IMD 1.17: 1/01/1998 2:30:58 MSDOS 80 Trk DS DD SLICER21@ $5ȎЎؼ&3 &36 t@3133۰u[3 uW  uJ13۰gu2&L:&@.Ë13Bu3ێ&;c;c6 t& 36 t@366&.& S2&>t &;t I;[u9t32;s2@;s눊 IO SYSMSDOS SYSNot Sys disk$Err loading sys$ ' @FܴƈJ@`  @`! #@%`'/1 3@5`79;?A C@E`GIKMOQ S@oWY[]_a c@e`gikmq su`wy{} @o O o / O @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` `Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aoׁ١!Aa!Aa " B b  !"!B!b!!!!!!""#B"%b"'""+"-"/#13B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%@`  @`! #@%`'/1 3@5`79;?A C@E`GIKMOQ S@oWY[]_a c@e`gikmq su`wy{} @o O o / O @ ` @ ` ǀ ɠ @ ` ׀ ٠  @` `Aa   !Aa!!#A%a')+-/1!3A5a79;=?A!CAEaGIKMOQ!SAUaWY[]_a!cAeagikmoq!sAuawy{}!Aa!Aa!Aa!Aa!Aaǁɡ!Aoׁ١!Aa!Aa " B b  !"!B!b!!!!!!""#B"%b"'""+"-"/#13B#5b#7#9#;#=#?$A"$CB$Eb$G$I$K$M$O%Q"%SB%Ub%W%Y%IO SYS'4 MSDOS SYS'U| tBCOMMAND COM h`jU>EXE2BIN EXE !)qSORT EXE !+`FC EXE !- PETER EXE !0@1ATTRIB EXE !=;CP EXE !Lb#SRI86 EXE !UeDELETE EXE !oSID86 EXE !tCFORMAT COM !V7TREE COM !SETUP COM !MCHKDSK COM !DTOD COM !DISKCOPYCOM !CONFIG SYS :!GDEVMM SYS !CIO SYS !DEVDMDSKBIN !PLM86 LIB H!COMPAC LIB P!$AEDIT 86 R!PE8087 Y!,AEDIT MAC ]!AEDIT BAK `!CL EXE J!jCV EXE Q!?)CV HLP S!۳EXEMOD EXE U!+EXEPACK EXE V!-LIB EXE Y!rMAKE EXE [! z[MOUSE SYS `! X#SETENV EXE a!)4#README DOC e!2CONFIG BAK ![GAUTOEXECBAT !\A C !]fuC;CON +4<y+..Slicer MS-DOS rev. 1.2 (c)Slicer Computers Inc., 1984, 1985 Holzer P.1985 $5 $ memory size is $k $RSPQ3؋FYX[ZW!RPSQV.&G< |2.%.&O^Y[XZ_&G.3.3. uS[tS[.&O.3u.&G 뙳t.&O &r3. t.ó&O &w)KPRZX>:;AUX W+Tn+.&O &.>t &O&)OGt. <u. .u&O&G .u&O{ t .&O~. t. k.&O&w.>t &O&)O>QP$ u<u. 䚨t t.XY䚨t t.%. $u$t t3.  m;LPRN WS++++++b;CLOCK ++++++++++WP&O&_&O&wML..LN(..>d|D...><|1...><|...>| ....@h @@p p    Insert disk for drive A:, and strike any key when ready. $Insert disk for drive B:, and strike any key when ready. $ ;t WRPSQV.&G< |2.%S&G..t)..:t u'.[g++++7+++.<u.&G &G&G.&G2.t&G.>t..>t..>t..>t.3..&w&G.t.؁....&_.V]^t.&_&?t&?u&G .;u&G .FCz..&_V ^u].&_.uH&?uK"&?u\&?um &?u~..;u..FG.u&O@u&O u&O u&Ou&Ou&O u&O u&O>&O&W..&_2.&)Ou&Ou&Ou&Ou&O u&O &O&W ..&_.&)Ou&O@u&O u&O u&Ou&Ou&O u&O l&O&W ..&_`.&)Ou&O@u&O u&O u&Ou&Ou&O u&O . .&" 3Ɏ. ˌÎف. 2.w.% .$ .# ™.t .# .t.$ .% .# . .S.$ 2.# .>% t ." t :I.t+>d uV. d .^t [uD. t=.# 2.;D s.# m.# .% 2@.;Ds.% R.% .$ D. 2.Ƈd . Ð.e.g3.e攊搊搊撺b.&~&=G󤊇.&&Ɇͺw.e  .&w t@&w t&g &g £e£ .gwcP43.u3AtيЈ:Јt.Ȏظ+ȎP.. 3(.6 .Ȏм666>˃3P!$%!6 tʴ!3۴>!>!C=!s$P>!XشE!E!bZ uO -5OOO 3K!H!H!MI7!!=!r,v;GI>}U>G&&E(GG3t/>GG&G&EG&E_GIM+شJ!H&ú~33ҸB!C3ҸB!ʡC+Ѓڎ36C?!P>!Xr;t !gKrDBu`t'=dsCttt&U &]t&U&] .\ u .GȊ&U&E.a..&n&~t&n.G&F.I&F..G.G^&F&F7CC&VS!&F.>&;Ev^DR.&V&^ZB.>&M&U.6&u&]. T^@tQu.t u8!sހFut=ds[ʀWuи7!EAuC36EOr< uFQV3!^ZY[Xs3D!€u>!=!ÃX[YZ^_]P!X\DEV\NUL\DEV\CON\DEV\AUX\DEV\PRN\CONFIG.SYS\COMMAND.COMBUFFERSBBREAKCSHELLSDEVICEDFILESFSWITCHARWAVAILDEVACOUNTRYQ Unrecognized command in CONFIG.SYS $ Sector size too large in file $ Bad or missing $Command Interpreter Invalid country code $?DEV/NUL Ȧȥȥȥ Divide overflow $,.-:P,.&.&6&&2&D&D^^&D>&&>&E&E&&EBYP.&&H&Z&+HX  Microsoft MS-DOS version 2.11 Copyright 1981,82,83 Microsoft Corp. $(rXvXX.P.6$w.`.^ˎ#JHXP&&.0ˎӼ2>&' t v QtPu >$uH$%(tP($X6.^`.#.&.F.J..H..X[YZ^_].6.UWVRQSP.6ÿM4V445 5 + 5/5;567 )j)J ''')x( \ g '' '' &'2'C' H Q 3i j X (@:,9P==> :F>:>:: ;/=/(4S/ << W;?T2u ...>u$....6D.P.RS.P&O[..&6# rt6#6&6..&6# rt 2tDZSVTWUEJDPQRRv5f666565m66s66x66, WR__r&V J&F&NLTlD26f6&f6d\3 $ rR x!&E&E &E/&E>:u  tM2&E1%rEm x]RP6.6  XCQ _l rƒ!&M u3FFMDP Zt@uBª@s&%fE!U#}@su$+)E}tE6#uÊ3rZu &M@2&e 3r9t22SrDtVtD^t)[rP tX.<$t)"V>D6.t. \3.t63۹o2rWT2r&_&&C6[S&.3Ɏَ¾ &+=v +رڣ P!R M K O o\LÊR_t@ u 6DsK+Vu6/3/rQ/>K&E. /7..Z/.Z2/>K^3҉TTE&FMZZ.2>K^7f*rZR?rOuM/&^ ^t6> tFF6>tFA+ t)3&=tGC/6:u\CXXC@3۬ u<.t-@r&E uO2&Fˬ tb<.uF tVWQ.Os:t tsFNYXY_ês2%s tOK;tP&EP XtOKO-^s t:vOK. t:uF)r!ru!>/ t&NuT\XX;u>K+Su? 2AM=. uă=..u!!s./+Z2>K[ 둿6 s9u>=Zt@&=Mt&=ZtÀ=Ztr&9>u&A& 3666P6r9>t#=Zt sX6>uhd[\rZ;vR;w6>u66>t6&9v666+ˌtEюI'6>w6r6+ˌ؋t@I&M&&>6@[Hs2rQ;v,Hr&>ʰ <rt 626<6W6U6Y6Du-3ۉJTG tttR tKG.I6>Jt4<t6&KuT&KԀ6ô t&ttt!t#D#D!#PQY ?6u6?e6666WUYD6?666&?tD6C6E6CD6C6CVWQu DtV ^t4uY_^6|66.$?:r &:Ft&n. WQP-XP3XઆPëثYX_-WQP6ơA=uv>/uË/ tur/ u !>+r+2d&N2Q&N>KW3s_&EYBء!@ù 󫪋6 DD«3urR_hrr4>u*M' t36:&t,G t6O t/&}?t.sM!;AsA:&tC1,&t t2tltt.&fá!!3&^Si[K&Vá!;Ct%@ ;r: rEsrã!È!>KUBJ3&^ tr8vs&&F3/H+&F &V+¢ -á/&F t/&F  >+2ۈj-PY6su u2:t,6u xQ6Mo u-Yt2 6tP>.u>W Xt>GVM ^<w 36 6tC<:teNNV6>tsH6P6X6^2r V^6<t@V@s^XX6  ,`VP=Xs^rZtNVc236t N&:Etì-u <.tt tà yVȀɀ_;uV>tMr ut^^WQY_rp>KG tU6>t׌_=tPW؋++SPVQuZ2Y^X[>K_ tGgudN2_ t^ .3!OHACP6"$XWVS$Y6Z&u&]&]3$X6T&u&]&]&'[^_WVS&'3$&]X&u66T6V66\t&]&u&]d$&]Y&u66Z6\66\t&]&u&]{ x/>@tt923366t״6>0t <t׋6>?v ut؋3ҋQY66t)W6>0t_6?<t2_6>?u6=6;60G<t< O< u < u3 K6>!u >&e:6 u>BtBQWB!_YD<uO *3 xe&E&UX-Q<tX+)366.״6>0t <t?>3&uÀ@33Ҩ uuug€?tZQY66tW6>0t._6?<t _6>?tB6;G6==t 60ⶋkW!r_68ry6 6Ê &2-Ԁ+E߁sE׊2N Ë&N&F2RQP XYtZt6p<tZQ&f&FSV"t6J<tQ&f&FSe>v[6?_+60P6Eu uu6> y2Xs 3[Ã@r2'#%!7R[Ãu^9С7&^;sN15&"F&N+tuH3'>&]3>[á5 t&+F+s3ۣ;3&v?= ;u=u&F=?&E&]+79ru t;s.+T t )+>;t>?tr?+WPSRQ[Z&FPE:EuA9Ur<9]s7}t.XPWR+Uڋ&N6sZ_&F/uYY[s )낡= t;gr 56!+3&L;'t" t+3s@ȋ&Ex+&e& E)&E#%IAÀ?&].G79x&v uH&NPR>&E&U&v t@33GIX+rGt8ʓ&f+Ã+1s3#%>E+v 3ңGIX+n+)+t QXrȋ)BItn+)>;t+? te1+?WPRS&FUE:Eu9Ur 9]sEcPu[Z6Y[ ),= t;5J>GI u t&E&M'O t;-&v&Nur>7&E9&E313>&]&]&e tc&;^ w=sQYP Xb5s QY 566KD6>tPSQM$P2>KEO&~XY[XPSQR3&N&FIPRQ26K|YXZ;u)B2~6K|ZY[XÁ {&f-/0&F:-&v>0 x2&f &;xt>;Et=uE:EuE6#u&~E us>K U6>]6=>;&f-/0&F:&v&v-^D>0u1&F6?:D ts6>;&F&fE&Fu&F=uE!U#>&]&U t+s3&]sBAJË+ 6!;>!>K>5Îۇs6>K]+&;vrOá1@1;3w2s6KGw+&;vr t%&:Fv+s>+)RS&F*‹ѹȀ;s-C;tK++R&f6!ƣ!XZ+)[+*̈&Q&NJJ &V YË=uE U ؊ֶS37>[RQSËC&;^ ~+=+[{X+ZbB&VB+#w3t H~Ɠt뽇ڋⰺ[YZ u>&]&e& ]SRW3ۋ_Z[3t=rs6>P3E=u6>XÃt}u=5W tM66zu 66.V4etXX^ lV4tXX^6&5&]V4tXX^D;uQRٌ;ZY3&F>)t ;Uu:Euo6>;Uu:EuI=u6>VRU]Z^6u]VWR tUqZ_^Um E2&FE t&F&fE 6M6+>K>)>8et&:t:Eu}tPuX26:%uEX=uøEK6u G t6E' t &;^ w]sZrWrr x  K&E rsrVP2 xM@3 ХDDX^ @x'«P3X6&/Q Ī6/YĪ3&=uEu\rZR\S[_r>KL &M &UT&UT&UT&UTG.&F2ðr) ?t6R%.sgr9ZZYRQu xv>K u&;N w+SVZ2[Kt>OuM3 3W6K&D.&FPS[X^_q6>#tQSV3_]`]66`u.6j<u(6_6]6j6`A6o^[Yr2^[Y<tL<tH<tDÜ6>'t 6>$u(pS3[r&t&!.#.$.&b#.X.;&bu...b.;&bt L.P.s꾐_]`2o]6k6.k.o66.VW^×u P&F6%X+R&fZ2&;Vr&;Vr &;V r6 &&F66.&v6>$uM6&6$6#6&&$&&&Ď6&6#6$6.<t 6%2>&tCf"666ۡY;t";uP6>ftQK&Y6E#%0&.YXXXP.6.662Ҩu&G t3t3󪑫t suFjIv<:uF,@v6:vFONG<.uF NvN r#u 6t< uI<*u?t<+t<=t<;t<,t< t< /uz/{/=MZt=ZMt}/+/j/e/t)>a/&/&Eh/x P6f/ XPuXr;wԀ>z/u/r;w+//r;v؉v/<rx/>z/t v/+j/-h///RX ȋf/2 j/r)j/Sˋf//3Qe hY;[u />j/uh//r//p//l/n/3ɋ/f/3 s/R{/6f/5 Zr߹{/66h/u&Ǝ؋ƉJ6e/t 66a/6/0$ t6v/S[6x/6/sñP6f/3ɋ3 6f/Y6/3Qc f^;t6e/u"6/-6n/6l/N66p/6r/6f/& )6e/t6x/6t/ tH؉6x/H؉R6Z66t/&,66v/&666a/Vt Q\3Y^Vt l<󤫫^t6:>v26:v2tttt& & 3؏6666e/t&66p/6>a/&]NN&u6l/&]&E66l/6#6r/.&p/VŽڋS [S.[P.t/ tH؉.x/ tH؉XP6f6sS[rãX$126& 6ft6f66DzPXÊ< rC<t6V66&uPX^6tSVr Dt}}< t <t&< u6 Qȵ Y66< s< tP^vX @p75rrt2kSSP XVI^[Vt2D^Ë<$tЎ2 t܊:v8 t݊J66V6.< u<t6:Qt8<t+<t'< t/< tO<tP:s26>u:sFFҪ_uƌŌێÎݾð z u뎰\k^6_ tR&< s< tG6>u tNTWOΰ Sv &} t 6**ˀ[_tO 6Q+*46:t:t G:tFs6:Qui*tItWG_u*]@x_W^6$t PR3r\ZX<t<t<t <t< tQ  ΋ѡY VS3ҋ64[^;tB=6s=VQR3ҹȾs#s${BZY^ô;r+Au|ƻz:°rt鸵sRϾ{IIIђVSP3ҋS6c[ۏ6R[^3ҹ@@2ôPQV t):u|t t6Qr6U>WYL[s؎M&[Āu$&G tut>\u >Pu V>WYg &e^>W&[/>W&P&E3&E$&E&@&E>QU&,s.t 6>KG tE؁t&F@.sR\DZ t<t̰_rW^r&G런ְSQY[sΰ<vrفtQPZYr6>K t&g &O &E3&O ˉLSVWa6c`st*6Mwwwwww 6666aXr 6:t 66aXP666r66KXG GGGGGD66]`66KDx,est뚋Q66-Y6s6Mo t 66!6/6>66 S6!66 6/G GGGG^< uO< t.< uO2|66BV^srˋD l x\6P6.6 XCo-P>t&+E|&=&ES([XPr&URu3mZ]YtB>+;vIA6-6.6/60SP-X[} &=t=t=t = tɎѼ!rδM!.uȎش !<t3 >|t|>tu˺>{t>|u>{u 5.L!| I!3P!u>tu3t././.1X@Q!.3P!.|.t.>tt=H!/ ;sKH!r.t. .p/+.lȎм}3~=t.!>|u"cI;rt;8;rt'7! /u \; ,lp.jP3X3ۋx:t>!C:t>!.>!CSPQ!ۡ.9X[$SPQ!9ۣX[ú46nuF>nuN[ø ! !EB=!s=uغ3ɸB!r.l?!P>!Xr;t)l*3ҭú"%!#%!$%!z9 !$_7狽t  !>;tqhu !j |t|>7t>7u>|t|ċϺ 庶PSRVP$<0r<9w,0 ؋д!Xt^Z[X+3<HL[_k{<Write protecBad uniNot readBad commandDatBad call formaSeeNon-DOS disSector not founNo papeWrite faulRead faulDisreadwrit e5writin drive A device $ COMMAN allocation filerrorCannotemor batcInserAbort, Retry, Ignore?0File3table bad0Invalid1.COM091.COM disk indrive Adefault driv0and strike any key when ready0Terminate8 job (Y/N)?EXEC failureE5in EXE4Program too big to fit in m70Bad or missing Command Interprete0No free4handle0M73e06load1, system halte06start1, exiting2or4name,_:/%PIPE1.$$$_:/%PIPE2.$$$  \lU-/LPATH=COMSPEC=/COMMAND.COM     p/+£l, t- £% 7! /u \>-u&\\:n@<@t">-u&L>2C< t< t: u4I) !42D![[Q3۴>!CڴE!E!E!>!Y]X- £% D ^Y>.I< t < tVQ &E{uFI.=!r ش>!Y^-L ! >.{>(u(>{t'Pێ! ثثZ.%!5x) - 1 B6.>-t0W_s 6.  u J!>-u H!% % 34r>|u8 !>(u_H!rF<3>u !A =!rش>!<I!<')l+)> /t|u Ȏм/6,6 +6+ t 6!+ >zt &,;!> t > utzȎP5/8!X+, t,,wt=r-!6,wt&rZ tt/ X W <t>|t6|+3ɬA< uI+< + ! +2 ++VW1-0l< t <%u&E=1-_s1- t< t <=t%^< t)<%t< u,0r< wW<3ɋI&5_to< tj%6,t#<I!< % ! !a r+<:u< u<u<%uQ< u+&+k wt + lt+0-)!<t, ,,< t F+ ,0-, tuO,>|t3:,uF< tFdKu  VBAPW&"*0- 2񞬢,uЀ>,t , ,-COu>-Mu,>-EXu>-Eu,Ɓ>-BAu>-Tu,,t-EX-Ef,t-BA-T-! t &,;!,zi,֎% t2۪ t<;t ,r t<;tV&E;N\OSVR2Ҁ|:u@0-WM _s(IZ^[\;!\6,zs,&& &<uH!&<&<-3 3IO,&:Et-M߹  +3 < t# &<&?CCt< t I23>@>|u|w6 =tEt, -@:-,I!,&t&z\Ri,% K.,% >|t>|ð,z,u&Ӡ,:,t &6,3&6\!=tĺ&&R A! A!3 wZú( )c, !A  3ɴ! !w6 >|u|#w6 <|uw! =!rذG+3ɀ< up<|t< t8A<|u&E I6+N6 # Q3ɸ|u|vV^u6t;3V< t<=uÀ< u^t(=S;[t< t,% 3<t3 u쾕((V%r+^þ((rz-,&% 3QVWoG&:Eu_^YtQUY&=uW@W>Y+À< t7D<=uþ t< Î,&% 3 &=uð=2!()2D!S3۴>!C[E!E!E!>!,xP>|u|6> tO-! > t ! u-&> @<@t &>t:_&E  ?t< u־+3ɬ<%u& :$uFV< tA^A< uI.+ wt&E$+&E ,(>|u|B3Ɏ,2&& u&> & = <%um&& 0 < t$=INt=inuV <(uN <)u,< tB<)t<*t|u&|&> t |:u)!X(Y,r < t* G3u&%G:t :GGu۬< tB u5 ,V3ɬ< t* tA<=t< t<=u < t_t| t< t u u2-)!!,t t ΁(++ 2۬< t t ,0Æ,&u2:s뢎,<uÎ3ɋIFF =t5.,< u<t&5Î,<t3҉>@~] uA .- <:t! < u <:t<u=(].-Qz Y &:u, &:uGc < w< tX < uQ .#/>!<3Ҹ=!r.#/؋>@B!Ëڊ,@ì<$tRPSQ.,> u *Y[XZÀ>/ t/ =!&r ذG>X t6>W tX =!r 33ɋظB!X 3ɴ.t\-׹ !|(Pf by(] X u .-tWU[r't?] .6.\)!U!PXU!u .,-.-u꾿-t' .- tW,P X%Ћñ$2Pdrd.- .F/ˀF3, .,u1.,.,N.-t..u..&V K-4  , 3R,/ Zð R) Zú& ú) t< ts.>.t'* s .>.t.6-l)!>m )t\!PmX%u< u["=!&r,3.,?!?S@![r ;tI;uûD!€uz.,>zt&,;!2,þ3>\t FF%;u < t&U3G ?󪺬-!U!F ,'e0!P2  Ĺ9.X2  Ĺ',3,)2!á, ,'u5r< tF=: u] .u;!sau9!s()5< t, ,'u .u:!s,(&,@<@u,&,:G!rȎغ5/8! ++ lCˋًËʲdĒ5/ tHt"9+"%' &à@/ÊÊ t þO< t(P'<`'3a' +!+< tˡ5/ t*Ht@Zr*r%Br {r@rk< uf+! u^%rX^rS#rNTrIr?Er:[rҊSMrl%Nt< t d2rߊĴúA'Qu2<>u&W < u &X hWX < tDt?:,t9< t &> +s< u+&> À>,/t-3؋ וOJ,' 3,PZրt"̀0*ъª''Ã>@So.#/?![r o<u׃><t<I!<m >|u|wìtN< t<=t<,t<;t< r&=u >8&G t0<$t&G) t7:t?uWW_ú)= ><|=2-6- ..6--;QV\.[+Yˋ)Iu. t & ) ]b.t 6/6c.b.36/+.&ǀt#u0-)!-1->g.3,,,6c.6/t[3,,///,/,b.. .j.--l-H,a..+3.ǀt/r=t ., .,ǀu,V%/.+ƿ .ǣ..A> .,^뭠/,/), t<v.<u ,A:F .,FF~u> .:uN .F~=u'}:uFN',=ttT!,2~.!3+.u .,u >,t/V%/.+ƿj.ǣg.f.A>i.^fM`cX&'6,3a&>,u[j. &V%/.+ƿj.ǣg.f.A>i.^>,u 3,,,6/&,e.6g.À>/uy36/+.rǀtu\)!j.:t@,@\tQ2, t --2/>g.->,ui.t j.3>,u Ir,>,t b.tIu,AFu"Ճ=!rظD!>!€uAFt;V:t@@Ճ~uv|:uFFNcuF;!r(3IO&,:F;EtFN;F~tFv<t<.t|:tFN2ۆ";!s7~F ?.Īı2QPj. .,|:u,AȀ}:uGG,A:u tDMP"Xu<.u .u XYôi.u P-!X\! ,j.=!r؉.W!/!/D! .t >/t0)M.,,+u@>/ue,,?!rUQ>.u>/tы>,,u,A+ы,,;,r >/u돀>.t>,t.>!À>,u,t6,;,u t3,,//2,r=tcvuԀ>/tW^.!//>/t1,! Q*! ֊YW!>!,,Ë^. .A!,,PX:,/>,t<u>.u>,c&t[/=>/u<3ɺ .!M&r>^.,ظD!`.€t2,$ u / /tz tD2 `.! u//>/ulu>.u&b,/Ë^.3ɇ,/>/uU3,@!&r+t`.t`. u >/uIt) ,>,t^.>! .A!,3҇ѸB!>,t@!$ zP$/X$/// À>.u &,.[2a. u6.l-)! .:t@/,@l- .&i.% t:u>/tb.24" /,/>/u$/ u t,3,uO>,->,t-m->.%/(/)/W3ɬu< t< t)/ t?:uπ< u:,u<:u>%/'/>%/'/uP,A:X>%/'/<.u (/'/(/t?