttselect, nodev, }, { syopen, nulldev, syread, sywrite, /*2*/ syioctl, nulldev, nulldev, 0, syselect, nodev, }, { nulldev, nulldev, mmread, mmwrite, /*3*/ nodev, nulldev, nulldev, 0, mmselect, mmmmap, }, { ipopen, nulldev, ipread, ipwrite, /*4*/ ipioctl, nodev, nulldev, 0, seltrue, nodev, }, { tmopen, tmclose, tmread, tmwrite, /*5*/ tmioctl, nodev, nulldev, 0, seltrue, nodev, }, { vpopen, vpclose, nodev, vpwrite, /*6*/ vpioctl, nulldev, nulldev, 0, seltrue, nodev, }, { nulldev, nulldev, swread, swwrite, /*7*/ nodev, nodev, nulldev, 0, nodev, nodev, }, { aropen, arclose, arread, arwrite, /*8*/ arioctl, nodev, nulldev, 0, seltrue, nodev, }, { xyopen, nulldev, xyread, xywrite, /*9*/ xyioctl, nodev, nulldev, 0, seltrue, nodev, }, { nodev, nodev, nodev, nodev, /*10*/ nodev, nodev, nodev, 0, nodev, nodev, }, { nodev, nodev, nodev, nodev, /*11*/ nodev, nodev, nodev, 0, nodev, nodev, }, { suopen, suclose, suread, suwrite, /*12*/ suioctl, nulldev, nulldev, su_tty, ttselect, nodev, }, { msopen, msclose, msread, nodev, /*13*/ msioctl, nodev, nodev, &mstty, ttselect, msmmap, }, { cgopen, nulldev, nodev, nodev, /*14*/ nodev, nodev, nodev, 0, seltrue, cgmmap, }, { winopen, winclose, winread, nodev, /*15*/ winioctl, nodev, nodev, 0, winselect, nodev, }, { ddopen, nulldev, ddread, ddwrite, /*16*/ ddioctl, nodev, nulldev, 0, seltrue, nodev, }, { nodev, nodev, nodev, nodev, /*17*/ nodev, nodev, nodev, 0, nodev, nodev, }, { nodev, nodev, nodev, nodev, /*18*/ nodev, nodev, nodev, 0, nodev, nodev, }, { ndopen, nulldev, ndread, ndwrite, /*19*/ ndioctl, nodev, nulldev, 0, seltrue, nodev, }, { ptsopen, ptsclose, ptsread, ptswrite, /*20*/ ptyioctl, ptsstop, nodev, pt_tty, ttselect, nodev, }, { ptcopen, ptcclose, ptcread, ptcwrite, /*21*/ ptyioctl, nulldev, nodev, pt_tty, ptcselect, nodev, }, { nodev, nodev, nodev, nodev, /*22*/ nodev, nodev, nodev, 0, nodev, nodev, }, { nodev, nodev, nodev, nodev, /*23*/ nodev, nodev, nulldev, 0, nodev, nodev, }, { nodev, nodev, nodev, nodev, /*24*/ nodev, nodev, nulldev, 0, nodev, nodev, }, /* 25-29 reserved to local sites */ { efsopen, efsclose, efsread, efswrite, /*25*/ efsioctl, nodev, efsreset, 0, seltrue, nodev, }, }; int nchrdev = sizeof (cdevsw) / sizeof (cdevsw[0]); int mem_no = 3; /* major device number of memory special file */ /* * Swapdev is a fake device implemented * in sw.c used only internally to get to swstrategy. * It cannot be provided to the users, because the * swstrategy routine munches the b_dev and b_blkno entries * before calling the appropriate driver. This would horribly * confuse, e.g. the hashing routines. Instead, /dev/drum is * provided as a character (raw) device. */ dev_t swapdev = makedev(4, 0); b[.