*&'/rR uu<>%/%/'/(/gt&< t":,t:t<:uD )N_N.F< t#BWQKu Y__êA'/ Batch file missing $ Insert disk with batch file and press any key when ready $Bad command or file name $Duplicate file name or File not found $Insufficient disk space $Out of environment space $File creation error $File cannot be copied onto itself $Content of destination lost before copy $ File(s) copied $ File(s) $ bytes free $Invalid drive specification $Strike a key when ready . . . $Invalid parameter $SunMonTueWedThuFriSat Invalid date$Current date is $ Enter new date: $ Invalid time$Current time is $ Enter new time: $Are you sure (Y/N)? $ $MS-DOS Version $ Volume in drive $ is $ has no label$Invalid directory $Unable to create directory $Invalid path, not directory, or directory not empty $Must specify ON or OFF $ Directory of $No Path $PATH=PROMPT=Invalid drive in search path $Invalid device $Label not found $Syntax error $ FOR cannot be nested $Intermediate file error during pipe $Cannot do binary reads from a device $off $on $BREAK is $VERIFY is $ECHO is $Invalid path or file name $Invalid number of parameters $Error writing to device $ DTP N V+GLB_$EH{QNOT ERRORLEVELg EXIST) DIR+RENAME%REN%ERASEDELTYPEdREMCOPYOPAUSEDATETIMEVER"VOLCDCHDIRMDMKDIRRDRMDIRBREAKVERIFYSETPROMPTnPATH"EXITB CTTY] ECHOGOTO SHIFT IF FOR CLSvMZq H .j Vers 2.003P0!<}*ں !ˋ*s0< t< t <.u&.N&qrr< t< t <.u&/&ھ0r<.t<tڀ>.t0<u$>/t'r<u)O< tN< uú0=!rp !˺cSp?![>MZu=s%RQPS3ɰpB![XYZ+Ёs⡽ tЉP;wc  tx t'=uRQPS3ɰpB![XYZ)>u3ۃ>tE: ! !` !Dt,0r< r $_,< r<s ߀| u݋?W>p3S![_s|>tERQPS3ɰpB![XYZ?Sp![s>Î&-u״3S![_r >S![˺"HBMAUlloa/Microsoft/V202.EXE.BINIncorrect DOS version$File not found$Insufficient memory$File creation error$Insufficient disk space$Fix-ups needed - base segment (hex): $ $File cannot be converted$WARNING - Read error on EXE file. Amount read less than size in header. $MZc 8 /0!=s !.6˰7!.3ɬB.:u8<+t t.H!s u/؎㹀 ˁ3۴?!+t u9ȋֻ@!L!ڋʁuK+ك? t8tC>F +Au= uHP+É[Goߋ?u4 tTVW.+w.+w;r.>.6SPw.׊&G.:X[_^u;s뤋;t6VW+ϋN_^WV^_W+A_>F=W   u+ʻ@!r;tV2L!SORT: Incorrect DOS version $SORT: Insufficient memory SORT: Insufficient disk space   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~MZ b  Vers 1.000!<}  !3P2AGGGG(7!rU:u[tWsrGPWbrrGY;w r uȡtQPSA+[XY떀>t>t 2~7?SWW W~r廰WW WmrrK>t% u w  @9uswsw뮀>uw w >t,rwuwwwwir1w\rwIwwww=r4w=tl>tMsa]WrO=t=>ts2.I% 7. OjL!tP2X׿P0X,'"DVD^ ñ$$< s07ûwVѻwV;u QYt>t(>t_^_^VW؊:uFG_^VWsD~sF>uF < uF >u>u؊IsEAsG>uG < uF >u>ux:tR< uNFGu< t< t3< tA rsËwO+΋ uFÀ>uww O+t+A)W)W)W )W )WWBSSr* tHW tڹB!r t#[oú'5[O66y3[ËO_+ʴ?!ËO;t/=uOH= t= tG G ȋ3@} t@PȰ XuGA+Ëû3W w +qW w +[2Oú2BO:1À>uWW OA+SW0s u[[OS@![S2@![MAUlloa/Microsoft/V102 Incorrect DOS version$Invalid parameter: File not found:Read error in:Bad fileInternal Error*** Files are different ***Invalid number of parameters ---------- ----------------------------------------------- 3 *** Data left in F1 ***  *** Data left in F2 ***  --ADDRS----F1---F2- MZ@  y\yػ,&J!H!s rkipr,:'6/5a3t1>O![>2uz#ȴ@OQ3Ҏ!Yr;u뷺{]33)2 t"22乀366Ƞ2$u QVX&6AQI&6P2%ZYP3XU)8!86P161 u3X]Q~S]6}!6~)YU1FqP61 u93-/~>3t$>2u[63SPӺhsm]U~tv&t F!Nu]U-6)>5u@@2]U+)- qF>-:E u:4ue e e FGt- )u36-D2]U~G~ 3QVf^Y< tV<.t^F!< tB<.uFQ!Y<.t< t$z<0r<9v'u 'Y- ƺ]ô !ô!ô!:B71ú* $NO MEMORY AVAILABLE, SHUTDOWN TO DOS $CP/M-DISK: UNKNOWN FORMAT $CP/M-DISK: Read ERROR $ CP/M-DISK ? (A/B/C/D) $INSERT DISK IN DRIVE $:, TYPE ANY KEY $ENTER FILE-NAME (without Drive): $FILE DOES NOT EXIST $COPY to MSDOS DRIVE: $, CP/M- AND MSDOS-DRIVE CANNOT BE THE SAME. $, ILLEGAL DRIVE-SPEC. $ CP/M-to-MSDOS-File-Copy (V1.0 (c)Holzer, 5/85) $select Option: V (VIEW FILE), D (DIR), C (COPY), E (EXIT) $ $COPY $TO $? $ YES $ NO $           @      @  @A:12345678.123 CANNOT CREATE FILE, SHUTDOWN TO DOS. $ MSDOS FILE-WRITE-ERROR, SHUTDOWN TO DOS. $????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????MZ  "df)0@!+ڱ+©t ڀ3-6R6b+شJ!r3I&,6^ t FuF6>`Ƌ6Tr r6;Rrb6&R+6+6+T6Z2W¾󤑪36`W6.`~ X[PSPXXL!6@!UsPvu p0 p$vPvu q0 q3]ø]U싶D0%t yP {P FPFPFP}P Ă]Uv D0p0 ÈDq00#ÈD0PvH]U~~Pvtu rNFFHPvtt PP3PvtAu P3P vtu P~P3Pvtu P^3PO 帖PK=t=ud=uSރ]U 5PDJNRC4LHQB %t B0 B00d0Ël;أ;n~ Pvv0F@*0%u(F=,t =;t0==t0=t 0= uF뻡v0u>uFFv0Ft@=/t;@*0%u-F=,t%=;t 0==t0=t0= tF벋v0FtUF+0uA=,t<=;t7==t2=t-= t(vvFH^Fv0F@*0%u+F=,t#=;t0==t0=t 0= tFvP6P ]UvPE P]6>!.)6>ظsh8VNC8@&VC)r2UFP{@u3]ÍF-P^F-PR^-PF-P:^-ÉF P:FPF-PFP.@uٸ]U~2II]U~3Iv~H]Uv_vW]Uv^AQVv_^YH]Uv^AQVv|_^YH]Uv~ 2׊G*u u]À}t3]Uv53v~ tr@]H]îu]Uv~ 2׊G*u u3]w]ø]Uv @P Ft v PF]U Fv<t8D0=:u.0F@*0%tF- v0-@FFF0Pvt ]Ëv0PtF@@vPO6v/HvF0Pu Pv@vv5FFFv<uFSPF(މ^^C QvF^|u'FH;FFs ]Ëv0PCtr PvEuLFH;FFs ]Ëv0P tۋFH;FFs ]Ëv0Ptvv?v!FF0PtF\vFFt3 ]3 ]U]Uvt0 FF]Uvt0 FF]$~F u!`:\GXUh!shr]UF=\t =/t33@]U7&0=/u~/t33@]Ã~-t33@]V!NVN}kV!OksUVFTFPv\FuvvZtNTvFvv\uvvZtNTvgFvv\/uvvZ tNTv9Fvv\uvvZ{tNTFPv^FTV]U Pv8F@0ۉFuFFvv F+Fv v u33CÃ]UF FFF@"SP0vu$Pv0u v0=.tFFvv\v>u33CÃ]UF HFF@$SPFY0vu"Pv@vv FF+Fv v u33CÃ]UvvvFvv3]U Pv 0vt@F F HFF@$SPF0vuv v RF+F v v &u33CÃ]U(VN!s(]U(^NV?!s(3]U(^NV@!s(3]U(F B^NV!s(؋]U(VA!s(]U(VFCN!s(]U^D!]U;&XwFF=},PEFF~} v Fv vw ]U;&Xw썆F0uƉF@0%^t0%u40>KۉF>x6::0맸:Pv뙍F PFPFPQF uzFF^ ;d>Kۉ>x6::C0vB0:SP F뼡>H>x6::F0:Pv ]U;&Xw,FD^;sG0tFF=Du3]vv v ]U ;&Xw4vDt0%t VP vD 0PZ vD0=+t33C0^  F~ t^ ؁PSvF@u3 ]øP3P3Svu ~ tF~ t3  SviF@u3 ]Â~ tFg~ t  ؁PSv F@u3 ]Â~ tF3 ]=wt=rug=auFEtNF vDvDFvD D3DDD FDƃ ]U;&XwvD0%t VPX vD0% u| t t tq3vDD DD 0P]U ;&Xw'~u3 ]ËFHFPFu3 ]ËvFDƉF ]U ;&XwFfPFFu3 ]ËF@@H^F^FN=v vFF ]U;&XwrF Ƌ\SPFs]U;&XwCFx=}D0%u h 3]ËFD]U ;&XwFF=}D0tF~uh ]ËFD%^3ÉF%vt3 vF%Ov0 @RF%t3 v0 ؈3v0 `%vh ]=t=t=tۋv0uvDF ]FF=}7 @PvuF ~EF ]FvDF%tvnF%PvvD>(t4F%t3PvvD>(t>hv ]ËF%=uvthv ]ËF ]U;&Xw&F % ^ SPv ]U;&XwFyh]vFu]ËvD0F==~FSmFF0^;~FFFF0= u Fv #F0=uFFFvF뮸 PsF]øIF^ qF^v0%t-FF;F}FF^؉^VvF]FF;F|VF0 PV PVFF@vv F]Ã~tPV PVPV띸 PV PV3]ËFFvF0= }^PVF0@PVSF0PVEx N N .;u.y뛋F]3]vvvt,F>(t]Ëv0%tF]3FF F^;~UFvF08F+FH3ۅyKQSPvFF ]뿋F F vF= t=t~ u ~tSF ]ø](O!!s.U;&XwFyh]vFu]ËvD0IFFFFF^;~6FvF0= uv0%u PVF0PVF]Ëv0%tP3P3Svv0%t(vvtF>(t]ËF]F3FFF F^;~pFvF0= uF0= tF NFF@v^=F^|PPvt F >(tF]ËF F F놃~t!vPvtF >(tF F]ËF]h]èEMUs.U ;&XwvFu  ]ËvD0t 33ۃ ]vvvvtoF^>(th ]ËF^ ]U;&Xwv LFu]3v\0ۉFut>(tFvF]Uv>(t]3]Uvv)]U;&Xw PFt0]øP]U;&XwPFt0]øP|]U;&XwF0PPYF0]U;&XwP7]U;&XwsF0PPF0]U;&XwKF0PPF0]U;&Xw#v D0%0t]Ëv | uD0%uVt]Ëv D0%tF)v D0%t]Ëv D0 DD Fv D 0vtPFyv D0 D~uv D0 DF~ v DDv D0%0t]Ëv DHDx 0 v ؋Ã]U ;&XwFv\00Ft ]Ëv| u[D0%uQVt ]ËvD0 DD DHDx^0 vv|؋à ]ËvD0%t8~u3 ]ËFv\ 0F v NQSFEFFvD0%t ]ËvD0 D~t2|~,DHDx^0 vvFv+DF tD 0v tPFF~uvD0 DF;F tvD0 DvD DDF=t \K\x 0 vvIvD0%0t ]Ã~u3 ]ËF ]U;&Xw+v| tD0%u3]6"vDuh ]á"vD D0%D3DD]U6;&Xw3FF v:0-F FFFu F:F v:0F@*0%tJ~0uF0v:F:0%Fv:0@*0%tF F:0ÉFыv:0=.u7F:Fv:0@*0%tF F:0ÉFыv:0=lu F:FFv:0~tv>\ N^ v>3ɅyIN ^F yBV ^^ F1~tv>\ N^ v>3F ^F FHFF ^3ɺ v 0vR"F ^3ɺ t F ^F Fu~u FHB"-FF"^ظ +FF ^~tv>\ N^ v>3F ^FFH^ N3ہZ"^ V^ FV^ F FuF"^ظ+FF ^@~tv>\ N^ v>3F ^F FH^ N3ہ0J"^ V^ FV^ F FuF"^ظ +FF ^~uFF F ^;~~>5<0tF v>^pF"F v>FN"VFOFHFA36]f"e"g"c"sV"o!x8!u dH .;"u."y뿃~uFt;F }F FF )FF~ t?F HF xFFv<~FދFHFxQFFv<FFHFxFFv<FF HF xFFv<~FދFv@F:@6]Ã~uF~|FF @^"S^S^SvPv>40v>^"NɉF N^y^~u~ t ~|33@F~ tN3F~tF~t!F@^Ë^ۉFx^~t1F,FFFyF=cF~F~~F~ u)F;F~!F)FFHFxvu ^ ؋F ;É^uF F ]3]U;&Xw׋F3SPv F^]U;&Xw׋F^33]ËF^NF 3ɺ^N ˋ^FN^vFu\؋N;ȉ^sv FDƋv3]ËF;Fu)~ D3ۋNȋVӉMNjv3]ËF ;FsF)]ËF ;FuFvt^;vF)]ËFvDt^;u GD3]ËF^ FN^ F v3ۋFDÃ]UfFV!]U;&Xw1֋F ^\Z?~3]áX^X)ZN \F]U;&XwՋF 3SPFt]ø]U;&XwՋVX+3ɅyIZ\X]UN u33F u33NFyy 333o3v3yڃux ;r+COu3ɋ!;r u;r+COu΋3FtFtڃ]U(FF v,DyN%u |u |u FuNF txvN }F ϋFxA=7FF^NV ֊͊ߊĿOu% F 3333ҋv4Ft D\Lv2F(]þ@3^NV~ = r- GNu^NV~ ËF F FЉFFЉFFЉFË3Ã3ɿCK[ÃCOOyËF^NV NuF^NV Ã~,t F,F,V0FN.uNFtP3XPx+u3;twH XZbikowski C startup Copyright 1983 (C) Microsoft Corp***** Stack Overflow ***** 000,+R-RR %s /debugnc%s Invalid number of parametersIncorrect DOS versionInvalid path or file not foundSyntax error\\/...  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~:.\/: ((((( H ((((( H con:CON:prn:PRN:lst:LST:lpt:LPT:lpt1:LPT1:aux:AUX:com:COM:com1:COM1:rdr:RDR:pun:PUN:nul:NUL:null:NULL:0123456789ABCDEFNot enough memory MZb b\ػ,&$3ۊp $GW!AqJ!Z L!L!UH!Ar@3ҹ =w3^&&G]PH!Zr^&&W]UF3 uشH!s^&]UFI!^s&]U3 t$3Ɋ F~]x$$ ! ! !%3ɋي ٍp GUN^& t F!]U!]U !]UV!]UV!]U/!V!O^ uNV '!P؋!Xr3] UVA!s]UVF=!s]UV<3!s]U^>!s]U^ VNFB!s]U^&W&G&+G&W&W&O t^ B!s]^>t@v&D;r&D>@r).@3^ ?!r=u^Сȣ3^ ?!s]3ҹ t@3ɋѸB^ !v&D&T+ t@]U^&G&W&t&+G&W>@r3.@3^&_^@!r=u ^&G͸]3^&_^@!r3v&D&T&D&T3]U^&G&W&t&+G&W>t'^&_3д!^&Gҋ^&_3д!v&D&T&D&T]< u д!< u !&uÊд!&U^&G&W&t&+G&W>t$^&_3^&GՋ^&_3cv&D&T&D&T]U>u]Ã>u 5P#/> u P>u>u XPP]UcP9P]U&P;{<v؊#{u {&>{u&~wP(P]À>{u>'Tu>(Ou n>{u>{uLzzw<㍿J't+Juz(zu{&>{u@xrzz:{wڷ&`u+Ju&PP"|s!z&PP}PPPq Ƈ|zuf]UE 򫠀s]às6F]þFG PP 6PP  w؀?uuw%؊ t6uӻ t8Ƈ. w؊ t6u]UȾ6&@ u]U q]U"$ ;w~scs(0PPqPPcG P PSPPGPPP86P P,r""Y"$=&G&G&GZ""Y"$ 6">[NO ]U저s]øPPo >tPPqPPej@ȾE6&t@u+J]U저sMr&GtPPtuPPPP tPPPPPvsV&G6&D&G&D&G&D&G&D&G&D&G&D}rN&G":u>PPt*PPPPPP?r]øPuPPPPP&g]UbPdP&P+{PPS>tPPUGSSPPs u>tPP> v:PPP&PP!&1ȸ>SSPP|> u_P>u T> u >um>u;r&GPP`uPPPPPy66SuPPPlPP`Bb6,)&GsY &O0>uYsr:6SuPPPPP6uPPP PP~&GrSPbss PPP$P(P-PPP PPZrYIu &GsYrY\.S S&GskSPPPPP(PPP︚PPY>v P>uB]U^&//t^&ar zw& _/]U~*u2~?t*~.u"~ tF<0rtH^ 0&31@w063q.>^& ] >1v2s2r/1<s^&?1>tg0^ &8.1:4s^&?1>u[2r21^&.14u]:w%2r >1vF13^&1U765 ~ 5^&8u5PU.. >6v7so7r6<s^&?66< s^&?67r167"7r>6w68^&6Q]UA^&^Se^&AP^S;^&?t+>AȢ9F@N 9tj&^Y96F9(99돂>u2^:&8Gu'&O&&G(F@N FN >uF^ ^S6P^S^&?t&6S4^& ]U^&>0PS:<^&?u9>:^S:SP^& t6<S^&cFr:w~ ^Y>F N F N :PPP<^&u&6<S^^&>]>Fr:w~ ^YUFJ uJ >J/ta>J\tZ>J rO>JzwH>J!tAJ<#r<&v6>J(t/>J)t(J<+r<-vJ<;r<>vJ<[r<]v>J`u]ð]Ur >J uZnr 8JtHJ]ð]U6J< t< tK"K<'w<8Ju/>J t3J:KuJ:Kt]s#Krs]6JJs]UFDFHL]UF@B(^&Ds^&J]A:/ ????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????:CO:CON::BB:NUL::LP:LPT:MSDOS COPY (V1.1) 18.2.86 (C)HOLZER COPIED APPENDED LOAD DESTINATION-DISK, THEN TYPE , OPEN FAILED , WRITE-ERROR , CREATE FAILED , BAD PATH- OR FILE-SPEC *** INTERNAL ERROR 0103H APPEND COPY ? LIMIT EXCEEDED, MORE THAN 800 FILES PBQCOMMAND-LINE-ERROR, USAGE OF CP IS - CP iFileSpec [TO] oFileSpec [SWITCHES] iFileSpec: [Drive:][Path/][File-Mask] oFileSpec: FileSpec or one of the following: :CO:,CON:,:BB:,NUL:,:LP:,LPT: TO is optional Switches: Q = Query, P = Pause, B = Overwrite TO LOAD SOURCE-DISK, THEN TYPE LOAD SYSTEM-DISK, THEN TYPE , READ-ERROR , SEEK TO EOF FAILED , CLOSE FAILED , ALREADY EXISTS, DELETE ? *** ERROR: CANNOT ALLOCATE MEMORY , PATH OR FILE DOES NOT EXIST [ AUTO-QUERY INVOKED ] , UNKNOWN SWITCH - IGNORED , RESPECIFIED SWITCH - IGNORED *.* MZ3 0ܦ ..\،,&I&UI&U$3C G $.F! A?J!3..SQ.& &O &&O&&O &&O&!&OY[SQ.ظ & &O&&O&&O &&O!&&OY[#%!%%!%V!%!%!%!...3!....h#RQ:2 tH*.#.!.6!.6#.6.6.6.6. .#.!.6!.6#.6.#.!.6!.6#.6U.v QQN6#QQ:3ɊRQ9#QQ9].>t .P.XU.v6 t ..P3PPP.L!@ :p:98=aG >< > ~4/>p>a4"=Uv.6.]Uv&4.6.]Uv.&.&D].Y.....&..vvI*36&[q.Ћ& .>t52"t3PJ ......&..06z)3YX t'...&..#P4X..QÌ.& L.N...RT&VPVWPQ.3ؾ@YX_^VWPQ.3@.>u R Z!$!YX_^VWPQ.3@.>u R Z! !YX_^.>tXx.>tP>t >t! !XR ZP>t >t!$!XR Z.<u RPXZ.3ؾ@ U@FHJ@wd؋LNN tD9Vt?Hw } @^t+JYuH&OL&:Ou@따]U||:w1F 1*| ^&F 1F|u]Uu+J<v ^&  6<F<>]U^&}}t^&ar zw& _}}}w,؊ ~t+Jt}ʠ}]UB<]U^Sg.-9r|>u*^S"=DFFَ&G&D>K^& A>u*^S<DFFَ&G&D>^&#^S^S:DF^&?ueD& \u&tD&\u&u 6F^YDG P^S@D&G^&?t&6FS31^&!*6FP^S1^&?t6FS1^&`6F^SN1D&gu&G6FD&GȴP^S<D&G &W 6F^SD&GF&GO>]UDG P^S3^&6FS0^&?t6FS_0^&)(6F^SD&G &W &GF&GO]U^S9.[ g q  X ^&p>u*^S:DFFَ&G&D>p>u*^S:DFFَ&G&D>7>u*^Sx:DFFَ&G&D>yP6BBtP^Sk8DF^&?uJD&GD^S^S@8DF^&?u6Fs6F^S.^&( ^S6>]U~ tX^ ㋇DFَ&t &D]D&u ^&HF t<wD&8Gu8F v ^&&"F D&GF&GO&G&G&G] U젬t=~u7Pv^ S^S-AP u ^&R^ S6P30P^㋇DFَ&GO;Ft ^&-D&G":t ^&&D&u^&^&?uD&_.  " / l 6F^ Sv^S %^ Sv;^ Sv8 ^ Sv6:] U^㋇DFَ&GO;Ft ^&xD&G":t ^&&^D&u ^&ID&_. 6F^ Sv^S^ Sv. ^ Sv.] U~u ^&&^DFَ&GO;Ft ^&TD&u ^&?D&Gs&GD&& Gu!&G&G&W&wMRP^S8]U^㋇DFَ&GO;Ft ^&F ȈF <v ^&#^ . !D&G&W;V u;FvJDFV &)G&W]FV DIDFV &G&W=D&G &W ;V u;Fs &G&GD&G &W +FV &G&WD&wM&w&w^S7D&G":u&G&W&;W u&;G v*&G &W D&G &W &9Wu&9Gv&G&W] U^㋇DFَ&GO;Ft ^&ED&G":t ^&&+D&G&W&G &W 6FRPP^S]U~r/^㋇DFَ&GO;Fu~v ^&sD&& Guf&G&W&G6F^S.*^&?u@~v:D&Gs G P^S&,D&GO6F^S)^LJ]URRw؃t 6R^S'RuۡDFَ&GB]U^㋇DFيN&]U^S^S42DF^&?uM6Fs6F^S(^&(,DG P^S:+^&T6FS(T^&]U^&~^ S^S1Z\^& ?u^S^S1VX^&?t ZG P^Sh7^&^^&?t& >^u^&^& uR6\s~ZG PVG P^S5^&?u&^&?u&^& t(`&6XS'6\^S'`^&N~s/@㋇DFVw } @^Y6X^SL'6\^S@'] U^ ㋇DFَ&GO;Ft ^&`D&Gv&~ vD&_ &D&DD&_ ^&G&GD&G&W^&G&W] UDF^&?t ^&2F t<w>tF <t<u ^&# F D&G] U~ v^& ]U^㋇DFَ&GO;Ft ^&QD&G &W v&D&T&DD&G$<u^&G&G~ u ] U쾠 ~]UbFtf^ S^S.DF6Fs6F^Si%^&(.6FP^S%^&?t&6FS9%^&!v~u)DG PP$6F^S6F^S%GF":ub&DG PP#6F^SJ6F^S$b t^&] U젮^&&G^&]U ~ ^. u+Jdtrvt~^Y^6d&x"u^6d&x!u^6d&x u^6dp^^Y>du+~} Wu+Jd^~^Y^&Gv&D ^&G&D ^&G&D^&G&D^&G&D]U^ &^&?tx^S^S,DF^&?tD&:u &u&G\DG P^SL2r&ruD& \u&t>ruD&:u &ur>rt ^&?t6F^S"^&D @u+JpJD&x \u >py  D>py +P^S "jl^&?ul^&>j+DG PjSP1n6F^S">nuEjS^SfFN^ &~t,^&jlPQPRP0nu ^&]N^ &jS^S FU55w* ؊ ~t+Jt5̠5]U졞PP# PPt#6PPPPU# PPI#]U츞P>1>t2]UlPP{  PPdPP6PPP6PPPPPN PP>@PP 1024 PP>uiPP  >6& F6 >9򤠘 & @& $% t+Ju1 P5P! PP!sPP!S6!]àr$%>$0]U PP죊>tPP@  >6& F6 >9򤠣 & @& PP S6 ]ð]U>t]Ds]ø PP j]U$<vȴ&>0]ø0]U> uP!PO >t]àSPP.>t4>u s]À> u PP]2]U6PPPP PP]U츰P4PPPP꣄>uPPPPq>ub>u|>t]U>u]6P,>tu<P#->tz2>uk]À> u PP]U3rR0s682r$ PP6PP(u6P6PPO/ u>u>ũ>t 0]Ã>t! PP66P6#368;u+Jt& &@ 0tJ68Ȱ&u+Jt"։&  PP3]U6Pr]U3:t@u>@u >u?>wPP$7t+Ju1> t+JFPP3>t6P. 3 8 = D K R Y ` p rmf_X4Q4JSP:SP*% 3' U2r 1r;UF8:َ&wM^ Sv^Sj<9Fu ^&?t ^&).F8&G&W&G&W&;W u&;G v&G &W ] UF8:َ&W&F&O &W ;u;v &+O&WN8F&G&W&wM^ SP^S>9Fu ^&?t ^&*>] Uxxz6BPP@P_~6@|]UF)D|=s|I+|N+ȉN6BPWQ@PR6BxSP@P~6@|]U6BPvv@P6@f6BxSP@P~6@F|]U`D tL+|;vDx6|0\>`9[6`]Ux6|&Ds|&6BxSP@P~6@|]U]U>|v.|]6BPPP@P6BxSP@P~6@6]UP<v C]U>u u]Y>u"6h&1Y0>uP6l&6h&َ]U6D]Ub6f&FF6f&FF6f&FF6f&FF6f`F~u6&FfF~t:b6f&\6`&f`N׃~t{N`+FF~v/\v0>`\9N[F`Nˋ]UF":u P^Fu^.k%s%%%%6h&XZXZ6l&]UF$pF":u P߀>v Pހ>u[t<u v).&$&G&Y&`&e&j&6h&XZXZ&6l&^]UF>Dtpj u "<t< u &뒸 P]U6D@P bd6@\b\^bPDu , .(%(D('(((!p6Hpl&P6Hl&>u ":u6@P6Hl&6@P>6Hh&l&h&&IH]U%$t :sP۠t<u-=prp6Fh&&H=$>u6Fh&&Hn6Fh&&P>u ":u6J;u)P@PZ6Fh&&@6@6DF]U>Du":u P.=*E*h***Nt&GLt&됡Tt&GVt&G닡Pt&GʡRt&G ]UI<u]s]t&w&wt&9GrUDP?HD>pt P]]U":u P]à<t<u!Nt&GLt&]UJ>Dt_itJ>tU<t+Ju J]U P<uP<60*$P@AP@P tv6@{thj@YlnRt&G B&G &G&G&G&G&WHFs,rHDw?,p..!.&.&.&./././././.&.4.9./.>.P' Pu]U@FB_D>nup>uPI]Ut&w&ws{Ft^t+Ju6D66HD>u ]g>u bV>u\S?>ru .>tu >xu@t$6Dr6DP ^]U^&? u'^& u^& u^ &^ &.t\t tߠ^ &8.uȢ^ &>t &@.^ xvFY>u ^ &] U EPP PP EPP PP EPP <v XPP BPPu ؂@u 'P PY ؂@t+A(*َ&,((S6, EPP tiPP EPP ]U<w4؀@u A Pذ@Au]U<v>t Xt+Ju>tZ [t+Ju>t- `t+Ju >u\>u]à]U> u]øEPP 6 DP PEPDP EPP ]U P P >t<=tI> u]øP P~ < u$IJt+JuL]À> u> t>u<wƇ0uQ/<wJ>=t5:w,/:w$؈0P P /İ8w8/v  ]À>=t/0P P >t0:u8@u A P.@P P$.Ƈ@$A(*P@>u<wx Xt+J;t`t+Ju [t+Juz>uU>((?>(:(>((>(g*>((@>(:(>(򤠰*(>(*>u  P P?]U P PpP P`>tMP Pӣ$> t6$PP P6$NP P P6$@P0P Po<w3؀@u A(*6$PQ@P P6u6$ P6$ Pك> t]U P PP Pr>tMP PУ$> t%6$PP P6$P P Pԣ"N t+J"t#  6$ P6$ PR]6$@P0P P9ԣ"<wuذ8@ua.@P P&.ء&A(*P@6$(S@P Pӣ"u6$ PU6$ P׃> t]U:w1F1*^&F1Fu]Uv P0F -u+Ju-~򤡲؊^򤡲؊^&] UVCN!]U졌H&>ZtA&s8;u#&>Ut@;t PP&@]UFH&>Mu&> t & ^&]UF uشH!s^&I&>uU&]UFH&@I!^s&]UVڻW <!GMsOM)^&]UF33&G&G&OM&GMٴ>!s!^&]UN ٻW =N!s)=t !=t&WM^&]U GWV^_u߰=K&8uC~v/C < t< u~Vأ؎ٌ.J<.&L<ɴK!.J<.&L<s3 !  t  t3 tG tb u!G]UV ^N@!*r^&] UV ^N?!*r^&] U~t^&!Fnu]U~t^&!Fnu]UVA!s!^&]//::U*!³ 0 0.=0 0.=ºd³ 0 0.=,!ų 0 0.=0 0.=0 0. =~Ȏؾ=^&]//::U*!³ 0 0.=0 0.=ºd³ 0 0.=,!ų 0 0.=0 0.=0 0.=~Ȏؾ=^&]U( r( F$ & 3" " ^$ & 3" ) ]U^$ & 3" ) ]U~(3i >) 't>) "t&<'t<"u) s" $ 6" &< t!:) u#<"t&@< t<'u " 6" 3)  =Qs&^& " ^&$ 6" &_$ 6" &2 rIsD =Qs Qr ^& H^&T &8tF'&8t"&8uF6" ) ] &8t#&2 s" 6" N$ &< u ) ]U$ 6" &< t< uF6" ]UI J F>J u{I <wt X~t+J;t`~t+JuJ I [~t+JuJ I ~]U* \?u+J: t]4 * P4 Pk: >4 u]À>u]á0 2 Pu+J8 8 0 SRPP6 u]À>tt< L * ?u+J: >: tA>L u:* 6< t "Ft+JuL < : 븂>L u]0 S66 4 P`]U9N vLv~^t+J;Ytv~^t+J;YuF N F문]U^&!FF ~ @u+J> t>> uM ~ ;> u+J@ u> F > @ F > +I> v M F FF F @F F K\8M t F M F * ?u+JB * F M FM P^SD ^&?t!* M ?] URP^Sl* ^&?t &* , . PR^&?u!?* & * &:* &\:^SN>J u.^& F* v FYI ȱ؂@u=I @I * & * &:^& J ( F@F* I ȱ؋A, . َ&H , * 6, H FYH , ^& J ( F@FI \I ~t+Jt!> t* H | I H * H | v FY* ]URP^S* ^&?t &%* , . PR* &O* ]UN QNQ^S<^& u/شB!B!PRB΋!ZX^&]UV~ 6 < t t)JI t< t u/ Ƈ C˾ ى 6 < u F+]RW3  > }tC6 Pp6   t$t/t*tA s   뼴!붲 ! !_Z  > t&   > t   붲Q!YQ !Y!UVٴB^ !^s&&] U~t!t ^&]3]UV ~V!s^&] U츰P$ P( P$ P( >u & ]øP$ P $ t& $ %6 PP$ Pá$ t& $ 6 PPP$ P%) ) <tu16 ) PP$ Pã" 6 PPP$ P6 PPP$ P6 $ P 6 $ P6 $ Pi]U6& P$ PPP&PP]UN/Q!Yt^<t<u. & &FыF]U/!0 2 V!O^ uNV !P0 ؋2 !Xr] UVC!s!^&]U^3 &8tFv & 2&X tKV &u?&PV &^S^&?u6X ^Sc LJB ]Ue e < sB؋B V X >X t!َ&Ƈe P^S?^&?ue ]UV &F]U^&Z @ d e Fȴ^ PSV X ^&?t>V @V  V ^ SV P^Sb V P^Sb ^&6V P(P^S^&?t6X ^SuV P^SV &^&?t 9V &PP^SL^&?t#V &@ P6X @ PV &ƇV &PġX \ ^ ㉇B >b t>b ;t>b ue e sPd Z V &Z S@ Pb Z &Z d d <)t< t<;t 뢠d V &] UV &u1&LJ&PP^SվV & u&Ƈ^&?t]U^&` ^˷㋏B V X e ^S^&?u~ uxe rV &u^SK>` zr ^&Q ^&?t_V &&b F u#b ^6` &` V &&&>b %tV &&u^SV &t1V &&,0b &&u^SV &ub < wRX Z \ V &Z Z &w^>` 9^YZ &` b Ib ^6` &` V &&u^S V &t/>b ~v ^&P>b t V &ue b` ] *** USER-JOB ABORTED ***  TMP.000EXCEPTION 0000H: \lMSDOS-EXCEPTION $0001H: INVALID FUNCTION $0010H: BAD INVIROMENT $0011H: BAD FORMAT $0008H: NOT ENOUGH MEMORY $0002H: COMMAND.COM OR FILE NOT FOUND $COMMAND.COM SRI86M:CI: :CO: :BB: :LP: :WORK:0123456789 SRI86M \????????.???EXIT SUBMIT SEARCHALLNOSEARCH SEARCH86 MAXMEM MINMEM / ASSIGN SAVE LOAD STRIP PC NOPC PCD NOPCD SRI86M.INI SRI86M.EXI , Siemens Standard-Runtime-Interface SRI86M, V X104 SRI86M TERMINATED >:CI::CO::LP::BB:>>SUBMIT: MAXIMUM NESTING REACHED 86 RUNMEMORY = OFF ASSIGN.TBLA: :F0: 0/B: :F1: 1/C: :F2: 2/D: :F3: 3/E: :F4: 4/F: :F5: 5/G: :F6: 6/H: :F7: 7/I: :F8: 8/J: :F9: 9/K: L: M: N: O: P: LOGIC DEV. PHYSIC DEV.-----------------------NO ASSIGN !#&()       *PQR NO EXCEPTION SYNTAX ERROR NO MEMORY FILE EXISTS FILE DOES NOT EXIST UNSUPPORTED OPERATION ILLEGAL FILE-ACCESS ATTEMPT TO SHARE FILE DIRECTORY FULL ARGUMENT TOO LONG ILLEGAL CONTEXT CROSS VOLUME RENAME DOES NOT EXIST FILE NOT OPEN FILE ALREADY OPEN FILE IS READ ONLY FILE IS WRITE ONLY ILLEGAL PARAMETER ILLEGAL POINTER TOO MANY CONNECTIONS FUNCTION NOT SUPPORTED ILLEGAL FILE-NAME ILLEGAL OBJECT FILE ILLEGAL SYSTEM-CALL NO START-ADDRESS ILLEGAL RECORD ILLEGAL REGINT ILLEGAL HEADR-RECORD ILLEGAL ENDREC ILLEGAL MODEND ILLEGAL  RELOC-MODULE ILLEGAL ALIGN-TYPE ILLEGAL GROUP-DESCR. SEGIND/GRPIND = 0000 ILLEGAL FIXUPP NOT BASE/PTR-FIXUPP ILLEGAL TARGET-METHODE DIVIDE BY ZERO INT OVERFLOW INT 8087 ERROR I/O-ERROR CTRL-C RECEIVED SUBMIT: BAD CHARACTER SUBMIT: LINE TOO LONG SUBMIT: UNEXPECTED EOF UNKNOWN EXCEPTION 0123456789ABCDEFPATH=PFAD=.86 CSDMZ  EB/MSLIB (C) Version X001\ػ,&$3ۊp $GW !AJ!TL!L!UF3 uشH!s^&]UFI!^s&]U3 t$3Ɋ F~]x$$ ! ! !%3ɋي ٍp GUN^& t F!]U!]U !]UV!]U>t]øU/!V!O^ uNV '!P؋!Xr3] UVA!^s &<t'&]U>u]Ã>u P#K> uPP  >u P>uPP0PP]U;v{BPAPG P POP PP!#<v!*؊Ytyu &G &G|]U;w&GrA#Bw # FPAPZPP&t\(PP9>un>&uxP(PxB]U츔PdPOP#PPQ>uPPfPPSSPPpPP&SSPP5in]U^&t^&ar zw& _]U~*u2~?t*~.u"~ tF<0r>tH^ &>2@w6q.W_k^& ] >vs栆r/<s^&?>>tg^ &8.:s^&?>>u[r^&.>u]:w%r >vF^&UAA?2^&^S1^&>AP^S 68^&?t>6A>ȢF@N :<tj:&@6^YB6:F2?A(>돂>?u=^:&8Gu2&OB6&C&G/D&GA2?(>?F@N FN QP662P^S^&?t&68S^& 8]U^&0PS^&?u9>^SSP^& t6S^&cFrw~ ^YF N F N PPP(^&u&6S>^&]Frw~ ^YUF u >/ta>\tZ> rO>zwH>!tA<#r<&v6>(t/>)t(<+r<-v<;r<>v<[r<]v>`u]ð]Ur > uZnr 8t]ð]U6< t< t"<'w<8u/> t3:u:t]s#rs]6s]UF]UF(^&Ds^&]A:/MSDOS ?????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????? ??????????MSDOS Delete-Query, V1.0 (C)HOLZER *** ERROR: MISSING FILE-SPEC , BAD PATH- OR FILE-SPEC *** ERROR: CANNOT ALLOCATE MEMORY *** INTERNAL ERROR 0103H , PATH OR FILE DOES NOT EXIST , DELETE ? , WRITE PROTECTED DELETED NOT FOUND ACCESS DENIED !Lb#SRI86 EXE !UeDELETE EXE/!"*? \ COPYRIGHT (C) 1982, DIGITAL RESEARCH SID86 1. 07/12/82 ABCDSBSDCDSEIODITSZAPC CDESXXXX CANNOT CLOS INSUFFICIENT MEMOR NO SPAC MEMORY REQUEST DENIE NO FIL START EN VERIFY ERROR AT DISK WRITE ERROPASS SYMBOL BAD FILE NAM SYMBOL TABLE FUL SYMBOL LENGTH ERRO BAD HEX DIGIԠ*+عþ t<@v@ȿ &..&X%&[.м[t_uI;Tt &@Ps`<0r06am>bt\#y< t<;t<-u,Ar<w\].?G>uXo;UH añññ ñ ñ tbþUtbþA uþ(tþ#-z1u3pR5dZt*R6UZt ñ7Gtñ8=tþ9*;%@tþUFt]U]ú æ þ6G-O>.td=c< t< t<:u,@Oÿ <*uWQY_t 㰪I? Ë>G ?ù\ +щEù v +щEùQKYA rþȸ.!. þv#ø .#0t1þv4Xu-ùCC +s QYQ YA:Crþmþ\ Du wCC C s QYQYA:Cr..6't"5EWDtkWt &&`= .t ..t.t.t..t S.[0ulÀ uP.R:XIÊȳcجд t0SRPQ^[X Î_á.....JN&t&.J& t.+.õ  <&Dõ   >.J*aW[n<t .J.......6.>...&...F.F.F.Ȏ؎м[t.5&.u}.[t!.;u.;u  yQt uV^6( t6(|tL.&:t :.t"t79t.<t 6k:" u6(t/6P[PW&[Yuπ\+;tuýY >uW3_<:u>u]W_<:t݉û>u<:t<+u<-uS Y u>u>\uP+u -u+ËX<+t<-tâU^ )vDD],0*.V>XrD\Z u"V.X.;s0... u.0\ÌN4\ <t;=V4ء?A+rPX\atu u8\422\.Xr2u4d\ P'tR5\>t?b"8\8X< uġP+)V^[b uG"<t4mtr*غRSrJuSBu[ðþ^6SXPXt> s/pu[ &þI@"&u#t+t6u":duW̵_uÀ>uMúL+HËbrb \bbË;s 6&þ6k< t< t < t< t< t/l&$? tȵ&VQ_Y^VN^U^Ft ]"t:&$? t't t:u&;\t ȵ΃ԉ6t U.]á6&$?ȵ&QVm^Y`? tE> &$? t3Wȵ:u 6`t__&E^> t%&H< u6J6H";HvH&LP< tW+LrQNTPRR< u;6L&6R&:tL%RLL9PrRt%=&PX#\N`t]u$<,Nu V< t;sF>>?6Dr+:t ;v6&1t;u;wCMDSYMH< tm<*uC\StP2d\J\4^ESZ\|c.ع0X< tZVÿe= uL(P]u u%P+Lr>L L.r L;Pvm ..\< t'  P X< tv< u .. e< u _< tsSW< uXPSPe+!oX-B[XPS+ñ*7[XPSPX/%[X tR6(X)Q#XSXPs #XP2XPr u'XP'[<t.6\G< ulD+s< tA&>^Eu\.&'tТ%\J!< !Jt *< u %& #>;>#wLW[S<t >: _!RLtRt L;Pv..Dt ;u;TtIþQVDt^YþDË>RT|t;uX.}= sOXV6u6uV,0*,NJ*^R*< u ТDL< u|,>L46L|*< tG<.u < tA<"u]u?< t's< u']u u s s>LL"&Ի9'7\t< u t7R&ʠ^*]>.@RTPXP]X>ht<rá,=*;0A.?< tC\t7< u >^Ru, J=;< t=A?< u \*`u`u xPLxXumE\;< uDPDXDâG < tu&G g< u`*E02E(<.u < tr< u) tEÀuJ uN;E>E r LABELS@ VARIABLESNUMBERSUL.F8L.wL.ƊN^:uL.uڰ]U,P]U^?$t 7F]U~ v F, AF0P]UFPF$P]UvM.sFPPHM.]UFPFP]UvM.s v6K.M.]U)PD,&7r,]U,&P"A.&GP>.XP$?.X$@.XP$E.F.X$B.C.D.]UE.s))P]UFF,7r,@,7d]U^.Pv]UN.Pv]UE.svv]UvP)PsL.v.|,&Gv]Uv+Pv]UE.sPz]ðPa]Un.Pv)]U,&7>,]U,&7g,]UE.s]]U,&s & ,&P%,]U,&,>.u 6@.i]|,&OI.s>@.u >>. u]À>>.u,>@.u ,&?t,&|,&GP,>>.u,&|,&GP ,6)&@..$P PP$P####$ $$$6)]UB.s6?.,P],P6?.h]Uz.z.˷G.:8.rz.z.S^G.*8.&z.p,,{.>{.w${.:z.w,7H, P<{.u,]U]U,& u s,]J.]U`6A.]U,&"|.A6|.]U2]U']U]U]U ]U3P]U,&,,:Py6,K]U]UB.s _v]qN]UB.s nS]Ncs]Uu=R]UdB.sP7],P]U;I.D.sPg]ð1P]UA.?.,&$E.6?.Y ]UP46A.*]UI.]UE.>?.vJ.]B.s6?.{vx]sk6?.f]Uy^Vf]U>>.uJ.]Z6?.35]U>>.uJ.]7I.F]U!A. ?.P8]UI.>C.u >E.u]]UI.]UJ.I.~>H.u(G.㋇)z,?.Ƌz,G.@H.>H.w H..p(J.D?:50++1&7!=CIR tz{vql g2bE]VXSNID?:''''''(( (((( (%(*(/(4(9(>(C(H(M(R(W(\(a((f(k(J.sO]UF|,~,&,,~,&O|,&O|,&O}.M.K.,&Êp*G.q*H.}.s%QP)Ps L. |,&G&}.봀>H.uH.=6G. P)Ps |,&O@6G.P)Ps |,&O >E.t |,&OM.si,]Qj$klmnqrvwxy[]??= $WORD $BYTE $K 68Wj)** *0*@*P*`* HOPHOHODE@AIJGDE@AIJGf=;:SR##Qj)Wa    a?  a    a?H H H H HHa?     O O O O OOP P P P PPK     ########aaaaaaaa????????0+ 3& 21/(f f h h 9 9 9 9 979?<hhhhhhhj gs`e]9 9 9 9 qrklffxymnvw9999999999999999C C8699d d$ $TU i!!!!!!!!zo_V>>Q)W X>>^tB"LNM,,s--'.INJAJBJCJEJGJLJOJPJSJZORAAAAADAAMAASADCADDANDCBWCLCCLDCLICMCCMPCS:CWDDAADASDECDIVDS:ES:ESCHLTINCINTJAEJBEJGEJLEJMPJNAJNBJNCJNEJNGJNLJNOJNPJNSJNZJPEJPOLDSLEALESMOVMULNEGNOPNOTOUTPOPRCLRCRREPRETROLRORSALSARSBBSHLSHRSS:STCSTDSTISUBXORCALLIDIVIMULINTOIRETJCXZJMPFJMPSJNAEJNBEJNGEJNLELAHFLOCKLOOPPOPFPUSHREPEREPZRETFSAHFTESTWAITXCHGXLATCALLFCMPSBCMPSWLODSBLODSWLOOPELOOPZMOVSBMOVSWPUSHFREPNEREPNZSCASBSCASWSTOSBSTOSWLOOPNELOOPNZ E QjzAXCXDXBXSPBPSIDIALCLDLBLAHCHDHBHESCSSSDS>BuBP]Á7t7 U P P]U^B]U?P]UAP]U~B"kBBwBA:FuBu]UF,0< v@NAPv@Y ]UF,0< vF,A ]UBBB>^Bu^BBƊ^BBBB<@r6^BQs,>Bu ]B^B]BBs]B]]B]àBs6^BAsBR6^BRY BBq]UO>B t>B t]]U>Bu0BF8Bw B^;u B^ FBuհ]UAPPAGP]UAPPAGP]Un.PPAP~s AG]ð]U^.PPAGPUs1AGAG AuGAGAG ]ð]UN.PPAGPs1AGAG AuGAGAG ]ð]U>]Bu0>BBYu AG >BWOuAG A t]ð]UP>^B:t@Y"]UFBBB]U젉BsA &PBzAG]U>]Bu>B uAG ]s8sA tZËAG G ]]UAG s? B:AuAG *FAG?