[lN$ bx(Iby/* swapgeneric.c 4.13 83/05/13 */ #include "../h/param.h" #include "../h/conf.h" #include "../h/buf.h" #include "../h/vm.h" #include "../h/systm.h" #include "../h/reboot.h" #include "../sun/pte.h" #include "../sun/sir.h" #include "../sundev/mbvar.h" int dmmin = 32, dmmax = 0, dmtext = 0; /* * Generic configuration; all in one */ dev_t rootdev, argdev, dumpdev; struct swdevt swdevt[] = { -1, 0, 0, 0, 0, 0, }; long dumplo,dumpsize; #include "ip.h" #if NIP > 0 extern struct mb_driver ipcdriver; daddr_t ipsize(); #endif #include "xy.h" #if NXY > 0 extern struct mb_driver xycdriver; daddr_t xysize(); #endif #include "dd.h" #if NDD > 0 extern struct mb_driver ddcdriver; daddr_t ddsize(); #endif #include "nd.h" #if NND > 0 daddr_t ndsize(); #endif struct genericconf { char *gc_name; struct mb_driver *gc_driver; dev_t gc_root; daddr_t (*gc_size)(); long gc_dumpsize; } genericconf[] = { #if NXY > 0 "xy", &xycdriver, makedev(3, 0), xysize, 5120, #endif #if NIP > 0 "ip", &ipcdriver, makedev(0, 0), ipsize, 5120, #endif #if NDD > 0 "dd", &ddcdriver, makedev(6, 0), ddsize, 5120, #endif #if NND > 0 "nd", 0, makedev(5, 0), ndsize, 5120, #endif 0, }; setconf() { register struct mb_device *md; register struct genericconf *gc; int unit, swaponroot = 0; int sw; if (boothowto & RB_ASKNAME) { char name[128]; retry: printf("root device? "); gets(name); for (gc = genericconf; gc->gc_name; gc++) if (gc->gc_name[0] == name[0] && gc->gc_name[1] == name[1]) goto gotit; goto bad; gotit: if (name[3] == '*') { name[3] = name[4]; swaponroot++; } if (name[2] >= '0' && name[2] <= '7' && name[3] == 0) { unit = name[2] - '0'; goto found; } printf("bad/missing unit number\n"); bad: printf("use ip%%d\n"); goto retry; } unit = 0; for (gc = genericconf; gc->gc_name; gc++) { if (gc->gc_driver == 0) { /* nd is last entry in table, just try it */ printf("root on %s0\n", gc->gc_name); goto found; } for (md = mbdinit; md->md_driver; md++) { if (md->md_alive == 0) continue; if (md->md_unit == 0 && md->md_driver == (struct mb_driver *)gc->gc_driver) { printf("root on %s0\n", md->md_driver->mdr_dname); goto found; } } } printf("no suitable root\n"); boot(0, RB_NOSYNC|RB_HALT); /* NOTREACHED */ found: gc->gc_root = makedev(major(gc->gc_root), unit*8); rootdev = gc->gc_root; swdevt[0].sw_dev = argdev = dumpdev = makedev(major(rootdev), minor(rootdev)+1); sw = (*gc->gc_size)(dumpdev); if (sw <= 0) panic("bad swap space size"); if (dmmax == 0) { if (sw >= 10000) dmmax = 512; else dmmax = 256; } if (dmtext == 0) dmtext = 256; if (dmtext > dmmax) dmtext = dmmax; dumpsize = gc->gc_dumpsize; setswapsize(sw); if (swaponroot) rootdev = dumpdev; } setswapsize(size) { dumplo = size - dumpsize; swdevt[0].sw_nblks = size; if (dumplo < 0) dumplo = 0; } genericsize(dev) dev_t dev; { register struct genericconf *gc; for (gc = genericconf ; gc->gc_name ; gc++) if (major(gc->gc_root) == major(dev)) return ((*gc->gc_size)(dev)); return (0); } getchar() { register c; c = cngetc(); if (c=='\r') c = '\n'; cnputc(c); return(c); } gets(cp) char *cp; { register char *lp; register c; lp = cp; for (;;) { c = getchar() & 0177; switch(c) { case '\n': case '\r': *lp++ = '\0'; return; case '\b': case '#': lp--; if (lp < cp) lp = cp; continue; case '@': case 'u'&037: lp = cp; cnputc('\n'); continue; default: *lp++ = c; } } } b[3\lJ" bbybysunb[5]lJ bybybysunb[7lJ bybybyb[8lJ bybybyb[9lJ bybyby