>B+u *FAG *FAGs B:At]U6BAPAsA^BAAG]UAGAGAGAGAGAG AG AG AG AG AG s]Ps]os]s]àB:AuAN.PPAGPs\5^B:AtAGAG ]>^B:uAAGAG ]à^B:AuPa]ËAG]UA_Bf>B,t]UArBAG s]>>B t\]UBBr-B=w%Ê?:Bu劏?B?B?B]]UB,<vB㋇p,BBB3.8Bw<BPBP6B sBB8.B]àBBBu]UBBBB >B t>B.u]}sPs>>BuBsNB>BuBs6B6BK랰]!]U6AvA]UBBȢBBtBP]>Bv BPM]UFAÊO s$ u\FA G BFBv-]UxB"}BsFBFBrBPV]U>mBw `BBrB~BBsBB_BP!]U ]U>mBw jBsB]U졃BPkBs BPr]U졃BPfB$<u BPT]U>kBu >BvZ>kBu>BrkB]R]UT]U|_BPnr]U>Bw F ~BF kBB]UyB"gB]UyB"jB]U}B"jBP>mBw@P>Bw@Y"Y"]U.{Bs]]U{Bs Pl]]UA~B+ȁwyBsA@B+Q5]M]UjBs=>sBuxBsB>Bt@"yBs6B6B_BP]]Uq6B6BrBP~]U?W>Bv}B"dBs]]U5wBsBÊB sBP]ðPBBrBP]UvBsBrB BRwBsBÊ B sBPr]àB B B]U]U>rBu vBs]]U^vs BTs>B~ u.c&>kBu>Br>BrB_BPvs]U P]U Pz]UyBs"BBAB+Q]ðPBB]U>Bw%yBs>BuPC]ðP;BP]]UZr>pB@s&}B"fBspBPBX$BrBP]]UArB{Bs B P]àyBs 6B]]UgBsz>sBuwBsB>BwyBsBIB B kBPU>`BudBsB>pBwfBsBzBsB B ~BP>BupBP]UL|Bs BB6B6B]ðPBBk]Us B;]s B;]s PAZ]R]UgB"kB"wBs sBP_]Js P ]]Us}B"cBxB"sB_BBrB >mBtvB"jBsBrBB_BP]À>Bu}B"gBskB B6B!>mBuzB"jBs~B B6pB]s'>mBwkB `BP]B!]js Bz]9]UFAA 6A:P6A PA_Bfr>BvB.?%7 Ozup$k*f0ao\WR MVHC>19f4X/M?R?W?\?a?f?k?p?u?z?????????????>A] 7   ?   Q j 8kl'/! "RS#$ TUw%sr&vrVt'}|(~) WX*vYr+sZw,s-u.~[|/}\0q1{2y3upz4z5{ x t]678^mn_oz{p9qr:;<= >?`as@ABbtucCdDEeFGH vwIJLMNxyO (fghiP 0BXBPSIDI,:+ [] ambiguous operand$H@XP Vers 2.10 P0!= s n ! X5 u'5 6 u 6 Sx[d t>>5 u5 r p 6n | ;| &d r p +~ I36l ؋36l +Al &n ;t .x sz CDSQR 7s  7ZY[À>6 ud t>5 u5 Ds d tsr p  !=s- [S3؋ וNI( ZtPZրt"̀0*Ѵ!''r      6n t@P36l X t+l &n p r ô !À> uB r * !A+úmú> tø ! !Ê7 2!tW JGO?덠 > e !t n l sBt 3ʋ>  !i7 A1 1 ;!7   !d tH7 > > ! u&? >? [u? A@ >@ [u@ AA ? ??A ?!d uQVW7  ! t62   󥤺 ! tW뫺 !__^YTsC  = ?  ;v.C 6? 3 r3ҋʸB!  C 6 ǎ r ;tۋ ;v+C + 31 r3ҋʸB!  륀C 6 ǎ r ;t ;v,C + 3 \r3ҋʸB!  PC 6 ǎ 5< 6 ,sÉA C u6 lj69 >; sr 6 ǎ A    6 rA C u2 C u  Br"6 lj69 >; r 6 ǎ A   6 osÉA C u2 C u  r"6 lj69 >; r 6 ǎ 'A   ?>C *t s Ë7!2ҾD \FG!d tD ;!:u !A 69 >; ^ sF;Fu;Fuá= F :u !xcr^VRB!Zv+WV^_;? v 6? 369 >; = s 3ҋʸB!FV O= !sã > t9 t > !ߣ 6 >   = !sף h> t9 t > !븣 6 >   = !r٣ ,> t9 t > !뺣 6 >   øB3ɋ!  PB3ɋ!W!XPRU?]ZXU@]3ҋ!rS;uM_E!r?;u9KQ3 t+ʋ!r!;u.+ȋ!r ;uYQYùùRPŽXZ:/X:\IO.SYSX:\MSDOS.SYSX:\COMMAND.COM ???????????AAAFFFFFFORP !$r ut~6x >z utt v +x z +p r hIncorrect DOS version $Insert new diskette for drive x: and strike any key when ready$Press any key to begin formatting x: $System transferred $Format another (Y/N)?$ $Invalid characters in volume label $Invalid drive specification$Invalid parameter$Re-insert diskette for drive x: and strike any key when ready$Insert DOS disk in drive x: and strike any key when ready$Format failure $Disk unsuitable for system disk $Track 0 bad - disk unusable $Insufficient memory for system transfer $ bytes total disk space $ bytes used by system $ bytes in bad sectors $ bytes available on disk $Volume label (11 characters, ENTER for none)? $OVSVE & uN7 &&:|Wu\jt6b\u0z`غ?$FH=cuN~E3Ҵ!%X8tYËFw>FF fFPF FH3vZ£F &E&=G>K&}&E&EM$<} &E6F&IL*QHNQE83TJN QTYJTYt Y HYIItQWVU]^_Y^t  u7 N3ҿE[4s7 N3ҿV8[rEV8FfuϺË>K&}M&EÎ &I&KH ,& <ù(*ÊL*NùIHJ ù @N L *NùùNðNðIHJF2 tMDg( M]P26 (]P26 P]P26YF<D$:uRQWVUI]^_YZ7 [V8~r.V8Nu F uDD;N|Á&uDFFF7 N > [rN uP &>&&2~ 3B&&Vf2 t&s π&X2S[t S[S[u;&&8~!tǀt& &&It&Pd tP $ a: $ <== cr selects this$ Enter letter for desired value: $SP Ad_RMXP;u?CC ;ں%/ !>t$_u: 8t >ur6t뷺+2&>G+ǹ 3M.>tu# Mttuu#+ 2utzt .>2ut & +3ô/! utu>.t:ô[! Ë6<u-P2G@t 6@ֹ).< u Nֹ2<uû@!ú;!ð 76F t<.u??7 Ë>>< t< t.< t>22>>t G>ô;!!\?????????????????????? Kein Unterverzeichnis vorhanden Ungltiger Pfad  AUFLISTUNG DES VERZEICHNISPFADS FR: Pfad: Unterverzeichnisse: Dateien: Keine Ungltige Laufwerkangabe  Ungltiger Parameter  Falsche DOS-Version $ \P0!<t k ! X5 u I !7!<t=$_] tQ8]ts!Ċ>\ tNJȈ&&&,&{Դ2!A2!3PP  !\! u]3vs$F;t@>;>us@ t#sP6F tq^F3U]뚀u] PMÀ>st?>MJJ U ú$8!L   VС$ tHt0<r64uR, Zy]R Z R/ZËR%H1{uo jZËRй'ZËRQYZËR Ƽ|Zò ^ >5u r 0pt u >1?"0>5uù3''r&2US3؋ ו>u * ZK]PZրt"̀0*р>t0|!ì!5 u  !À>tR' lZðq<u S Jù< t< t.Ī< t2>Eά uN;tu} W G3SU]U=u0Y P 3F3X>t >t][XhP>u T SUu]U=u7d P 3F3X>t][X][X>t!>u Sqe_mAqU,;&"w+>t>u +SW,Zڴ!~t t|Y tDuVW^LJD";FtVW^FD".D$ uD& tVW^3D$D& Ӵ! td uDuVTn^LVD";FtTT^FD"D$ uD& tVT2^3D$D&Ӵ! t+~tT;!s>t S2M]DuK>t부>t>S[DuDt }y{w>tuw>t dM6qSt"vWZ;!r[q>uXXXXR+^h!>uo>uuUSGW ^Vt"^[]D$T&mދw"uS.[srtr>%3ɋw"r;6wS[t7u7$S[AsLr;6vQWX^S[Y*t>tV<9^SQ3Y[GuE>u>>u72&P+G$W&r uZ;rRZQw$&M)Y t5RZ3w"w$w&닺$uۃ&uyD9ttDV% Pt XË6FF u"~tu D DB֋6 tZu6FFt R3BZB3P`>uXF>uaË6FFtZuVVQRN s;Wr;6w ;tu ^Āt %_ u _ZY^B>M 6FFVW3PQRV^=t=ua>tBuPRS !,! u]- P35GGWT_«[ZXZYX_^J tVWZYX@ XX)ywPGttf6>t^6O2OW.!Dȴ1QRQWP&oXs!mXPXY_ZY:!ut !;!>su6!VSQ6Y[^66>tUSVVG^ a^[]6>]rB3ҋ t<62 RPRS%oX[ZXst_R>Uϰp u>uRZ>uuËW^V@:6|t6Rm t`^<tRO tEúSN! .6.6.6<u .$%!.#%!sK QPRS&oX[ZXYsd tþ_dPSQRWo< v 2狕iq !PX }t=C6}30>utw='6u3>yt{= 6y3g t=>uH63 tu+w+{+++++º??????????????????????FILE0000CHK-/.... .. / $Incorrect DOS version $Invalid drive specification$ Invalid parameter $ Invalid sub-directory entry. $ Entry has a bad $ link$ attribute$ size$Cannot CHDIR to $ tree past this point not processed. $Cannot CHDIR to root $Processing cannot continue. $File allocation table bad drive A. $Insufficient memory. $Invalid current directory. $read$writ$ error $ing drive A $Abort, Retry, Ignore? $Write protect$Bad unit$Not ready$Bad command$Data$Bad call format$Seek$Non-DOS disk$Sector not found$No paper$Write fault$Read fault$Disk$ Does not exist. $ First cluster number is invalid, entry truncated. $ Directory is totally empty, no . or .. $ Allocation error, size adjusted. $ Cannot recover . entry, processing continued. $ Cannot recover .. entry, $Volume created $aJanFebMarAprMayJunJulAugSepOctNovDecDisk error reading FAT $Disk error writing FAT $ Has invalid cluster, file truncated. $ Is cross linked on cluster $ lost clusters found in $ chains. $Convert lost chains to files $ recovered files $ bytes total disk space $ bytes in $ bytes would be in $ user files $ bytes in bad sectors $ hidden files $ directories $ bytes available on disk $ bytes total memory $ bytes free $ Contains $ non-contiguous blocks. $All specified file(s) are contiguous. $ $Probable non-DOS disk. Continue $(Y/N)? $ Unrecoverable error in directory. Convert directory to file $ Errors found, F parameter not specified. Corrections will not be written to disk. $Directory $ CHDIR .. failed, trying alternate method. $ bytes disk space freed. $ bytes disk space would be freed. $Insufficient room in root directory. Erase files in root and repeat CHKDSK. $ File not found. $DTE EXE !oSID86 EXE !tCFORMAT COM !V7TREE COM !SETUP COM !MCHKDSK COM9!AUTOEXECBATusfrgritspukH ]\\!<tX|\!P\!X<t<u;< t-  9u  +ɋъAU(<-t%u>u6=t=u6+! =tVÊ<!àò ! !=P|=c l=| =3,!.6K<:o: !<tHs>u==;=;~.6-!=tfQRS 0 ;|+0RAu=0 uPAZQ!Y[ZY u9RRSV U,0PPRXP&TP^[ZRCurrent date (DD-MM-YY): $Date du jour est (JJ-MM-AA): $Datum ist: (TT-MM-JJ): $Immettere la data odierna (GG-MM-AA): $Fecha en curso (DD-MM-AA): $Enter new date $Entrez la nouvelle date: $Neues Datum eingeben: $Modifica della data $Entrar nueva fecha $Current time: $Il est maintenant: $Zeit ist: $Immettere l'ora: $Hora en curso: $Enter new time $Entrez la nouvelle heure: $Neue Zeit eingeben: $Modifica dell'ora $Entrar nueva hora $Incorrect $Non valide $Ungltig $Dati non validi $No vlida $(DUp0FZnzSRP&ہð !XZ[ COM;!iVers 1.20~ !ú !´2!G@O IG O_ÊEXE2BIN EXE !)qSORT EXE !+`FC EXE !- PETER EXE !0@1ATTRIB EXE !=;CP EXE !Lb#SRI86 EXE !UeDELETE EXE !oSID86 EXE !tCFORMAT COM !V7TREE COM !SETUP COM !MCHKDSK COM !DTOD COM !DISKCOPYCOM !CONFIG SYSA! ..PSQRWU.&.Ȏи%.Gg OWG2< w $ .G.&.]_ZY[X^V :Gthh.G.GO2롋 Î3ы.Wk@ @EP36 u@&EX+ƊU23&sB6 t@E OwGع< u< 32,0|< җ.&rrƗ< t< t 7  uw^E&tjx !p#f%P'1)*|,c.e0F204)68 9y;]=*>wڪ DQALLOCATEDQATTACHDQCHANGEEXTENSIONDQCHANGEACCESSDQCLOSEDQCREATE DQDECODETIMEDQDECODEEXCEPTIONDQDELETEDQDETACHDQEXIT DQFILEINFODQFREE DQGETARGUMENTDQGETCONNECTIONSTATUSDQGETEXCEPTIONHANDLER DQGETSIZE DQGETSYSTEMID DQGETTIMEDQOPEN DQOVERLAYDQREADDQRENAMEDQRESERVEIOMEMORYDQSEEK DQSPECIALDQSWITCHBUFFERDQTRAPCCDQTRAPEXCEPTION DQTRUNCATEDQWRITE SYSTEMSTACKGETTABLE GETKEYTABSORT EXE !+`FC EXE !- PETER EXE !0@1ATTRIB EXE !=;CP EXE !Lb#SRI86 EXE !UeDELETE EXE !oSID86 EXE !tCFORMAT COM !V7TREE COM !SETUP COM !MCHKDSK COM !DTOD COM !DISKCOPYCOM !CONFIG SYS :!GDEVMM SYS !CIO SYS !DEVDMDSKBIN !PLM86 LIB H!COMPAC LIBI!n"AEDIT4ESTACKMEMORYCODEDATACONSTDGROUPCGROUP??SEGLQ_PLM86_LIB_CODEߘ Z  A$A$  ;  ee  ĖKp@PLM86 V2.311/11/11 12:51:5er[ Aedit V2.0 VOAgain Block Calc Delete Execute Find -find --more--OGet Hex Insert Jump Kill_wnd Macro Other --more--OParagraph Quit Replace ?replace Set Tag View --more--OWindow Xchange --more--r]V1 UUU"U&U*U8Ur U>r U>r rw=lr&-kGYr xrrr, ????????? ?? ?????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????rr.Nr&= 0:::-AB9Dn9FJP:rtrr  -!!- vrg rrr O ?r,Xu- ;Cr-6r ^r-%e%eCbGbINdLudS*e bad __ valuesrWM*?++Pr*A3qBCqCSqDkqE{qG{rHrIrKrLrMsNuRuSCvTvVwOAutonl Bak_file Case Display E_delimit Go Highbit --more--OIndent K_token Leftcol Margin Notab Radix Showfind --more--OTabs Viewrow --more--rZrtr rYry.r."3379,-23IrKPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPr+d 8r60123456789ABCDEFL:CI::CO::WORK:rer &9rF rr- 4r~rrmr5/rrrrxr) :rf r r r!ErZ!r!r!r_"r="illegal exponential operationunbalanced parenthesisexpression too complexdivide by zero errorillegal expressionmod by zero errorunrecognized identifierinvalid numeric constantnumeric constant too largeinvalid base characterfloating point not allowedstring is too long assignment to read only variabler@$r&Copyright 1983, 1984 Intel CorporationGYk  -?ABJ;CpDJ;EeFG* to re-edit ([y] or n) (y or [n])  Find Replace Tk Cs Sh } "" with "UCDCLCRCHCFXRBZXXXAXUXBREXSXNXHXGIUMDMLMRMHMBMRESELEKELICAOALDVRVNKB????????? ?? ??????????????????ABCH JEK KY LPL@  JEK  SERKW`?Y W?`LL OPOS [    #insufficient configuration commands??? ?Z  SERIES-III$cannot save in memory - save anyway? Output file: OBuffer Delete Find -find Jump Put Input file: Other View Forward Macro hit space to continue *** ERROR: illegal command overwrite existing file?some text lost bad command bad hex value no such macrono more room for macros3macro creation is forbidden while executing a macro Macros: error in line : missing '*\' bad '\' code missing '=' missing ';'ASM;DVBORWXFDICHSTZAVAWAX bad AF typeADAIACS3S3ES3ETS4VT100ANSIAHASATAZ no macro namemacro nesting too deep Macro name: Macro file: Control C to stop\NL\EM\MMOCreate Get Insert List Save illegal set commandDHOBA OAlpha Binary Decimal Hex Octal DecimalHex Octal Binary Alpha Insert automatically?Create .BAK files?Consider case of Find target?Display macro execution?Delimiter set: )Continue macro execution after a failure?#Display parity-on characters as is?&Automatically indent during insertion?Find only token strings? Left column: bad Leftcol ,  , Indent,Left,Right: bad marginsbad indentleftright margin: Insert blanks for tabs?Current radix: illegal radixList lines on multiple finds?Tabs: bad tabsRow for View: bad View rowinsufficient memoryillegal invocationmacro buffer too largemacro buffer too smallconflicting controls TOVOFOMRBARC MS _DB_NOMRVIEWONLY FORWARDONLYMACRONOMACROBATCHRECOVER MACROSIZENOVO NOVIEWONLYNOFO NOFORWARDONLY NORC NORECOVER NOBA NOBATCHtext does not fit , NEAR: ":BB:MACBAK no input fileEditing  which has lost text to all changes lost?OAbort Init OAbort Exit Init Update Write OAbort Init Write Output file:  has been written TO  VO FO"enter [file [TO file | VO | FO]]: no such macroOFill Justify  insufficient terminal capabilitywindow too small found:  replaced: not found: "ok to replace?6[6667O7778C8888794#5,invalid variable name0123456789WGPMTREIOB)I +,9 9COL ROW LSTFNDINOTHRISDEL ISWHTECURCH UPCH LOWCH CURWD NXTCH NXTWD CURPOSTAGA TAGB TAGC TAGD EOF BOF DATE TIME IMARGNLMARGNRMARGNNSTLVLCNTFNDCNTREPCNTMACCNTEXENXTTABSL0 SL1 SL2 SL3 SL4 SL5 SL6 SL7 SL8 SL9 SLB SLI SLO SLW SLG SLP SLM SLT SLR SLE ROLRORSHLSHRSALSARblock buffer too large for SB  missing string terminatorCalc:   r!Us2舗2-12,u$1,u!1 u+Jt161u31<t,1uJ`61`s@B.U>1Hu]À>1Pu]蘡]UPjx"薖]rvU@r.U2]UF]UFNFPN]U>.t"3I!,>.1P菎]UZ^&Z&WFZ\]UZ tbd&Z\O^;`s,+P.P` f>.ut^PPD]Rbd t &wb]U^&G&W >T >Ru^&G &WFVXRT0Vhj^&G Z&WFh&GZ&W VX]UFV^;u$:u^&G VXFR^;u$:u^&GRT^&Gln t^&O F&O Z&WY^&G ln t^&OF&OZ&W Y]U>. u_q3r(PsPPtsDPhs8&PXs(PLsP@sP4s]à؍pw.PnFGp]UF؀u F]UF؍r?u%3P.P"rGrrr?u&rwPP.Prr]UF؍xF^&G^&&Wx  u.^&G&WFxG G xGGxGG?xGtv^&GZ&WFt&Z&WxGWxGWxGxG^S]UF؍Gz| tY&DGGGG~ tظ&&WЋG W OOzSz]rUF؍G u\v!G+PwSR6.Pa2wGP6+.PMG&G G  tظ&G&WЋGWG^;u$:uGGS]͜>TriUbCF؍^u?tw.Pe^^G FFF t &NF^Sb^SRFѸЋ^G W ^GW^GW^G^G^G^G]UQF؍^FG^F^G]UF؍^G;Gw"w^S6+.PFw^GD^GFF t2&GG^G+1^w^F]rlU AF؍^tI^G;GvvFs#GFF t &DGG^O v^FF Fu+1^w^FFr^Sv7^u@Fȱ؋H+PFV+QW_Y^GH+PFV^wPFVRv.P+^w^S6+.PFFr ^O^O^O] TTEr U @F؍^ts^G;Gvvv^FSU^u:v*^GH+PFV^wSRv.Pm>^O^O^O]G`Trv U?F؍^tL^G t-+PFV^wSRv.P^GGG^GG]6Tr UQ?F؍^t<^tvA^wPPP.Pp^G GG^G]UF؍GGGGG]r U ?F؍F^^F t"+1vv^S n^uSv^G+PFV^wSRv.P^w^S6+.P^G^G^G]{lTrf Uw)ظЉ u͸УZ\VXRT]_W_W_W _W_W _W_W_WUF;FrF]UF;FwF]U,+,,+,]Uv~N]UFPv؊P]U^^:u)^ãFF;wNAN؊:tFuݰ]Ur7 F<v  ~v^0F;vN ~sF ""Fu+JtF tCHFV NߊFV NFV 붋F>uHN1ڊ1Ɋ.DJ`x.FV t@HV~ "ڊ؈F##>F~ 붃>"u !Ƈ0"+E"+!؊و țTȼTr+&ڃ>}]U졞@;ؠ]UFNɈ]UFFȢ]U:sF]U^F>t^7F]UvvPv5P]UF]U< t< u]U:Ft]|ryLU^<0rK<9wG,0< v3 Pף t ^]2GTrIU^t8FuGF۰]U>.? u]/:w>.? uT9,tAQ5@Y"sD@,;>.u,I>.ـ? >.H>.؀? t@;,t>.뗋>.? u1>.룋>.? uK>.? t C;,t>.z]U-q3:r3u/]U0㋇@.;,wLJ@.]UP\/:0u0,@.P>]U젎cs ؊F)]U,,]U,>.>.;s 7>.ꠎ>.>.9,v 7>.]U젏s/㋇@.>.y6/{3;v),,ߠ;sH,I,؊)و]U6.PD|]U /㋇@.;,s, v]U/㋇B.,,;rI,{L/㋇@.;,s,u,>.c/13]Us-,? t,? uC,? u,,̡,9,rH,Y\u]U,;>.u,>.>.]U,F,]U P P]U1r,H>.>.< t< u>.>.H>.؁? u@>.,A+ȉ;r+>.6,>. >uP6,P|>.3< t< u>.,,>.:]Us6/y,蟂]Uf.8w]U;r,>.#w]U~t#>u>(t10*~0&..>u t(. tP_z>.@;,uP6,P{>.4~0,9@.w09@.w!/*~0P6,PL{V6|`>u/㋇@.E>uA/㋇B.>.؀? t@>.؀? t>.,;>.v>.,;>.wH>.uF,.rz/11sQ. t*/11s`. tjPIy>.@;,uP6,Poz>.>.H ؀? u;61s/*. t#PPCy1s. tPPAx]Uq]U>tPPxT>t)PPxȢ,I,؊و$/㋇@.;,u,@.P]Ê/㋇@.;,u ,;.u@.]Ut`]U6. x1s,< t< u PP_w]U1]U>.u]à1r>. v P)]u6/gv]Uc6/Uv]UQ6/Cv]U?6/1v]UFuү2yt]à2]U. 1s Z[>1At PR[Z[<t[Iu >,u[>[It/^;PP<u]ø2PPr P']o6^at_\\82r؀2 u_\u^_:0r%>_t^0*^B.2P6,2P2,]À>[Ot)P6,m,>.  u WP]3PQPkGP\\:]wm>.[< u 9,wF6s>[|u,H;>.w6r ] 1>. P@[v3/[v3\u43Pn&4]) t < t 2>s3t2)P?m]W'1HU1fmfs6/r,H, PQ{NP((``uD̠``u;i6`su>`th6/-r>`uH61P薍؀?tdd8rj8 u[d0Adun>`uA藌؀?tcdd8rm8 ud0duf>`u0iP h>iu< u6ht>iumPNl]6`PkskQ6`s6`}Cs9 4fs>u,H, PSP`< t< uz$/eb>` u/e1ba3:bs1re,H>.` uB uA"шas/؊gg< t< t < t >.H>.>.? u,H>.>.@>.;,u,>.P6,kjm,,< t< t,jPqjasC>` u/1s(ce1:cr , ,cu ,`,x`1&]UXP=j1J2P>jSu]À>jEu]àjjLuWPP<u]Ê2Ƈ2 kP. uAk"Q PY"s{.wHPTp]À>jPuhPPK<u]Ê2Ƈ2 kPy.=vAk"Q PAY"s./P6,P2q>.]øP"]àj<t mue@6mP6mWY s Pm16/m>muM61P7؀?tKqoo8rK8 uo0ouK>muF3؀?tQqoo8r^8 uo0ou:>mu;tPs>tu%]Â>tuq>s u_6sq6mPue6mgs6m?sMH>m u1s/1m nn;w 6mnu>mu]U>du  P,< t$< t C;,s6,F6,F< t< u qr ,F,|-rr<wD؋Z-;,u.l-,;r";,s;,vJl-r,l-ruq3:r3t|-]U~0LJ@.]UF>s3t]&>u$:r*$:u>u s&1s 6csrؠzxx;szO:uq#: #< zS: ^< [6zVtvD^##;u;u>xt=x5z:uzxtdsT%+p3s64s"]à]UF<NwB € uA"]Ux P>wOE:u ^/6_ u P#6A> tA s6|u]U\Prv3av3Q]U//3PQPP/>s3u;vJFs  P73PYs 66C63WC4P166C6U<tNs Yt@]Us3s3p3p344NsYvv"4p3s3]Us3s344N Pt6N B"$"4P[4s3J-s]UrKP PX3<s8u>t]À>u LA8u]2(u P PP[~~?u%~8r0u>u6 P2.)5))))*h*****x++++tF2*Ȉ2W)WPd2P2P2*ôPJ㠮2>u'2*â2Q)WP2>t° P P22W)WP2Ƈ) Ƈ* ]à82v{2WPPs2Ȋ*2ٷ2Q2Q*ôPXzt2WPPgs. M82v2WPP6s >u2>tu< t 6\Ԁ>u 2:s,'P8u]Â>u 6]6]U젏<;s?2;s52;t+ȋ؍22NOF2]r/,U.112/u2t<r8.12<0s<9v>2t.82rz؊20r9w}<v4. P׃0 t 2.u>2t.0<0<166u=]ȺTrH$.-U3PQP/211PsvI1>1Qt611uD1,<s8 ^s3tO83v3n3!s'~3P8rk؊2 u2WPPQs01> u#6> tA s댠N;v6;]UR^<8vv2PvFPݸ3PQP8PbFPg32PZ<t<u"P=>us2>2urf 4PdF:uP32P<t<u"PߊF< tuF]Uvv]Uvv2< t< u2:r߀>t:2t 2Pvbܠ]UFPPހ>1Fuu3s-P޸ ?81uP޸ P ߰{Pޠ1s Pޠ1r Pޠ1s PފFz uN P޸4PFP۸#5PmP۰FPFP:tV2PFP۠12PmP5ۀlureFP4PۍmP#5P۰]UFfȰ~ FH;r*v ~ FF ^@Fu]U>u83u P觐361<t<u`]U절3s]Â><t1>At*>Ft#>Kt>Pt>Ut>t>0u P7]UPPPt P<PPP P, PP P٠1r000000]UPPPL P<PPPm P PP P]٠1r000000]UPPP P"<PPP P, PP Pؠ1r000000]U<WWP P]U3rYtQ>)u>3ub)Y'PmP臎u<s].PN PyU1@P]UPPP P%<PPP9 P, PP Pנ1r000000]U ! ! n }]U3P.P膎3P Ps+]øP2P.P֎>.u >2u]!]U절3r PD]U~0㋇@.;,s@0;s߉1㋇@.;,v㋇@.->1Prd/;v&9,v< u 1͡/-t;w)O9v 11d664,>.]U, t3r4s^/ɵ~ u+JVV;,u,FыF;,r*kulP6,Qp,FPQ랋^? uFF;,u-t^G!^7F< tA< t=8/t4:vӠ t[1>t8/t/:vޠu^,R> t&/:u/u>-uO8/u/8<0v&!&]UX/%t%@P&P6,aM%111Du >,u161%Pu,%r2s][/&/&@P16&6&.@POU1s]Ê/㋇@.6/]R/ & P8P<uIՂ>2t9u &6. &;s &. &0* &:v];sV:sR<t<u> &s@ &>.;utȴPQ &@.6- &P0>.td>2u]6,+,WPQ}.С,+.>2ux>u,,+ &㉇@..]U젠4'4 P'4]U>s3t4s>1t>1uF'F']U>1t>1u']à']UFdu>it|)/Ƈ<0F@ &>t9؁ u? tv t+J&u ފ&^&؉ &^+ȋ &t3s4s->3t>3u /P謃3& P轃6 &ȃ^/>3tS/<0[:v]t3sf4r_jt3s4s">3to>3u /PB3vi^/>3tS/<0[:v%t3s4s P^* P/P3 & u? uv/<0ui>stb^> & t+J&u&^&؉ &^+ȋ &6&6/Q*6 &^/!v^/S/<0[:v"'^'<0']U^(>u'<'P&(Ȋ':v*Ј(F@P&&@P(Pˠ(&]U>s3t 4r&q3s P>,u Pq,<t<u P_p3s PQ(^(8r0(^(uv >u>&&Pr'!3s^?v(?&Pr60&P&PKve&P˸&P&PʰP]U2PPe&]U/(/(>s3t4sv6(6(w(]U젠4 (43sv((s!v P P$Yt3s$vs[>s3t(K( ((: (rd t u (uߠ(s < t@( (4]Ub63P.U P$vEBP菀]U P ]U PPk]U<u]U<u]UPB&'P'PPPK]U>s3u 'PX'PI60Y'>Zt# a$60C'W$'&]U/ (/ (60 '4$60'*$&'6 (6 (&]U절3r6>s3t4s60v'PHv'Pȋ^?tSX'P]U/(/ (v6(6 (N&]Ue&PNQ61Y >X'< sX'P]U절3s]à4(4t3s2@t3s3(s3&PER/(s3 Pu(4]U]UQQ>3u>u 3P}t>uF3^;r3t}Fuء. u=wAF3^;r6.3PP.P.t t uFujF.Q3*QƈFFtD6.^3QP.P~ t uFF6.3P3P.P~3]U젠3=u33؊F3]U^P(>P(tF@F7P(]U P]U절3rt3s4r>s3uv]UFT(S(F/t3s4r >s3t0Q(0:vQ(^?u1r*>t#/:Q(ur/R(#v6R(#~t:^?u">tS(>t U!r P^7FNFT(/S(s/s(/:Q(ur/R(^#FT(P6R('#]UF:X)uF]UU)V)U(22]U>3t.83u P {3>3t>4t2s2]à:t<tN(rQ.PFP>|N(>2tF<t<u\zs2u2u5F2uF:t< u2FV)U(V)U>u F`)\)Py]U절3sF-F&&X&&s3t3r!a)rF:b)uFb)(ry3f)f)u /Px3]U?PC]U!P8]UU):V)t<t&<t"N(s>3uP.P(PyN(g)<t<u>u61xg)h)6.g)PP(P]yh)6g)g)2sg)h)2>h)uYU)U(g)U)h)>g)u2>u@P g)]UV. tSF3PQP=Ċ3.hڰ83v3 PK6.FP.PxFP]ĸ3PF.]UF33..Pw(袷r>.u"3(.PPv.P7xH]UP36.vP.PxRr]U&^㋇.PP.P x>. t.b PPPڢi)<ui)]UF33㋟."(?u. 6"(.Pv (辶r3 (.>.uPvv.PPwa]UPPPPPP.P.Puw>.#t@3N(]U0F3..Pv3LJ.]U36..Pv]U8,tP,]UF3>tE3.6,6,.Pv$(>.t }$(>t $(,]UnF3.PPP.Pjv8]U>t6-6,!>t]U>t6-v>t]U>,u P,]U|-*(j-,(,,+,+,;w,((~09@.wԠ,<t<u4&(&(w!؋Z-;,u ((9l-sl-&(u^&(&(wI؋Z-;,ul-;((s ,)l-!&(&(㋇Z-;,v tZ-&(u,((P6,,+AQb;,),*,+,((09@.rӠ,<t<u+&(&(wmء((9l-rHl-&(uS6((n&(&(w:؋Z-;,vu&(㋇Z-;,u((9l-r)l-Z-&(u,,P,P((+,Q:,,>,u >,u)q3:r3t*(|-,(j-]/]U,+,N;s]U3P>tK6.6,P.Ps.(>t(.(]U>,t]ð]U|-4(j-6(>,u]á,>.;6,b6-6,PFs,,,>.0(0(w6؋Z-;,r tZ-,H0(;Z-u,l-0(u,q3:r3t 4(|-6(j-q3:r3u/]U>,u,s]ð]rqQU|-<(j->(rb,>.:6,8(8(w&؋Z-;,ul-;,u,l-8(uҠ~08(08(;r㋇@.;,u,@.8(uڡ,>.>,td6-PP s,,8(8(w+؋Z-,;vtIZ-;u>.l-8(u,uk>,ud&6\>,u=,,PPR_Yף@(B(6.SR6@(.Pq_P:(;,swU&9q3:r3t<(|->(j-/]ð]T%rRU~t4)>t^.vv.Pcq>t]U8Fu>.uPPP PPP>.tO(P6,]5m)h-,;r ;uz-;,s5m)~u ((m)㋇Z-;,v?,,+D(vQP!~u D((s(Fs ,,R5|l)믊m)㋇l-,+D(vQP~uD((s(P4]UPv]UO(SPO(sP]UPP>.t]n4>.tA>2u:P>.t]á,F(,;F(uP|PF(>.t].n4P]U4>.u>2tP>.t]á,L((J((H(L(9,ulH(;s >J(uL(6L(>L(t<>to6.6,6L(.PnL(>.u,]À>t=L()H(sJ(.L3]U2r]àp3sp3w>s3ts3]UTFPQP蘹 P鹡z)RP P PԹvι(FP-((r*&v)HF؊;t tF<;t*s]U^A*GB*<*Pj]U*s]áv);x)u?;*r,v),,;v)u ,v),Hx)v);x)u **]Ëv)I*< uz)v)I*]UJ*K*>J**u<\u]àK*J**sฬ P]UYL*L*< t< t>L*\t>L*<\u>L**u*sǰ]À>L*0uCPyM*)BTu ]Á>)LNu ]Á>)MEu* >)MMu *]ø P*L*L*]UEN*< t< t< t>N*\u*sݰ]À>N* uN*;6N*]UO*<=u]ø PZ]UP*<;u]ø P>]sraXU))z,0Q* :s))>)ךPQ*ף))v)) t )))]S+Tr;%XUTcu>FFPſs3t*s\ e\ is7r))؊Ar) r)QPt)+Pt))+r)t)2t)p);;v*s D P;D P]ø2P6t)ȱ2t)@|)]U^Fu+J)u)]UR*PǢS*S*Fu^vR*]Uz)';*s,v),x)x)v)*LY**s]6Y* PF.[[&_+_[[_fP(ǢY*P P.\.\\\\\\\]^0^:^^___)O)rBv )1r[)H00)00)00rzxupP \*P P\*sxqPcƢ)PYƢ)>)KBuT*PPsE>T*u>U*6>)CCuW)e>)TSu#2P(Ps3r2Ps>)NEuP(_))w$؋ ;)u)؍0)u))w+؋ ;)u)؍<PPFe)u͸ *PoŢ)PeŢ)>)OCuY*.X))w)؋ ;)u[Y*)㉇|)uϸТY*Y*PP.Y*Т{P g*]*P P!h*h*<;t*rP8>]*uB]*P Pqsk]*PP]su]*PPIsZ|]*PP5sbh]*PP!sT]*P P s@%PP7a)P'PWa)s!-P%4P)P+P0~2PâY*2Y*u>2u-_s\*wY*>*u*r6Y*'s*/*r(8*u Pr|)t) PUs3t#LJ~)))LJ)s3*]U>.u 1r]às3u;Ps3Q]Â>s3us3s3r)C~))).)1s3*LJ)LJ)))s3*6)2tA s])2);r2)2)uް]Us3t3:u)))9)u؋);tB;u 6)xt]ð]U>s3u*s*<s3㋇~))))9tTPk*u1A;u,>9*u 9*]9*s3*k*)@㉇))@s3㉇)k*]Ms3㋇))LJ)u s3u<7s3*r))H㉇)s3デ))s3Ƈ*]Urs*sp3A*]UgP79P&<t9>2u ;*;*PP\>.t]j;*rP]U\P°FP軰v走]U6/L+踰聮<4]U>/Jw~ u ~ u6/+~ uA0 ~ uBTP#v蓿sHF:rl*tF@F7$l*]U\tP2m*<u]:*6m*U>un*(n*<4r);3PQPʪ Pr);t)s\؊3:n*r% t 3P/< uJ3PQP茪 Pݪ6r) P訪r)@r)r)뛸3P܂>s3t4]U]Urrl^аMP6r)P r)@))p*))9vH>2uA@o*< u:*P{!>o*u)@);up*6o*):*>p*uP: P]ø6 P@]UIs&s]ø6 P!]Up3s&|)Pp3|)t)p3]øPƢq*>,u uPPP߰//P)]UUP/P]UZP޸P>t]U3_P޸P>t]U>dt dP޸A**/<0:/v *P~/ms08/r /Pu]U>itiPH޸ P[]]UnP0޸ PC]U}P޸ P0]U츇P ]U>/Pu/Os //]U츂P]UF:/u F:/ujF*>u?0*>1u0*N*:v:/t*Q*/:*vPsPpݠ<t<t**N**< v* 10و***P* 10^***Ƅ*;*< v*¶*R1[***P* 10[***Ƈ*H5>u*yNȈ***yP**XF**Pl܊F/F/ Ps]U/F+;~1N/:s*:vF:/sF:/v]U~s/F+;~F:/s><tF:/sFF:/vL]U>st vvvvv@]UOP6/ms/Pj]U>uF:0vSP4/:Fu3F:/t*/:Fu>st PvE vP >/t]U>~0u6~0>_t >1um>ZtD1s>1u68uMPP0/>~0ui+6~0%"~0v*0v*;r P v*u~0v*0v*;r Ƈ<0v*uJ]U>iu >du1]À>uذPV6~0VPV>~0u6~0~0x*0ȴ;x*r0>uPrVgx*@.x*<0x*uÀ>uPBVP~0uG]6~0]U<t<t<u/0**`*F:*rP*P?ٸ PR*u:*F:*r *u0*FP*F:*r *u]U<t<t<u6F*0**F:*r\*PvI P*u@0*FP.*F:*r f*uv*F:*r 6*u]U>}u0F+Ȋ/;vqˆ*RPG0z**FIz*;s +؊<06z*<0拇@.@.z*z*z*9Fv*ذ<0@.z*]U/*|*^|*؊0;w<0<0拇@.@.|*Р0*F|*0;|*r Ƈ<0|*v0*FP0*F|*0|*;r!P|*@.=#|*㉇B.|*]U>}t >nt>u760** *F:*r *P*u0Ƈ<0j60R** *F:*rG*PָP0<00<00<00<00Ƈ<0*u6~0v60]U>}t>nu P]6~06~0P&]U*s vn*v]U*s/++Nu^%P+*v^7裵+<t^]U*sR2F+2;;:²uB"s9POsP*/22ؠ+2vv辢+2Ƈ2 +]U|P1P$]U츗P1P]U1P1P1]UP1P]U*sG2+22u]ð.!/^e/**@*2;w؊2Ƈ.]U+< t< t< t+]UPs3*P]UP1Pkq3:r3u/]U?P1P]UfP1P]U적-*3PQP肜*RP PP3P<u]ø2P Ps]ð+P s+P *=,wA+*3-Ps+P*=,wA+)* +Pޜ** P賜 +>*wA s PB]à*-hq3:r3u/]U3PQP觛3RP PP蛠3RP PPћ3RP P뛸P3P<u]à3*3*3*++++2PǛ Ps]ð,Pۛs!+P훣*+++,P蹛* P讛s`,P袛s!+P贛*+++,P耛* Pus'+P臛*+++ PSs++s3PQPnP迚+s*=w;*r P裚*J+s*=w;*r P肚*)+s%* t=w 9*s9*r PW**>3tPC*RP P_3P]à*3*3*3]UP1P]U*s%I+6+PL+<t\؊1]ø3PQPvPǙ61P؍TP讙3P˸P +<t*t+++++;wj1++:tS*:+t8+;w.++t Ȣ++"+RP P* PҘ >+u+++++u]U3PQPw\6P3P<u]ø2P Ps]* Ps6+P*9*s =w+s =P]á**,PϘ+뾸2P蝘*+ P貘s+PĘ*+*+G,P蒘+ա*=w+PPΔ**s]Bq3:r3u/]U**;s+و1*]U3PQPc1RP P՗FP3P<u]ø2Pח Ps]ø+P +8080" +P SΗY s UP]à+1蔪q3:r3u/]U+*suߢ+6+*PsB]Ê+*o+>+ u+1+ՠ+<tY-uY-,|,@, ]UY-sY-,H, ]Uv]U3PQP3P.PUJ>S,u PP'P >S,u PS,]U3P]U+ tp)p);, ,P.PI,@P.P!I+>.utT,P.PIT,,,P++T,1+-1%+Z;s=sbP]Uj-,Z- q3:r3t,j-,,-Y-s,,,>.Y--h]U>.t P$,6-6-܋,,+,>,uPPwЃ>.us>,u6-P6.I6-P6.;X-, >,uP,s*,+,,;vPѣ,;,tϡ,>.>.!u >-u.σ>.t,>,u,s}P|.,>,u6+P跐,>,u),.,Y-,,,>.),-P-O]UX>79tPP_σ>.u r߰P]]URV,,-,FPQPvmPf3PC"P1U,s FPnFPŋ]UvP]U츷P]UW,W,=w33W؍P.sW,˷]ÊW,W,ð]UX,< t< u Z,s>X,,u X, Y,]À>X,-t8Y,t3P.PFX,3<vu[,[,<w/83rȴ[,3؈\, [,˷Ƈ\, [,uʸ,P3PC3P\,P.PEX, Y,]À>X,(u X, Y,]À>X,)u X, Y,]À>X, u33P.PEX,>3u< t< uZ,Y,]À>3Y,ub,sHb,79+>Y,u4b,s*b,w>Y,um>Y,t3P79PC>Y, td,sd,9>Y,t,,,e,e,83rH؊3f,<0r<9v,, Pf,׃0,,e,u>,u>,v>,u>,s P,+>Y,t,-'Y,<t< uc,s"c,>Y,t@3bT]r,UX-,,-a,`,_,>Y,u#3P,P.Y,<t<t< t <t<t>Y, u7,<t<u>Y,t3P-PҌ3PPsQ8Y,u%_,ra,r8,u`_,,R>Y,u$`,ra,r>,u5`,,'>Y,u_,s_,`,s`,#>,u,]UU,X, Z,3.>Y,t3P79P79PP.PdB>Y,uY,<t< u>Y,u,>Y,u t>Y,tb]Ua)P P.PBɸP.P&C脊aa)Bd3t3(>4u45(s s]Uj-".|-4.q3,,=s#,i,-,i,6,-,ա.6.~-.]U,P-PҊ-PP.P2Aɸ,P-Pϊu13Ǹ-P.PQA. t!u,P-P.PA-]U, , tB6- > ,t-6-6,>.uv6,6,[Ѓ>.u ,6-D]U, , tG> ,t9.6-6,PIj,>.uv6,6,Ѓ>.u ,6-]UvPP4Ƀ>.un,,t ,-Pv(>.uHv,P,+Qσ>.u0,+,,Y-s,v6,6,|σ>.uv,vh]U젠4k,4>,u=3PQP軋P ,P>,u>-tP닸-P䋸3Pk,4]U2B]U&40P0P腈l,>u.l,6l,6l,\FP`?]U:PPP螢m,<u]àm,]U>,u1(-s'>,t P[/us]ð]U,sl,6+kˡ,P++P,+,@P+),,+ȉ,,)>.)-,, ,@,+,>.t}d]U2TP6,/s,/t,1Q>,uPΧp,,t>,t 9P裧p,P藧p,p,Wu12P8Pb<u!P.r6t,6s,2p,p,Eu2,sjˢq,3PQPT>p,Wu r,2<>-u-r,,P舉3P>X-u&1s>.t!r,-P[3P6r,>.tfP9<83v33P2P3->p,EurͰ,q32P:P12P-{p,p,Au2-s>,t Ds->p,Au QrP>,uD,P=P5,P膈>-tPx-Pq>,u,<t<uPSP,P襨<tg2Ƈ2 2P.P<,U,X, Z,3V,:>Y,t V,rV,r >.uP5p,<t.]UP]U|-z,x,x,w*؋Z-;,ul-;,r ,;sl-x,uΠq3:r3tz,|-]U^㋇Z-|,9,v4,,P,+|,HP1Ƣ,^㋇l-,h/,;|,s!!,,NP|,+,HPiǢ,^㋇l-~,9,rC~09@.w'/,,㋇@.;~,v,6,W跘~,,+,;~,s"~0ヿ@.t6/(~,,:]U^F;v2Ft؈N^w^ Nv~1Ft H^^Nv~NNOO|-,NFI,N+ȉ,,,w*؋Z-;,ul-;Nr ;,w,l-,uΠq3:r3t,|-.9Fw ;,w,.,,0,,>1t >1t0,,:,wN,㋇@.;Fr3,㋇@.;,w+,㋇@.;-tS,㡄,@.,,,>1tI>,uB,>1t~0,,0x0,,i>1t ,$:1u,-]U,;>.u,>.,;>.u]á,>.;v+,,+Љ,QRP>.,#,>.+ȉ,P6,Q>.,,,Plá,>.]U,F,^,v ,w~}t+J,,:v,,8,v,F:0t6,8,s^8 u,堽,:,v^8 u,堻,:,u :,u:>du3,,:v(*:v">itFt >,s,Ft 0:,u٠/,F6,6,܊F,tRF,:0v~0LJ@.6^㋇@.;,u,@.^㋇@..P/P葧,,]UT6.FPtFvFP/P,;.u,.^.@.,,F]U>.@>.؀? up9,wYs4Fs ,,>.H,؊,,>.? u6>, *,H>.Ns,.>.H,؀? uFNtzFs >.,RZ]U~t76>.谨>.,;w;sFQr,H>.#Nu]U,>.>.H>./㋏@.;,t ;,t؀? ue,>.? u./:~0vȴ9@.u,>.H>.؀? t>.,;>.v0>.Ns,ȿs Fп,C~usRFs.>,u~0,:sQ ,8~0sPNt(Fs >.,]U,H, ~u1- tF;,u,v荧FFHF؀? tFF;,u,FvbFF;,tF;,sF~u P6,rFs ~t Ρ,F-2,F~uP럃~u^? u;,t FN끊FsF>.4,FF;,u,FF]U,0;,rvhF;Fw,uᡒ,]UT>ut3s4sv-%vFPFt3s4sFP诫F]U,~0,ࣖ,0:,s,1,H0;v.9Fu4>,t-9,w,;v㉏@. ,.@.6,D,,Ȼ+ˉ,1F9@.u1؉@.t3s4s6,oס,ࣖ,}:,t^0,:,wt3s4sf,,,+,,,1@.Fu+J,t,+,H,,+ȉ,,t>usX6,qڡ,1H,ࣜ,,,,1؋@.),,,1؋@.,3v,,ࣖ,,F,,90F@..]U>}u@>nuA",>1u rC0㋇@.;.u60,.0㋇@.,0*F,,>t,rK,,~0,0,;rd,;v^S@.؉@.['>t.Pً,㡦,@.P,0<0,<0,,u>uE0*,P٠,,0,;r%㡦,@.6,36,w,,uΊ0㡦,@.,sPA菟]U>}u@nɲuB"¢,t/>1u,s!FP~0@.P,9,s*0*^S0^@.@.,0,~0Ȋ,:t~0F:w#*طS㋇@.㉇@.,[<0D,4ٰ,<0>t.WB.P7,㉇@.PV,<0,<0,t>uR6,6,P,,,,;,w-~0P3~0,㡮,@.P,,uȀ>t,r ⫰P辬 ]U,~0㋇@. u,;vCQPn, wA0*~0;аw@"Pt@ 1Y"si6,0㋇@.;,ws;,r,0@.6,,0*~0;,w@P;t@ 1Y"sR>,u~0@.56,$s1]Ê~0㋇@.,~00*~0@.>,uk^&s>1u t31,>1u-0*~01P0Q0QsX1,,P6,P ,6,o]U, ,]UPP]UPP]U,H;,w ޷r]ð]U,,P+ £4[+؉4OtIA>.;u ޶rR{]]UP6,,4< t%4< t< uc,H4؀? u+>4 uIɀ>4|uLs,H4؀? ty]ðP]U?ssŰ]qs],;,wUF444:4w 4u443:4s,4< u 4s PP44 4< t< u , 변>4 u7yPPRssRsPP럠4<.t4w3:4r4444u띀>4|u s444,4< tz< tv< tr< tnp,? tF:4s [44F:4sQ;64PC,44< t!< t< t< t<|u 1sw`ϋ,< t< u PPw,? u  PP,? u$PP@s9ss4r>4t>4u44;s*414414t%144416444P6,24>4t>4t,< t< u,? ti4484v>4uM4>4u444:4u4;4s 4444:4r44u4oPG]U,? u444u]U1s.1F.F~At 8P'1F. t 1<t1Fu4>1Ju4Ӥds֫FF;.vN 2rx~0ヿ@.tK /:0u>.v y,.6/,/FF:0wLJ@.Fu63s63s Ψ2r<0@.6,:F/0*~0:v >.tFt.y,]U~040~00040000400004000400&P3P>m0P&P3m3P0P(me&P3Pm0Pe&Pm3P0Pm'P3Pl)1P'Pl3P)1PlX'P3Plz1PX'Pl3Pz1Pl*11P6,,4,4q3:r3thq3Тr3.d-..v-r34q3r3>j-tPt4r38q3u d-j-v- 4j-4|-/sv/]U>iu >du&>1t/<r0:rt3s PL]ð00)1z10444P/~00Ȣ0/,0/,0q3r31014S@.y11Ktp34p3a)4-P褧Pf4s!P萧4p344]àp34p3a)4-Ph4P%4p3R4s!PFP4]U1r]1>1u00~00000݀4Pğ]UTrM3PQPmPmm6464 Pm>1FtPQm6464 Pmm43Pp4]U>1Au/11耠AУ4444>.u-1r&]À>1-u u31Fu3葍<u]5-h5115r/>s3u&3PQPLlPl4Pz"Phl3Pž]À>1Ft]jn555584r؀4 u55558#5r؀#5 u55⠢585s5>1?uy5rՠs35s35s3PPP#5跱s 1. 5sP>.u5 V511r.뇃>.u1r>u3t454ڞ4P號45c5r05:w:u ނ< t~05]PP6,P44;t t655Ƹ/P蠙+544P/P轑4>.u5 ~511r.e0:5uS< uǠ~0565Ÿ/P<5< t 154]à542P=>.t%1sP&1r..Ԡ1s1]U>1Fu,4+40㋇@.;,wF>5tT}Fs%055㋇@.;4v565~05585r5:0sLJ@.5١4,&558#5r؊#5,,5u߸PᩊFsM44]U>2t>4uP6,Q1sN444;r3454u4:4t :a5t444>1u5.u ؊54444u<>1u/4.t@,I;4wAPQ詩Y Y"r&446484t8`5u 44랡444544/赟>2t@Pgt@Y s/,4+>.%4,;,v,4+4+,@4t>4u4:4t :a5t444>1uH4؊.u4r444, 4u->1u4.t74>.x44]Ë46484t8`5u 44뭡4444A薞>2t@Pwt@Y r4,H>. Pߠ5rs3*ru]U5P膘zPy9赙>9u<]69]U9~Bu%>5u>5s9>5u>5s99989r'ء559559uР999 Pٖ4]UF=v ^C$]UF=v ^C]rU5P.PBУ5555sK^0:r89w35>5 ךP^65׃0555뭡55]#ITrU,,@;Fs,N;vE+I,ךPNQWM`_Y,Q,VP_YmF;,uJ,N;r+,+,5 F+,55,,P55%,FךPNף5555]3TaTȮTTr@U,,+HV;wPQN:Pۡ,+,HN;w@]U:P6,P559,v!؀? u:1::5֠:]U551wD؍565<ڋ;u!t+Ju]5u]U5؊55.hmٮޮ1Hn¯̯֯ #(.7@ThðȰͰҰװܰ  %*/4jt3s~0ヿ@.u~0,9@.v09@.w~0::㋇@.;,w:~0:m1q3 >..rH">.cu+Ju$Pry>.dPre>.7sMPrN>.:.)P{ru>.GPer_>.G6,6,&6\-6n-6^-6p-6`-6r-6b-6t-8]á,@;,u h,;,t@荠r|655P]à3 33s3 44]á44]Ês3㋇))]Ês3㋇))]6؊1:Ps616,6::::w6? u6:u6v6o[6j6e6`7[O7V7Q7L8GC8B>;Hu#;;Bu >;Du P]øf;P]yr>U66 8Nu ЊN 66;;8;s؊<:;<9w.;0;;.u};P;Ȣ<:F]U5< t< u557.dzHelszPĴ:a9CJ5=u 9 9P9l5@59 ؀?>u9z5?=u9j95y9 5=u999\9I9N9G9@9-5*u 95$9 99 9 57957Un5;;50t<u$;50&n;5;ȋ5?NuSw=<t@P5w+<u@Y"s95G,0]5G;< t< t<(u{9n5?Sukw.P裥;8.w@P5w<u@Y"s9 ;555]Ë5G;< t< t<(u 95];6#>;s)65>6t+Jt 6;Р;<t9 95]Us955]ø;P]UFV ;Vu;FuVFV # ұuA;V~# u@;V~ ;~u;Vv sr;s ;r]U5599]U5599]U9tB< t>9<t<uB>9u8;9<t)<u ;z>9u;uh>9t@]ð]U=s:P]U5;C562265:;t ;6w55;6vlP56+Ȉ3P 3PQU53]U5< t< u522;5s]Ë5.t@]UQQ>9u55FV|~u~ w %>9u/cFVu v;P~狅557>9u+>9u55FVFV :PЋ]U9<t<u9FFV^.׸/IFV7FV؃(FtFVFtЋ]ýr$UpFV>9tYFVt:PFtFV^^FFFFF;Fr.FF;FrFVN~PFVFuFuʊFs V^^FV]͜ȄTrչU FFV>9 t9F*FVFFFtFV^^FtFV^^^.@FYFVN~P F Fu:PFVN~FV*F Fu;PFFVN~~vF2Fs V^^"FV]' ȀTȢTTr ̺U FV>9u>9FFV^.FVFVɋFV)FV뻋FV]UFV>9 t9FP}F^.^jŻFVN ҃뱋FVN 똋FVN냋FVN뻋FV Ұt@FV~NV~s ffYNNMFV Ұt@FV~NV~rЊN F VFV]U FV>9 t9FFVvvRPF^.ʼм׼⼂~~u@+~ F<~t@F<tAt@ FFsFFgFV]U EFV>9 uN9Fc,FV^.NTbpFV F VNjFV!F!V빋FV1F1V뫋FV]U/NF7Fs\>:u:>9u55FV DFV~u~ v;P\~牅55>:u: ]UQQ>9t:Ps\FV>9t:PYFV]U>9 u55FV؊/F&9!:F:FVN:u v;PF0F>9uK:~u~ v;Pts|jFv~M~狅F>:u:vF9s@F]Um>9u@9< t<u ;6;/66>9t:P]U츆P9Pp<u]ø2P9PDM2Ƈ2 :胊52~3PQPO PO>;uK6t-PO66؃RP6666 POPO6666POHPOPO66e>:t@43Ṕ>s3t谄4]$uJBË2v >1tËFÀ>3tg>3u /P:3Z^RU6/, >;,;uW.-2:t C:Ͱ!< t*< tr< uZ:th:vCPsEޢ;tK;!ϋ21ߊ& t:tj:vCPsE;tK;!؁t 8 < t< t?:t':vCPs$uJBע;tK;!ȁt N;6,u6,);6,rFSQV觏6/ t$P,P 詏6,P+^XY[6/^Y[:u߈>;, < t :u;+P< uF;,u,8>;t ;1ǶPˊ./8>3u8<0v*t NJވ>3:u//݈<0]UvQ$uF]P8F$tP'6ðP;U P]U P]Y["u"uJY["uJZ[2CR#t"uJBC_^VW_^[SVW _^[ZRSVW_^VW_^[SVW _^[SVW _^[SVW _^VW_W_^VW_^[SVW _^VW_^[SVW _^[SVW _^VW _^Y[SQVW_^[ZRSVW _^VW _^VW_^[SVW _^[SVW _^[SVW _^Y[SQVW^rj u;v 33ˋ33U3 ҃+@sH]؋%TOD COM !DISKCOPYCOM !CONFIG SYS :!GDEVMM SYS !CIO SYS !DEVDMDSKBIN !PLM86 LIB H!COMPAC LIB P!$AEDIT 86 M!COPYRIGHT1980INTELCORP<AQMCODEA?MED??SEGAQMDATAA?MUNA?MJUSTACKA?MSKA?MSR(hhepxɘthsxטxP x ˎoINT31INT30 INT29 INT28 INT27 INT26 INT25 INT24 INT23 INT22 INT21 INT20 RCOPYRIGHT1980INTELCORP(C) 1980 INTEL CORP.VERSIONNUMBERV011 V011NA?MAB$Q -)$t&> u::&@^"aA?MARQ -Jx.z.G|.G~.G.Glûjkûkûkûkÿj&>t.l`-t l`kSjzu>|u>~u>ukk:&RP>; u&Q>S u&i:R$V^X>ju::&RR u j>u&> u>;u>St$2.>txPj&jXlw:u#>u.>~u'>|u >zukkj&Á>ltuiĀ>;t>Su&>u&U뭀>;u&> u<;>Su&> uTSS>;2$<t< t<t....j&::&Rtj :RR>buɃ>duƒ>fu>hu&>t&R>$u:&:u&>z\RXJcXToX^{XhȘ^ƀ|^! .b^LŹPŻPŽP%ſP XXXXXX"XX"XXXXXX"XXXX"XXXXXXXXX-XXXXXXXXX- ^!{WXltLsX/xXA}X ǂX> Ct1ARCTANLFA?MCHQ -(Nt&> u::&ã^!A?MCOQ - r$tRS3T`bdfh&;STĻ<w<t0t+HQ;nĻ`iS`&>t% u< t &< t$xOt>tj<u)<uu tt< u u P G G G GX֜^LA?MDC hx              &&&&&&&&&&&&&&& ,- !"#$%&  '(  )*+|AX X X X X Xe X Xe X X X X X X X X X "X $X &X (X *Xe ,X .Xe 0X 2X 4X 6X 8X :X X @X BX DX FX HX JXe LX NXe PX RX TX VX XX ZX \X ^X `X bX dX fX hX jXe lX nXe pX rX tX vX xX zX |X ~X m :LX X X X X X X X X X X X "XP $Xn &X (Xn ,X .X 0Xx 2XP 4X 8X :X] @X BX DX FX #@Ox #u$ж̀tz܀8$ 2.$.2.GwW%gGLt=tt 2t3ɉO.t) t$% 2.$.t%8 2.$.8&&'u{È#.&ڈ# #.â.t$ #{0&1t\&'.($ â9]&01&&'â&'&&#&'/e XXXXXXXXXX X* "X0 tX}XxĄX8XxXX$Xx2X~A?MDN ȇG+ȃCrC_2â8A?MDIQ -n #8C~|zyU3xz|~`22&..HJL>N6PAr>N +`bd>f6h`bd>f6h&xz|~u>N `bd>f6hHJL>N6P &x]<+TĀuR?lj::Rujiu+&>u&xz|~jXò*-^=X BX eA?MEMF PX$2S.[2.Q7P PPNPrPZ PZ PSPSPSPSPWPPPZP$P P# "P*$P*&P (Pd*PL,P.P0P 2P4P 6PZ8Ps:PtP@P BP DP FP HP JP LP NPPPRPTPVPuXPrZP $ XF X ҀEXAMK nEXCHNG lEXP jFXTRAC" äA?MGT h$ 3.^KKCCN & FdЩt3Шu& Fdǀtt@t & Fd& Fdމ^ÇA?MGM .D\2.FF#FFF FF F LtF Dt \.D<t<t d=t<u FFF ôGX X X X X X X X X X X X +X jX PINTPT iA?MIN h" @UPSQVW-%؉.<.>.6&&ED_^Y[X]tÃZRZRZRZRZR}ZRuZRmZReZR]ZRUZRMZREZR=ZR5ZR-ZR%ZT4 u :&^LOG*^LOGCSTA?MMU2,UnGGGGG G GGG`dubu uHLuJu u3ɋ-ʋD3GʃHtO5D3GʋD3GʋDGW jun p r t vtx]ò<TtR-?lj::RujjXÔ*MISCELA?MNUZBLA?MRGQ -(^ EEE&E&GEĀu2u*EuEu EECEE?3 t\W_& (&WSÊe[_2E&E&GE&GE&G%% E&G<t<u:&$X2&&G :u &> u9&#<u(2&&G :u &> u & &3҉UUUUU;uUUE ĀtEE@E؊2ڰ عC;uظ&+X-X/X[1Xv3Xh5X^7X9X;X=X?XAXCXEXO^bXg rXɊT=X?XAXCXEXI^YXo'T^ '4'7c'f^T^IW2ڰ C;uEEEEEE÷ T0REMR@A?MRS> D F4ROUNDQ -33ɇMŀtuEuEuEt2EtEEE33ɇMŀtuEu EuEt2EtEEE33ɇMŀtuEuEt2EtEE3ҋMtuEt2EtEe33ɇMŀtt2EtԹƋ2.3u 2s&2.=t<1=t5* %Xz'X)X+X#-X/X1XM5^DXcX^^&A?MSA&>  SCALE íA?MSE.Ft_A?MSH t GNt2t#ގQYtWWWW32t"ގQ FFGYt____sGugWWWWOGugWWWWOuSQRT,úA?MSTQ -P&& t ^Ȑ] ^G^L]^ ^5^:]b^g] ʞ^ʯ^ʽ^ʀ ^A?MSRQ - u(>'u:&&&2.> 6J&:2 <&À>;t'>;t>; t>;u c ::><?rDQt:><~@vt&>u:uh:Pu >Ou\%> :$&<ĀȊQ &EO&&>u;> &:Q &EO&> 3&&:&E&M> &E&> & &:&Eù@+<x@vH2:Pr w>:t>:uPøÀ>;uQu=t P> &À>;u > &&>u> &َ ËXUXqX"XxXy X3 X"X"XT^58L@ MXoL^|^|% /uL~^ dL^]A?MSUQ -H`xJbzLd|Nf~PháH+`xJbzLd|Nf~PhË<+Tx1C~C`<lQu7u0it)%كC~CQHTlYiu>$uR&::&Ruj:jP:j4<t33xxzz||~~j39u<9~u69|u09zu*9xu$j&>tjXu P'2>|u >u> >nt > }S6).]U3q/>Ht\>jL  JPP+P>u>u>u>lt|>u>t]U3.u~t >t,F t%=t =ur">u 6w]U3.6W u6C u6/ u6 u6 u]U34. > } F# P2&]U3.>t6P"P$>Vt6VP!P}$>Nt6NP Pd$6@PF"PR$>$t $,* P  u>Dt>u>t(s#m u& t|X t|[ ]U32-F   09Fu    ]U,>u>u6PPa#0]U,WVv>Jt+>t+F>Lt+F=~P3%+JL>Lt FLJ B>t)P6 P P* FLJ >Jt FLJ >Ft>u P$ FLJ ^_]U+WVv#tPXPF㉇ O9>r~׃>tVb^_]U+WV9+)㋇P_5 u LJGヿuN96~^_]U6+WVvF>zu%>u 6~+} ヿuU㋇=t F㉇ FGϋJFPPXF㉇ F~~ P"O9>H~^_]U*V60M?1tFLJ F >Pt FLJ ><tFLJ 6<dF㉇ V>u>t FLJ >t FLJ >t FLJ >t FLJ > t FLJ  FLJ #>Xt FLJ '>u>t FLJ *VVV4FLJ .FLJ F"LJ  P601P ^]U+)V" tP362>u>t FLJ 4>t FLJ 8>t x>u>u>xt>Bt4>u->u>t>xt FLJ A FLJ F>t FLJ J FLJ N>t FLJ Rt FLJ V>t FLJ Z>t FLJ ^>t FLJ b>t FLJ f>t FLJ j>t FLJ p>\!tFLJ vFLJ \!>t >u>tE `t.66yPbPFLJ }FLJ b PFLJ FLJ F"LJ  P62P ^]U&WV>u0>u>t12GrG>Zu&"P;1"P1164^P6/P0>u>twFLJ P6P0FPvlFF FLJ F >t6PPFLJ >t>t>tFLJ ^>^t FLJ >t FLJ >,tFLJ F, >(tFLJ F( >&tFLJ F& >*tFLJ F* >t FLJ >t FLJ >t6PPFLJ >t x>uQ>u>tCOG>u >t>tF㉇ >xtFLJ  FLJ >vt(FLJ 6vPp"PFLJ p">u>tI>u>uFLJ F >u>t +P>u>u>u>tA>u>u>t Pr>tF㉇ P6(>u>u>t\!tFLJ FLJ \!FLJ FLJ LJ  P64 PQ u>t6x>t 63-^_]U"WVvV,PP tEO;u^_]UP"WVv$ tLV t#VW_,v6PPW+7.PV u vVVv6POPW ,^_]U3!~te6'PvP+ u v,P~t3>t,6PvPk+ u v,P]UT!WV$vWs+~t*.PW u W+.FvVC+^_]U3!P%=u vPPPv%]U3 6'P6&"PGP6"P5P6P"P# P6"P#P6z"P&P6P)P6u>t5P6!P]U3>Zu" tPX*&"PN*"PD*P"P:*"P0*z"P&*P*Vv t!V(؊@PP t+^]UWVvvn(VFd(FP$VW(V u<t PW'vWy'^_]UWVv~t vNOp@9u]U3) u P.  u P  u P ]UWVv~FFPV& =F=t45)'FN+;}~2}5V&v FFɸ+^_]Ur>\t vv>Ht  PvA& t1vPH tdž%^+G3,PP2&1PB"PP%džPvv+P$F*=u)>t*v64% uP66~}->uvP4!vPF ~~F~u+~u]U3*]U3>u>t5:>^㉇ F@]U3]UV+ヿtF|>rmuB>rluL>rcuV`㉇ @t FLJj> u FLJt^]U3h>u"PPPP]U2WV>uhPg  u Pb$VY$F< t=;t= t=\u/G=u^FLJ ^F㉷ =uFG= t=;t<u^_]U3>t"PF>&t>t6&#P>t>`t $Po>u>u&>u>u>uP>u>u>u>t>tP>t> u .P>uP6" tnP6" t\P6" tJP6n" t8 P6\" t&Px>>u >u<9>t66" t뿡>u>t0>u>Pt">t%&P]U3>u$>u>PuPP]U3PP P"]UiVP tPV<mPP^]U&(WV>uP6P"PPP"P u'P# PW Fヿ#u>^t $PW >t )PW .PW P660PW > t6 7PWr DPWg >u>tFP6>u>^uAJPW/ 4NP6P6.6RPW WPW vܸYPW wF u1N]PFPX FP6"PdPW 96uɸhPW W8#P"PkPFP F###P6#oP>Zu P"P^_]UVv <\u/F<uF^]U3tP0 P& P P RP P P P BP P P  P Q P  P  P  P + P i P  P|  Pr ( Ph j P^  PT  PJ - P=  P3 ? P)  P  P  P F P  P  P  P v P  P ]U츆|WV^?u+Edž|^GF=u|^|9~FP|^_]UVP uu<umF<uJ=eu~ =2~=1}M=0t#Pȸ  >u>t PO 돃>tP1 |1u[ RIVu*F>&t P, F=bt=cu5=dt̊DPMPP =ft=hu=lu =mu=su=tug뻃~t P^]UVP t<t Vv> t>t> u'>t t t u P< ^]U Vv#6 t9vt P ^]U3Vv=du~X=Ct<=HtI=Lt;=Mt$=St%PDP P`"!Px+NPP: NPP PP  PP  @PP @>&t PPP sPP X`PPa 7-f=v. Y YYYYYYYYYw Y\ <tN>NuO>u!>rt>rlt P)rl>ul>rt>rmt Prm\>NuU>u>rtA>rst:P.>u >rt>rct PrcP@rs^]UeWVvv@PvVgvV^_]U3VvFLJ (FLJ 2FLJ +>\!u.P\!PFLJ \!^]U WVvVFVF+FPM~" <"u\GG<u"GF^_]Ur WVv+<"uGF<u^_]U3M '>'~ ))+]U& >Nt!>'PPQP N+P"PPPF uo~uH+GF=t=t =t= t&6 Pk6P+PB  묋F]U3 >uP6P]U3N Pg]U&PDDPDD]U~uU.&E塘ſ.(.]P> FvPsXe_,3ы&8uW^AAZ<%~u6 ,21 ؾ%~u$66  C33ɬ;vv}tNփ~u&? & جjy~u;vwcu~u&Eu)6 RvS 6&? } ~u &E&]<*t\tFPvP!]U3 FPvP]U vvPTvPPPP]U3e FPvv]U3L FPvv]U2 WVv~=%tE=cu=dt@=lt =st=xt1|FG֋^ tPV^7PFS}du F~tPV^w7EFvV^RP+벋^F몊GFF=tG^_]U$\WVvF$G~}"~ u-FFV؃ډFVFF RPvvE"؊GF RPFP " uFOF uF^_]UvFv,PPPFPvPDPP1P=]UvFvFPPFPvP^PP]U:vRFv`PPFPvPizPP]U3v vvv]UV^&&FV ^F&F^&?u^]U3]U3Vv8FtF<u<t+^]UXWVv+ 8FuF<u^_]U30Ft ~a| ~zf߀~a| ~zfߊF8Fu+]UWVv~u+F%|t!CFL!%!;s OO ô0!<sPv ! 6+rׁĎ)s 3P} L!6&:6&8ƱH666+۴J!6 )+3 &,43&=t* t 3utHn36*6(6&PP PY+r ;r3UV+ ^&^F9v ^]UFV FV~ t~ t~ tF^&F u^&F&FVFVF Ft^&<*t !rƇU^E!r ؈U^NF!r وUWVvDuD@uzV D㋇FFV DPo }C~t;PFPPFP PFPv FP+D^_]UV{ tVvv +^]UVvDtV&@u++D*DDVvv ^]UWVv~ FfFF~t~u+EuEBtu~uF9ErPV5' F)EFփ}tuV5 E)FEMx * WPE u FNvVEP F=t)FF+F+v^_]U t2&!2]UWV6* t8~t2v 9=uWvS  uA <u+^_]U^O]UVW?u)}u3$@$D6N؎_^]UWVvaF FF<uFF+ҹ 0F+FNu+]U~t~t/ t24~u04.2,>0u#5!0.8%!F2ȣ4;.u ;0u3Ћ]ÜPR؃>,u24=tb9.u290u,UVVEE<u.F0F]ZXˣUWVQS.204PDD[Y^_]ZX˸8Ns 8 t86ʻXN6.SQR2PPZY[UWVRv vvvF@u*>u#^<\t t:tP uFPV,P/ Ft <;t G<uRW؀y\t PWBvW8v vWv}F@u>u<u{F uq^_]UVW~3O~߹Aً_^]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UW~W@PC[ u[P_]UW~3@@_]UVA!)UVWV;t@t 3_^]UWv t3I@!_]sAwtBH;st4Dt L+HLƌڌ;t&&=t%tH;stDG t&t،;t&7뼋w3j;t $@@^t MtNN뙌،;t&G3QEt+IAA&;vurr #+ uu3YRQtWDw+JUXYZSP3RRPP Z[t U u F23Ћ]UVWv3ڬ< t< t<-t<+u<9w,0rҋˋ؃ܓu؃_^]r3]s ]2â u#>r <"s < r<vטÊUWVvDtD@t L DuLd+D~DuDBt@<+|D@D㋇DHD ~WtDP F\FDujuCDP  uQHD%DƇB%LJDD릸PD t L@D̀LWFPDP{F9~tF*^_]UVvDtDttDd+DD^]UVDu+DDDD ƃ;u+^]U^VUV tNO!s3]UЎغ!]V3622UtP^UWVv^=atD=rt =wt3+FF^?+uNFF%=t=t3=t3FF+Ft^?tu@߿ ڋ^?buPWvF }sFtDFtDDHFF*^BDLJF+DFD^_]UVC!rFt t UWVv+D$<u@DuDBt'+DF ~PtDP5;FtL DD^_]U, u>r ! u,!£,]UVWNF3҃ u~UWV~v׋N5;v;s NO s 3rIs&^_]U츊WVv~uv vV+PxPFPFPv v @u\PV u.PW tvxPVvEFVP u v랸.PVWcPvxPWvF>u+3P.PW/P$vxPWvFWrviF^_]UWVN&ً~3ˋvD3:EwtIIы^_]UWV~vߋN t2^_]U^ tB3ɋ!suNV3WVe @u2Q+I!s I t/F8@!s 4 tYQ+!s  u@t ^?uYr^_N uV@!s u@t ڀ?uUWV+9vu*FFF^F7@^?uFF^uNu~tF~t^7v6FP u)FP u 6<6^~?F$F^ ?FF+P^7WP@F^?uۃ~t;+P:PWPrFG+tGFNuG~t^7WZ+~ G^97t~9wt GFFF]FFPtF=}~ ^7tv+P^7WPF^?t GF^F u ^ ƈF^_]ËN FV~W t u y -ۃڋ3 t0<9v' uODO;rX_^]E U~t~t VW؋^ ãJFLN6LFX)!)h!U>}!.E.&E.5.6Eu.6E.EJ~t32P !X,VK!PP0!<X[}!.E.&E..E.6Eu.6E5,]_^rM!UVW~u8:VFHuSr'H6Ht;t DF V:^s0s uڃ۱H!r钉T63_^]ËN 9Lt u?r9ӎ;u96s&;u ١ +؎J!r ;u6U^}| @t3]U2>F2t .%=uvx!7VN!sF%=ut VC!tWuRuK V=!rǓD!€u-ѸB!ٺx?! t>xuًѸB!3ɴ@!>!F$ V=!r7FukN-N2uFuV!F$ V=!ruFt VC!qUW~3AيFO8t3_]UW~3AOFG8t3_]UNeNV2D<@?HBRERIRORUR@(#)getflags.c:1.30-/xx.cxx.c%L:;C_FILE_INFO* ((((( H    ...''.xt:\TMP\PATH\   ..com.exe ;C_FILE_INFO (8^I<> error 2008: Not enough space for arguments error 2000: Stack overflow  error 2003: Integer divide by 0  error 2004: DOS 2.0 or later required $ error 2009: Not enough space for environment  error 2001: Null pointer assignment /`RB OP2PˌÌH؎GHt +Ўځt +ЎNF$6 -؎֋./@ʎں!L!Packed file is corrupt7nLjLfLbL^LZLVLRLNLJLFLBL>L:L6L2L.L*L&L"LLLLLL LLLKKKKKKKKKKKKKKKKKKKK*kg1/8:jjP!$AEDIT 86 R!PE8087 Y!,AEDIT MAC ]!AEDIT BAK `!CL EXEX!MZ? B$#+E!UVFH}y~}u6P-Y.PH73 t |.t|\u-H7FP2[PFP1HF:`PV:2 t)ePV:2 tjP-P"+PH7  tH7P-P"+Vw Fr>Et>u >t>t  u7  z t$F  ud^FP- ^]UVHF7tD=Cu~=-u=/u =2u=4t)=BtQH7P-P"HG7tD=3uH H@PyK5bDfU>K5uNB-D=v5.ZvbjHF tH^]U츴P-]U30fP/ t ?PW>t} RPPY/ RPPY/]U >P pPPP?t׀?;uPU WVPPFF7uD M6Pg=tZRZJ >u'666/=ua>t6FY=t[6PPY=u>u 6FY}8>0 )(FP6PE=t ~u~| FZ>taPbZP?>tPP6PP6PZ6P=uP6PrZYZLP PPP?:uZ$^PPFF7uD ,F Q K E?97+=cu=du=eu=lu=pu>t#PFF7uF, FF<uPT,F~ u~ uF7uF7uPT,FFP^@b=t FT,=tPT,PN=t@bPPbPT,P^P?u^$>7u z tl=tAFP6PE=t AZv+PPB=u%%=t^FPPE=t 8FPPE=t^Zvv-By=t)FP6PE=t NZFvP=t  ^^r^c=t7-!=Xv.\ ; ; ; ; ; ; (; ; ; 0l; ; ; ; ; ; ; ; ; ; BV"*; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; c; ; ; $     ( " >4u)=t7Z^_]UV;~tPPFPF<;u;^]U@ FP)PW>7t Z7]U6^Pv& u#6^PP&7+.+P6^. Pv:2 t*]U6@vv& u#6@ PP&7+.+P6@.Pv:2 t*]U>tH>t-'+Pl7t%~t~ t~t7ߋF4)Z]UVPF t$F7tD=PtPPFu<PP?>u FDPFFvP tZXP7t(FPPE tv+P u P+P t^]U // >u>u+PP5'N+P"]UWV+4hY=twPVHPEPEPF؀?t POP} vu SP} tE P`P P F}p^_]U\VFFF u#PwFPg u GFGFFePFP2 usP?"tFPPE uc +P?"u>P~"t^F6PPPF uۋP?"uP^~~7"FPvePFP =u 7^]UWVP?*u!+4hY=dueF|PvP7t[FPPE tv ||7>7t +.4ƇhYeP7u 7^_]UWVP?*u!+4hY=eudF|PvP7t[FPPE tv ||7>7t +.4ƇhYdP7u 7^_]UP?*u PuP7tZFPPE t~|~|7>7t +-vw P7u 7]UV+Vw F|>u#^]UV>2u 7q, u uvP+P u+PP @t\>2tU4؃rYv4rY>2uy4tYP3 t4tYP t?F6 u=>Cu6+}Pq, u uFښq, t^]U u4PwFPg uFPq u t]U>2u 7+D+Pv @u$fPPtPv =u7ǚ t]UV>2u 7+Y>u%>t'>4 u >4u,>4uF t+PP @>2t66 u->Cu&+PP @u+PP @+PP F@tM>2tF4nrY<v 뽸4ntYP3 t4ntYP>t-'>4u~u0>2t)>+u"6660 u P+>t-' >@u^]U"6 u&>Cu+PP @u +P uы]U>2u>@u.fPgP>6tWPP6]UH?u+KH7/  u >7eu6H tΚJ GHePb_]U 9H?u+L6H t J GHePb>u oP]UPwFPg t"PPtPFP =t+]UFFN t9>u%>t'FP5F>t-'>2uF~t>Ct]UWV+962u 7+!@=&t =+t)=-uI~t+P @u5+Py @#>u$ t%+PP @=t~tA tHV^I6\6Z6X0 u+P @u)^+ u uظ Py @tF>2u>7th7_6660 uJA^_]UV@^F7u<u F~|  t >7u\7TPP7u<_tVwbP6 t"6f6d6b/j7VP u<:t <;tF<u<:t9FPFVE tv t7뚋P7tFP6PEZ>7tkF6FY ^]U^ww7P]UPWZ7]U>7u7]U>t<=&t =+t =-u.^'6660 ta]U P ]U츎_P6FYP]UWVFPp+ u>u >u>u'KPzP*^?u+PWWP0v 5FzP=#9" ~t!tP-P-u PW>u%5>u>u-'>t}t+^_]UV tLPPFEEGGVvv6^_]U" |*>t PW>t PW]UPWIPWPW]UWV6PHP+P4F>H uZ^_]U츉PPq%^PPq%@]UVW؋^ ãF 66F)!)!U.!.&~t~t32.5.6#u.6%.'P !X7VK!.!.&r~uQ!2@P!7..'.6%u.6#5]_^r ~tM!J"UVW5!uw5!} 5!..!5!.. "5!$5!.".$˺!˺q"˺} $>Et˺˺2 |_^]UVWD!3>QY&?>?u(>QYu..t66΄>u*>u&Et}Y.. I_^]UVW2& q& &&>FعFHVXZ\^`bd_^]˴0!..& .. .+L!.>.t 6&΄f%t.>(t !!..& .. f_^][[ZYX &f6f6f6ff.&P`&u,<t<t<.u PS&&u;[XuPRb.>)ua$| aQY4aQY ZX<t#<t+9CX9BX9؀6BX.>&uX.>&u&1t tLuPQ!X.9,u Z.'.....6.6.'.>*t?..&... .+.e.[.Q .*.>&u.>'t.*P9CX.*. ..&.& ....fPQRSUVW..& fff&f.. &f.f.fȎм >t >Et!؎.& .>.t%6΄.>(t.>)u 2QY&.Pf@P2/2.,P!>ع6F˺I˺>˺q"3Ë@P!>Fع6Ë«ëU^W^G]PQ.>(tN.>)tF.>)t>.>)tQYH pQYa aQY2aQYYXPQ.>(t].>)tU.>)tM.>)tQY栰H pQYpQYa aQY2aQYYXPR.>(t0b.>)ua @t9CQY@uZXÜ."UVWv,rPFPnPPpP F6n_^]#؊/./%@ ĴUpp J5]UUWV@5&L5>5u)>5u 5 >K5t5 5>H5t>t,*55>K5t5;5t >t^_]]5>K5t055 5 &`=u&` 5ô3tPH5D5F5&u;I5>5 |5>5|B55u5>5t5B5P$P XtV@Љ5B5¿ 5P$P Xt#@Љ55¿ 3U@&L5&I5&f5&`5&b52P&5>I5tL5&5&G5&G]U>K5tk@5>t:5t25&L;5u:5t2>5u&Lt5>5V5;5t]U>K5tD@&I5&`5&b52P&5>I5tL5&5&G5&G]U>K5tp@5>t:5t 725 :5t2>t &L=t5>55;5t>u]UB555F]UB5550]U555]U555]VWێ_^À>I5t>5t0&c5&fL5&5&W5&GÀ>I5t>5t0&c5&fL5&5&W5&GÀ>K5tp555555555L5&P5R5>T5عZ55X5T5&&&`5&b52P&5 5&f55>555&;LtF5&&>565U>I5t>K5tL5P5&R5&G]˴&bP<t2X<t  ø@&c  R>H5t!>5tt@&e%ZÀ>H5t>5t@&e UW535 _]U]U]U2^]U졳5N^>H5u>5tut&]U졳5N^>H5u>5tut&]U^^n >J5t$~p  N 5>H5u>5tut&]U^^n >J5t ~p5>H5u>5tut&o]U졳5^>H5u>5tut&]U5^>5t>J5u~~&pM&GN>H5u>5tut& ʀ>H5u>5tut&]U2V2F+;Vr]UPL ]˰CBBa aPa$aUVv7,5v9<6:59^]UVv96:57<^]UWV!2^_]UWV5؋~ ~t~~V +VB^+^ tW_Kʸ ^_]U>K5t9^^@&c;uvV>5]U5:9~=f%A ]USQVW $_^Y[]˻$2$"*5ACRInvalidDenormal Divide by 0Overflow UnderflowInexact Unemulated Square root Stack overflowStack underflow error 2100: Floating point error: ^^P$b@!XP,ִ@!˺b@!9X2P"UWVvF7u.FFLj~F|u^_]UWVv<.tF<uF|t/ )6=P)6+6X5.+6957<=35ȺM⑰MװCW߾57_'6=(6At G#Tw=:zc%C1<8G; yW_F t'W%tS2!CFL!::7%!;s EtUvGP:]U9 U:U;V!r3]s ]2ˢ7 u#>7r <"s < r<v8ט7ÊUWVvDuD@tV=D㋇6FV6DP= }K~tC9PFP2 9PFP1 PFPvT,FPyV+D^_]UVvLx * V^]UWVv ~~u+:9u%t:9jut`u vG-_^]3PPPPp;t3‡<9>9 tڣ3HH  Ì؎N3ێ>9 ҌUVBV tVvv6+^]UWVv7F PvvHvV{8^_]UWVv Ff FF~t~ uFDuD6ts~uF9DrP4v,F)DF҃|t"t4v,D)FFDV@t;^FLjNvvDPNQ ~)~u DF+F+v^_]UVv DtV#@u++D*DDVvv6^]UWVvDtd~ w^DFDtW~ uV)FV F V=Dtdv v vvHt=tD uND6u;PG-D tDDtDLJ6DP+PPvHFVu=tP+PPvHFV+PvvvH~ u!F F u<DN^+N^ ~ u FVFV D㋇6F~ }FV9V ~|9FvDtFRPv vkbN^ +ډN^|tZFRPRPFV-RPkbRP?b;Vu2;Fu-+DD^7tdDO ~b? uOL+PvvvHu=u;D6tvNQD }Dlj)|+^_]UWVv|}DDF7 t DuP+PPvHFV } Du(D6uDȋڋFV++DFDt^7t| = uFG9FVv{89~u Lx *V P^_]UVvV=V Dtd+PPPDPH^]U^_OW]UVvV=V6~uLdDƇ689dDƇ6D6FDD^]ˋŋ^wgNONO 3ˋF u@^wgONO N/U~t~t : :t7979~ u~u7777->7u#5!77/%!F7F 799;7u ;7u3Ћ]˜PR9؃>7u77 u=tb97u297u,UVVEE<u7F7F]ZXˣ9 9UWVQS7777P9DD[Y^_]ZX˸0NV us 0 t06$9$96"9"9ʻ:XZ:6.:SQR2PP"9ZY[XEU؍F PvvIT]MXEU67v vvR]MU WV EBFEEF PvWHMx ** W+P^_]U WVv EIu5V3EF PvWH?^_]UVW~3O~߹Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWVv~AZ $ t tFG:r:w:r:w:u3:t rIIы^_]UWV~3Aً~^_]UWVvB#v3Ȭ[#:uA^_]UW~W3@PG-[ u[ P2_]UW~3@@_]UWVN &ً~3ˋvD3:EwtIIы^_]UWV~vߋN t2^_]UWVvq"v3:t ":tH^_]UW~3AOFG8t3_]UWVv"v3Ȭ;":tA^_]U WVv~F7u+PPV3PV eF t ؋GƉ^tVW~n:_^7"^VW~w_^VW?v_^?^_]UWVvh!v u6&93 t-w!:uN3h!:t u N;u3 D6&9^_]UVvַaz 2 :r:w*Ȉ F^]XEUظ=v3PG-F u 7 (9Pv*9Pv2P1P1FF^?uN^? tF^F ^v3HHF=~78^F709Pp+F+PPFPFP674< @u v9-4vvv+P)Fv9-v9->7uF]MU*!ډN,!2PPPP*!;Xt <uӋN2PP-PxT ~t^W]UVW`WUVvDtDtt9-d+DD^]UWVv ^=atD=rt =wt3+FF^?+uNFF%=t=t3=t3FF+Ft^?tu@߿ ڋ^?buPWv\F }qFtDFtDD89FF*^6DLJ6+DFD^_]UWVv89B6u9D u3D6uDx]ƅ6Dž6Dx]NJ6tZ6u@Du:D6u%>F6x]tDx]D@ƅ6Dž6d+^_]UWVv~uF69Du V=+e~t_B6uDPG t V=J6tZ6u1V=@$DDƅ6Dž6+D^_]sAwtBH;st4Dt L+HLƌڌ;t&>9&B9=t%tH;stDG t&B9t،;t&:97뼋w3j;t $@@^t MtNN뙌،;t&>9G3QEt+IAA&;@9vurr #+ uu3YRQtWDw+JUXYZSP3RRPPp;Z[t UWVv~Ǚ 0FǙ0F^_]UWVv~ǙdPVj:ǙdRVj:^_]UWVvD9D FDFF^^:^^2:EFG~|݃tWj:tGWj:tGWj:4GWj:t GW:D9^_]UVW~ u8X7VFHuSr'H67Ht;t DFV:^s07s uڃ۱H!r钉T673_^]ˋN9Lt 7u?r9ӎ;u9T7s&;u ١7+؎J!r ;uT7U=WV~u7FvFt3@F<uF@FF^7u N~~|^9P3FFFPG-F^ u.~ t v 9-7 7v9-F$^ ?v+P4W2P1@<uރ~|N+Pk9PW2P1FGF^7t7GFFN uGF^_]YZ+r ;|9rRQˡx9@u3CRQ.x9V3622Ut PH^U^>!rƇ7mUދVvG!]UWVv+D$<uBDuD6t)+DF ~PtDPV;FtL DD^_]UWVv~ Ff FF~t~ u+EuE6t{~uF9ErPV5,F)EFԃ}tuV5,E)FEMx * WPE u"FNvVEPVF=t)FF+F+v^_]U츄=WVv@F @F@&@F @<uB7t"GF7u<%t+@"@@ @ @$@@@|F<*u@F7t3@@ȃ0@7u t"@ @=FtP=NtC=ht =lt1=pt<@>@t"@u @"@+PB$@ PC>@t >@tPC.@@W@@@ @Ox @؊* 6 @:u&&@PC.@@@+ W@6 @WY`@9K"E,AA^B^BBBBBBBBAAABBABABBXB>@t->&@u!%<tPF t uߡ&@F^_]U=WV@7v>@u@> @t~tH>@uA"G:F@t9~t>@t @9u>@u7u>@uLjF]G uu@>"@t>@t@6 @WY`>@u~t9vt&@^_]U=WVv+FFV9$@t9 @t 9@tME>~9u"GF-t+u-uF@F]G tTtO7tHu+PFPc7tE 7tW0+puD8}PFPcUt@6 @WY`~tWFV؃ډFVB7tȋFVcFV҉FV0ǙFV @4@FF>@uC> @u>$@t0>@t>@u@FVW @F&@@^_]UJ=WVF> @t >@t3+"GDE@FF+t-u$-uƈG@ 9~vFƈGFV~F u߃.u1]G t(9~v#9~vFƈGFV~F u߃~taetEuW]G tN9~vIƈGF-t+u&]G t-u9~v 9~vƈGFV~F u@6 @VY`>@u)~tFP6@@%Pr&@@^_]U3=~t^7t]G t+]U=VF;vu+u@6 @VY`^]U3=V@ @Ox @7* 6 @^]U=VF7uu@@6 @VY`^]U3=>"@u>@~@+]U^}| 7@t3]UV^^W+::FVFP/Z>:t)V}_ tFVFP/ZD^]U^F tK~ t3ɋѸB!rPF uFV y+;99ѸB!FV y99B!ՋVN F B!r7UVW9V:;t@t 3_^]UWvH t3I@!_]Ub=WVv6@F 2@F,@D@B@N<%t<@+:@(@>@0@4@*@.@H@J@8@ |0u;F8@02<-uJ@'<+u :@*@< u >:@u *@H@FP$Q uV@@PP<.u4@FV<@PP=Ft9=Nt<=ht'=lt=pt%0@>0@t@H@ PK.@<@(@4@>0@t>0@u;0@2@PK:PZN.2@PK2@Z+PL닸Mz>0@tNNJTJJJJJTJJJJJBJiJnJJJJJPJJJJ>D@t>B@uK,@G uB@u,@G tB@^_]U=WV~ t>@>0@t>0@u2@WFV2@)>>@t2@FF 2@FV2@>H@t F FtF+F@66@>>@u*~}$~ u-FFV؃ډFVFFvWvv6>4@t"W3<@+ȉN0FFN >(@t>@u:@ *@t ~u+PO^_]U=WV8@ ~t2@F^2@>0@u2@WFV2@2@FF^2@>0@u F Fu9 ~u 9F^FVFV+FF^&?u>4@t ;<@v6<@>@@+>J@u WNVvvO>J@t WN^_]U=2@F>4@u<@6(@6<@v66@v ~gt~Gu>H@u><@t 66@>H@t><@u 66@2@F@:@ *@tvR t+PO]U3=V>D@u6,@OxF,@7*6,@v@uD@B@^]U=WV>D@uOv ~H1,@Ox8@,@?*6,@68@@uD@N ȃ>D@uFB@^_]U=WVv >D@uR;,@Ox^&,@?*6,@^&P@uD@FN u>D@uF B@^_]U =WV66@+FF>@@V3F++~>J@u<-u>8@0uPZNN>8@0t ~>J@t~tF[P>F@tF~P>J@u,WN~t ~u[P>F@t ~u~PvPO>J@t8@ WN^_]U3=>:@t+ PZN]U3=0PZN>F@u>(@tXxPZN]U=WVv<*u2@2@F:+<0|3<9.9>4@u <0u8@0ȃ0<0|<9~^?^_]U=V9 8FuF<u+^]U^7t3ыN V?!s /7t(VW :t<u7G+_^ы]˃t< t7@tD! u 9?!rϰ /99?!r t~ t ѸB!>9 t V뎋V대>9 u뺏997&>7rEP,3ы&8uW^[%+ $+C P܋ t 7tNV72 t #uEڪKK;sD܉&7.9< t< <\u<"u<"u< t<"u|\uOXEUظ=WVv~uv v VY+PvPFPFPv v W @u\PV3 u.PW1 tvvPVv)FV3PG- u v9-뒸9PVW2P17vvPWv)F>7u19P.PW3P2vvPWv)FW9-v9-F^_]MXEU3=67v vvr]]MU WVvQRPD3+¹3+™RP?bFV^㋿9ƙ u~~G<RPFRP?b+SQȋF ڙRPN^?bQSQȸmЋF ǙRPN^?bFVFVȋFڙځN^F ljF^::FVDPFFHFF F>:tFP}_ t n^FV^_]UU73ɋI6, tEuE@$W _ϋ.73I<;Ct~EE uN]]˿9߹3 tȀQȀY3t@UV:6Du+DDDD ƃ;R7u+^]UVA!U^7 tB3ɋ!s7uN V3WVe @u2Q+I!s I t/F9@!s 4 tYQ +!s  u7@t ^?uYr^_&̋N űV@!s u7@t ڀ?uɋN FV~ W t u y -ۃڋ3 t0<9v' uODO;rX_^]U=WV+9vu7F~t$FF^F73@^?uF^7uNu~tF~t^73Fv6@9@9FPG-F u+FPG- u7 76@9V~6@9^ ~?F$F^ ?~t1FF!+P^7W2P1@F^?u׃~t?+P9PW2P1FG+7t7GFNuG~t^7W2+~G^97u9wt GFFFav3F=}~77 ^ 79-v+P^7W2P1F^?t GF^F u ^ƈF^_]ˋ:.:7VUWV:6+Dt V=@tG96R7s^_]U WV^4|?s,V@PR@+\@Z@T@L@N@P@X@L@3RP^w7aV@QRPV@@3+¹3+‹RP?b3SQ^w7FVkb+FVFV~}(F3VV@@ u FQVOV@ҁV@V@ uV@d u V@ u99.V@lQRPvvaZ@QRPFPqcT@T@T@Z@9|T@T@+R@RPvvaP@RPFPqc<RPvvaN@<RPvvkbL@m.V@Z@-cX@\@q^_]U2>9F2t .9%=uvVF$ Ǵ=!s=uF%=u >!ƸD!€t 9v9>!:t VC!tQuL@u]:u@ 9V=!rѸB!ٺ9?! t>9uًѸB!3ɴ@!>!F$ 9V=!r7FuU:N %N 29uFuV!F$ 9V=!r:uF t VC!rXEUظ=WVTv v vvRF@u,>7u%^<\t t:t:Pp+ uFPV*PZ3Ft <;t G<uTW3؀y\t :PW1vW1v v WvRF@t}>7ts<ukF ua^_]MˋX7r59T7s%Pرً7+ËشJ!Xr$HT7.X7X7Ë+UWVX:Pp+ u<uPV6:Z3RPV`RP?b::+ހ?tފ7u ހ?-uG|؋ހ?tPP6:Z3::?t+:^_]UWVv||| ~+|~ | }| l\㋇9@FǙ uǙd u Ǚ uF| FmȍEٙ3+¹3+FF+‰F|u9D,9Dth|}_F9D|9DtM||D^_]UWVv~EttE uE6u 9Eu}uE ƈe*^_]EaU9NlNV2؋N VF u3RPv v ?b;Vwr;Fv3ҋ t؃[^_]UW~F ^ Nt f_]USW3F }׋VFVF }V F V uN F3F3 uGL؋N VF u3RPv v ?b;Vwr ;Fv+F V +FV u؃_[]22U^v vw7a^W]U^v vw7?b^W]U^v vw7kb^W]U^WNc^W]U^v vw7"d^W]U^v vw7?b^W]U^v vw7d^W]USVF uN F3؋F>ȋ^ VF u3RPv v ?b;Vwr;Fv3ҋ^[]USF uN F3F3Hȋ^ VF u3RPv v ?b;Vwr ;Fv+F V +FV؃[]UVW3ۋV _^]UVW3ҋ^ _^]؎NvF Nf:U]+vv^:2 uE]5>:=P::X5.:>z:6|:Ή~:::3 u8: x:6|: x::uBt0::5.:=É:+x:>z:7:9x:X0%0u߃ tǀu ǀt >::C3ɋOrHrӋڀt3ɉ::ù23`t?Nw:t/<+t<-tu%N:Fu@ut 3ۉ::>:>:u+>::~:}ʶ>z:>:v557.::9>:=:Au 9=mË>z:9W3 _3ߋ׋^r9 u :OPDXЃr5s>@ x H43V:^7.:WUS XXXX@+X02ù߃ tǀu ǀt >::b3ɋnrgrP&:&: urXs9=mû.r wxrt <+t<-tN N^t,0r< ~,::}2FN3(ux:uu$t<.t,0r< wδu: :2;6~:s#>v:t< t< t< t< t t~ u F G +F-=v.~|~|~s ^F^&w^F &볋G %Fg O ~u7I^ 7 tw~ EGog7aaG^_]UWV>2t +LJfF |v^7P0@u+W>2t2EGGGGG G +EGGEGG^_]U]U욕]U]U]U>-=wr.P^2w^MP ^ۋ ^+PP62PMP ^ +27d]U 7Pvq%h u 7+PRP6h ' u6hPPFP%=uF:PFP2 t7e6hPPFP%+Pvv6h '6hPPv%^G+|@]UWV>6t2JbRء2G$W&FVGFFVFV9Fs*F^2&FF^F&*vˋ^G(W*FVGF#^&u 2&G^&*@)FF~u׋^GF tY+4hYF؀?vu(2GePPPP8G|6^_]UWV>6uRءJb)GFG$W&FV.F^Jb&)FF^F&*vD)F~w̋^G(W*FVGF#^&u Jb&)G^&*@)FF~u׋^GF t^+4hYF؊b*P_P>b*PtP>9u>b*-4= v.\PXR>b*P_P>b*-أJ>b ,>b>bPtFt _F>b_*tFFt_*㋟7Ft@fF_tt]U+ttƇ,]UVt󊄕8u+t󊌔8u+t.tttƇ,f^]ULttƇ,]U_ttƇ,(]Ug]Ux_nttƇ,_*㋟]Ux_n_*㋟ttƇ,*]ULttƇ,]U>_sk 6 LttƇ,_*㋟!]UVPFP6PP8 u+~lr~ov~r~v~s~v_F>b_*P_P_*_*㋟FttvF^?u_*みu TƇZF_^]U64ttƇ,j]UP>bP6PP8 u+ 8:]UV>b*>b_Ƣ>b^]U>tPvvv / +]U{>b*P_P>b8FF>t]vP66H/  uvv66/  t3P PvvtPttƇ)vvtPu]U >b*P_P_*P_P_*8>b*FF8.tZvP66H/  uvv66/  t0PcPYvtPttƇ) vtPFVZ\GX]UWV;>b*P_PA_*P_P1>b*F_FFZ\~v>b*P_P _*P_P _*>b*X6\6ZP tfPr Ph _*PtP >b*PtP ttƇ:VtPw WtPl ttƇ)C_*PtPM >b*PtP= ttƇ:VtP% WtP ^_]U>b*P_P >b*PtP ]UV>b*P_P _*P_P >JtJ6GF_*>b*FF8.tCvPv/  t0P! P vtP ttƇ) vtP| ^]UIttƇ,_*ヿ}]UttƇ,]U>b*P_P >b*%x_>b*%n>b*%8Nb_*%L]UVLl>nu/P, 6x_ ttttƇ)_*6Nb拄z ^]UV6l>nt_*6Nb拄>b*%x_>b*n= urx_tG_*LJ Pe x_%PP ttttƇ)_*LJ P 6x_뺃>n u3>x_u_*LJ< e_*LJO>nu_*6x_拄>nu'_*6x_拄z ^]UVLl>nt,._*6Nb拄z _*LJ^]UVl>nuV>NbvO>x_sH>b$Nbt>Nbufkf_*6Nb拄^]UVLl>nu,Pg6x_U ttPG_*6Nb拄Fz ^]UVtl>nuGP6x_ttttƇ)_*6Nb拄f(>Nbuli_*6Nb拄Vz ^]UVLl>nt#_*6Nb拄f PA6x_/tt P!>Nbu>x_t_*LJ'_*6Nb拄z ^]UV/l>ntx_*6Nb拄_*6Nb拄z ^]UV(_*6Nb拄fz ^]UWV>>bu_*LJ >b*p t=t5=tJ=t[m_*>Nb狅z D_*>Nb狅Պ_*LJ _*LJv^_]UV5_*6Nb拄vz ^]UVttƇ,>LtX_*6Nb拄Fz ^]UXttƇ,>Lt3>Nbu_]UV"xttƇ,!>_v P ttƇ1_*6Nb拄z ^]UVttƇ,G>b*P_P~>b*PtPn_*6Nb拄z ^]UVYttƇ,>_uH>b*P_P>btttƇ- ttƇ+>b*PtP_*6Nb拄Vz ^]UV_*6Nb拄z >NbuttƇ,>LtqE^]UlLttƇ,NbuNbP]U/LNbu>NbtNbPttƇ,K]U>ttƇ, ]UttƇ,]U]UWVj>nu>LtZ`>lt9>ftttƇT#_*%=v=t ttƇDttƇQ`%P>JtJttƇ:ttƇ[X>x_u(>nu!_*>b*+Z\x_=wd.! T L X> . Xj Vb㋟Z\>x_s.ttƇ+W.㋟+Z\n=t=t"ttƇ]^_]U>Lt NbP6Nb]U_*㋇J,>b_*P_P`_*]UVv tt<u^]UVvtttt^]UWVv~>u_t)DZP%P{^_]UWVv~DZ PUDZ%P=DZ%P%%P^_]UVv v70^]UV>b*P_P>bZ\>jt)>t"V gP t.tP=>btttƇ->b*-ttƇ+>b*PtP^]UV}>b*P_P_*P_Ps_*>b*+҉FVZ\_t&ttƇ-_ЈFЈFFuF ttƇ+>t;vv>JtJ6GPH/  t P/_tF*N*FFvvtP^]U>Lt x_P x_U]U>_t>_u* >b*P_PW>>b t>b*PtP@>JtT>_nr>_ov>_r>_v>_r1>_w*ttƇ JttƇ:]U_*]U~t~u#>tv gP t PK ^]]U WV___Ƈ >_|>tF >+<F:`+Z\`Jl7F6 g6~t*PF^?tC``vF66`P``Ƈ:6:68`P<9`}F `+<FF<_F+F>TF+F@tFBfFD>b_*P_PQ_*_*㋟FTTvF^?u>t+Pv FtƇ=tzƇ ffƇ;ffƇBffƇRFFF 0^FFF uffNvF9FufƇ~ u3>`u)tuƇ fuƇ >JtJX6X拴ƇSƇ:6\6ZP(Ƈ=>XuFX㋟6X>`uDZ\P>bPXPv8 u/c>b*PPl.Z\P>bPXPv8 u0)>b*PP2Ƈ^6^_]UP+PFP]UWVFF.+ʄn_fvd@?t[̄ãg4F u&6d@ t1Ąみ| t+w6d@ u v^Bb?t̄ãg4F tP6< t#Ą| t^.^_]UF4=4<4? t?t 44? u4?u ãBbd@o444?;tXãd@ 4?t 44?,u4?uãBb+444?;tãBb44?u]UĄ~ >Ąt>Ąu P>Ąu P t =t =t7A<6d@J tĄ| P P +]UV>tP+H>8u6n+60|~ 5P Ą~ EV>^]UV>tP+6n+608=t=u=un=rL=v=tH@| >Ąt>ĄuPV?PDP>ĄuP6n6f͸Pe>Ąu 0b멸PE>Ąu bY fP +Py  tqPk^]U>nt8>tPK+CĄ㋇~ %P6n>uȋĄ~ ]U>tP+!Pv6ʄ6nb]UF>tP+8=u=t =tT=t"/Ą㋇~ 0bPo>Ąu>0bu PMTFF0bǁ>ĄuP>Ąu+0P+P uU:룋]UF>tP+m:=t=t PT>2buF >ntF+Pv" tk+P t>:u>nt 6n]U>tPN++PP t+P']U>tP+p8=t1=t=t'=tPNĄ㋇~ 0bPr7+PPX t>Ąpu+Pt+P͸Pċ]U>tP+8=u=t=tP=u=u=:=t=t$=u=tv=u0b PP=:=t=u=t=t9=tU0b +PPs uY0b 2b Pcx+PPI u/P(P62b 0b뽡:=t=| =~3=tOPp+PP u+Pd!PP uR+P%}P >0bu;뜸P :=t=u=uĄou+F>Ąou+F>t P ^ヿ0bt<^㋇8=tT=u ^ヿ0bt^ヿ8t^ヿ8tvĄ㋇~ P7vĄ~ ^ヿnu 6n ʸ2L]U>tP +E>:us8=t=t=t6P +PP;Ą~ Z+PPĄ~ 1+P`̡8=t=tb=u눡:=t=t%x+PĄ~ h+PĄ㋇~ PPu7:=u+PĄ~ d뮡:=}=~PĄ~ 2+P ]U>tP +8=t=t-=uP` {+PP:=t1=tZۡ:=t=t>̃>0bu2b "+PPbYf 2bP D+PPzP`++PPa:=}_=~W+PЋ]U>tP + >:uo8=| =~=t?Pv >0bu+PP+PP+P +PP+P+P١8=t =tC=tX돡:=t=t+PP3]+PPjPPZ:=u+PPKʡ:=}.=~&+PP&+P]U>tPu +7>8u&>nuPP6n P: ]U>tP" +8>8uĄ~ :=t PPc]UbY2b fP[]UdY0b fP5]Uv]Uvq]U^㋇n=t=uFv #PE]UF*bY fP]UĄ~ ]UVv㋇8=|E=~'=u;㋇bY t=t=t 6_aヿfu6_{P^]U>:u-n=t=t%n*;nt 2Ps6n 6n']UV+64:2 uy}$̄LJn̄㉷0b̄LJ8ĀLJn}̄LJ8̄D̄LJ8̄D0b̄㉷f Ff+^]UXWVvXvFP2GP1P3 tVFPE t*n̄ヿnubPo =}E@FPwFP6 t4FnFf̄ヿnu.9ft̄㉇n+^_]UWVF+F̄㉷bȲ㉷0b̄㉷f 4?[tc7t?: t ̄؋0bf̄LJbY+FP64 u FP64 t44P9P3 t4?ūLJ8>̄uFʄ4?[t _4̄LJ8F_4P>P3 t 44?uۋ4?u WV,47u4G7t4FGFFPEP:2 u t.FPHP:2 u uܾvFPKP:2 u t/zTFPNP:2 u u޿7FP640 uxFP64 ua4F_4PQP3 t4^_]UWVv~>_t%6_o =~̄㉇bY ̄LJbY tpu+̄㉇f t̄Efr̄fF؃?t^̄ヿbYuF̄ヿfu9̄LJbY+ t̄Ef̄LJbȲLJf^_]U(64FP2FP4̄LJnPFPXP 3 ūLJnPFP]P 3 tPFPbP 3 ūLJnePFPhP 3 ūLJn ?PFPnP 3 urPFPqP 3 u ̄LJn̄ヿntm447tu64FP2FP4PFPtP 3 u 44? t ? t?[u&+]UV̄LJDb4G7tD=Sui4:u_7tD =ct=dt=et#=st,6̄LJDb.(̄LJDb>̄LJDb& ̄LJDb6̄ヿDbt̄Db 4^]UPFP.PP u 02]UPFP.PP u 02]UF=t@~= t"f=t=tnxPW︜긯۸ָѸ̸7ǸS¸i뽸븸본뮸= t=t=t=t-#=w.U21@2@2@2@2@2@2@2@2@2@22 2@2@22@2@22@2@22@22"2'2+]UPW]U4? t? u4]UWVF9~HFǙ+ދz v:2F }Oʃ~~DF뼉6Ą+^_]U:WVRvLYPb u+=F+FFFFFFFFF|@F+P6NY6LY6h ' u6hPPFP%=uhOx 7* 6hF2PG-F u 7 Y>RuFR ^FGFF؋v6hvƸP1P%;Ft vƋ^@1)FF2~~9RP, u^GF u6h#^_]UVvV9 u*D0%V tVy tV tװ^]UWV^GF uv$FV u 7 +o^GWPYRYFV+PRv6h ' u΋^FVG$W&+9Fv)hOx? 6h^F&F^_]UWV^GF uv$FV u 7 +o^G W TYVYFV+PRv6h ' u΋^FVG W"+9Fv)hOx? 6h^F&F^_]UWV^GF uv$FV u 7 +o^GWXYZYFV+PRv6h ' u΋^FVG(W*+9Fv)hOx? 6h^F&F^_]UWV^uS^GW\Y^YFV+PRv6h ' t+ hOx ؊* 6hEPG-F+%hOx "؊ 6h^F;|׋^6hPPFP%FP$FV u 7 X^FVG,W.^F&F&G&GF+9v6hPPFP%^F&6hPPFP%^F&GFF^_]URv#^GFS9-FF uۋ]U^G G"tw"w $^G$ G&tw&w$$^G( G*tw*w($^G, G.tw.w,$^G0]UV^&G8b&:b*ftF*fv&DG:b2u 7~un+PP F@tR=u;dfPFPbPP8~!u4nƇhYdFv P  tvP62vF t\_>2tJ >2tH~uBb.df+PbP @t.O0 ~t 4nƇhYeF^_]UG$f_G+ң&f(f__]Uh=u(=u=t!=uY=u=uv dfPFPbPP8F*=!uFFFPFPFPP8FVPFPFPP8FFFFF PPtPFP F=u.v  ~tvP  PPtPbP F=t=NjGbG dfP PbPP8GG J GbG dfPPbPP8dfPPbPP8dfP PbPP8G pg GbO ]U >2u 7L5F*=t7v=u=tdf+PbP @udfPFPbPP8dfF*=4r=;v'=<uPFPbPP8dfPFPbPP8dfF*%t=@uH=tJF$<t>d1d)d!dfPFPbPP8F*%FF*%8F<t:tF t=t=t=tF$<u|dfPFPbPP8fF*=ur=uj=ub=uZ=O=u w=r=w v P V=r=wz=uظ PPtPbP =u 7FvP FF]U>2t+PP62P2]UWVF+4hY=et=tu PFPEPP u+ F|Ÿ^_]UWV+4؊hY=et=tu,Vw 4PpYPjYPPF|^_]UWV+4hY=t+PvEP, u~u =et=tu F|^_]UVRPPY/.fP;62tu縏 RPPY/u 2+N.f$<t(.f%6 u.ft P2.f6=t=u6^]UWVvPV @u+}4hYF؀?u u]Gݸ4hYF؊FVW_^F G v  P2~vtPFPVP8 u^_]UWVv4ƅhYƅtY^_]UKF2u 7+m PfPFP,0vGDGJ PFPvP8PFPvP>t'+PP62P tAOJ F9G sRPFPvP+PP62 PJ PFPvPF9G sa>t-'>2uPFPvP^ 6^ D PFPfP,J 0^]UV+4LJrYF|^]UVvvF7u <_t<$t<@u+F=}FFƄƄF+F^]U$WVFPFPF܉F~@tFPD/  t*fGnFv3=uS+v:2 u*fG狅GGF |ŀ~@uFPD/  u7+^_]UP6Ƅ3Ƅ]UƄƄF<\u'ƄƄF=bt$=ft)=nt=rt=tt F    ]UVƄ<"t F u<"t 7+F~P+P^]UƄD**fGGgƄ?'t 7+Ƅ]UWVv+DiTFVFRPVcF7tEЙF7tEǙ-7TT9Vrw"9Fv 7+$ƄƄFvP  tz^_]UWVƄFƄP6Ƅ3*fƄ9Fu 7+*fGG^_]U V4FƄ?0uf.t`ƄƄ7tD=Xu ƄF5Ƅ?nu ƄF !FPƄP  uƄƄFv؊P  tKFPvh u+ƄF<.t7tD=Eu)~ u#FƄƄ?.u~ t7믋Ƅ7tD=LuƄK~wr~s *fG:~wr~r"~ t*fG~ t*fG *fG*fFVWG^]U ƄF7tU~(u,Ƅr u+Ƅ?)u Ƅr7F7u <_t<$t<@u)ƄF7FFP> uF7FƄ놀~'u~"uC~.ug7w]UWV*fu 7+p~t+6*fQ t9 t݋*ft9 t‹*fGG^ t6*fg t~t.*f"^_]U*ft S  u 7+u7 *fFƄ?)t69 t̚r t6*fQ t Ƅ?,uƄʋƄƄ?)t7늋G FlG ^ww F u'*f9FsKP.*f" uFG ;F"Fv tكF"*f9FvF*fvv6*f ]U"z u+>Ƅ t Ƅ=(t=-u=.tC=[tƄ9 tr tƄ?]t7Ƅs t닋*fu 7 |ƄƄPFPN u 7Y6*f  tFP uFPn t+ u+Ƅ>tLƄ*fu 7ƄPFP uv uFPn]U&VFƄ7uVFP{ u BPFP2 u7FƄPFPB uKPFP2 FfOPFP2 tVPFP2 uК ƄPFP u 7+ Ƅ?)t7 ƄvvFPFPV2 t F^7 u^?u^vD~tދG$<u 7z^ƄPFP: tF\PFP2 u^ aPFP2 u^@ Ƅ?*t땋Ƅ?*u^ Ƅ ƄF<)t<*u7Ƅ^]U ƄF uK^?(t+hF@Ƅ *fPFP=t t=t 7Nj*fFG6*f*fWGG+GG]U+PsRP^]U+P RPI]U u+P Ƅ?-u-uƄP RP #Ƅ?+u+uƄPsָ]U  ƄƄ=(u~=!t =&u(FF tO@FZFƄ?-t FOFƄF F Ƅ?+t 7+ ƄF F 띡ƄHFFPFP<=t t=t7dFƄ t~| *fFGFVGWG6*fQv6*fwFF FF=*t=+u1=-u=~uƄPP6Ƅ, tWƄG7tCƄJ^]UƄF^F8uFF^F u^?u FƄ+]U7d+]UV`P[ u+a ƄF^FV"  u F^7 u^?t9 tr uFƄ.*f" ^_ t^]UVv=t = t=t~8|+ F؊7*%F؊7*%^]UvQvQv=  t)v=  t 7+4vvO $v=  tvvvv1׋]UvQvQv=  uv=  t/Pv tPv t+vv1]UvQvQv=  uv=  t'v tv t+vv1]U6HYP_PV t FY+]U>FYu+ FYHP]UWVv tUFFN~~)VF$@tt tߋ^FLj< uN^tuF9Ft+^_]Uvo ;Fu~u 7+o>HYug&7 u7v t;FY9Fs[FY9Ft  u먡FY9FvFY9Ft˚  u덋]U+PPP6HY '6HYP_PVFY]U>ntx@HPA  u]U WV~W u+z@+ggNLnF@W3pQWF2F;Fuv3WF3;Ft0v.P2W3vF3+^Ƈ.W t [ksPvq% u 78VP_PV tvbP26HYXPbP:2 t*oFY^_]U>HYuHYoFFY_+>nt9Fs$+PPP6HY '+PPv9Fw[x@;FwOv t@x@H+Px@@@6HY 'x@@@v9Fs^+ヿ@u@uv u.^+㋇@@FVFFY+PRv6HY '6HYP_PV]UVx@FV@@LJ@LJ@F|6HY dx@H;Fsa6HYPPj$6HY)FVu =u+1x@x@FV@@>x@t HYGtn^]Ux@㋇@@FV6HY +Pvv6HY 'HYGuCx@H;Frc6HYPPj$6HY)FVu =u+.HYGux@x@FV@@>x@t끋]UWVvPvq% u 7+G+}?VF$FDt t$F؊7FFWuFu7G^_]UWVFF~ |~sFaƙN^+ډN^V~v^+PPFPFV9Vu9FuFFV)FV9V|9FvN uFFV-^_]UWV+Pla t5FYobPXP2P_^_]UWV6zNޱ〿vu^9uM|~EU9|8|9zw0^狅rt9W|9Gw#>ua+P^ww7^_]UWVv~>t'~u!uu5/  t WVF8~t(>t!uu50 t WVZ WV+^_]UWVv~Ʊ؋EUrtƇvPPPV?#^_]UWVv~ƱF؋EUrta^Ƈv_P6FYPPV" ^_]UWVv~Ʊ؋EUrtƇv+PPWPPPV"^_]UoF^ww7/ t_a t]FY|9sz9pv ~u#9oFYPbPXP2>2t v]UVvz+|+F|V ^]UWVvx ta+P6FY` t#؋GWrt؋ޱLJrLJt_P6FYPPVT! VޱƇv^_]UWV>u+㋿F^9u~tL7PFP1| FPGPDPFP!F^F }iFP^_]UWV+ƋV,G # #x<;u~t6G t PGPDPG tEEP!F|G x<^_]UWVv狅V,1G +P^_]U>t)6 tU^6 7]U>td^+P6_6_6_]UVPFPVPE F96}>u* t~EP["#~OM")6d^]U츨bP3 uBfP3 tBfPbP2 th]UPF PFP1bPFP1PFP1PPPFPObPBfP2]UWVBfP3"PPVPF;|Bf^_]UWVvvvvvvvvv v vV~P1 GP =u^_]UVv P <u P ^]UWVv[=u;tROP C=u->t&PW*P;P벊P  tG < u P ^_]UV>u>Ct C + t暧*'>CtC + tܚ*F~u *PE@>!tKF= t =t=:t7t!DAJ: P,PF=t=t#'s  u2>u ?Vr^]UWV>Ct C >u@Ox F?*6@FP~uJ@Ox ?*6@ P@Ox ?*6@P>u>u D6xFB6B6*B6PFP~uD6x B6B6*B6P PD6xB6B6*낸B6PPo>6b6u6b6H;z}~u 6b6bF_b@jF tW=u= u= tF7 t~9t*PW&>u6b6bF5F 6b6bF9_}_?>uk>~*PP&>ug>6b6u6b56b뾋6+F9v} P F2+^_]UV66bV V P V < u^]UF>!tgF=Ht,=Kt6=Mt8=Pt%=yt5؊P u.B{-tm P_JXF=>uc~=!u~=u =u=u=u=u>u  >u1>7t>@tI>2t?~u6.fPP>u/ 륃>u뗚[됃>u낚z>ukc>u6_bKC+Ps޸ٸԸϚ>ui2>@F>ttP+Pπ>u>t2뺚본PӚ*x="u[=.uI=/u-=;uH=<uH==uH2@=Gu2=?uM=@uW=Aua=Bu`=Cui=Du}=Ou=Hu=IuE=Pu*=QuH=xuM=yu[}>7tP >@u>2u ~t]UF-;= wp.|^u=&t =+t =-ubU^[d^T>M@@9P+P(!P2")JQ^ev}>7t]U>u 6P]U>u62]UVv t$=uFޱ㋇rtFVFF+Pޱx` tP2^]UWVvPV @t4؀hYdu4ƇhYe;+PV @u!5PPePV =u2 Ww #^_]UVv t$=uHޱ㋇rtFVFF+Pޱx` tPq2^]U>u)'++P2 -'#]UWV+F؋ffF„H; W= u㉿f^_]UWV>ulz+|=uV~^F+7F>z狅bdFVf u+PPFPVFPzHP(z+|=t>z狅h@pzHPzHP#^_]Uv vvv+P]Uv vvvP]U졂9_:9z}4z9_@_9z}jP_b@P52]U|9@z9|H|9~;z9}2+P65>ux2]U>u:]UWV>tz+ƅƅƅF |>up+z„+6fF96„56b+Ƅ6 F#|+ޱLJrLJtF(|_>t~E>t>t-'V_^>u a?^_]UWVH7EV36QVF2;Fuۚ  T PPV3-OP+PV#6dw)^_]U>u6 < t=t=uF FFv6_6_6_]UVvV)966bu+V< uV ^]UVv6u6N^]UVvF6u6^]UV„㋷f< t966bu+V966bt5u6D^]UWVv+nF>966bt=G;~}&PvFF*PvFFVS< u^_]UVFb@j+P P&F96~^]U>„~z@;_} _]UWV>„~W6f u+C>„F؋ffO 6f6~HPz@P+Pz@PV^_]U>„~9_} _w?]UWV>„~W] u+J+F؋ffG„H;„㉷f6~HPz@P+P6VP^_]UV+F96„^]UV+?F96„^]UWV66b V< u+'㉷fz@P@z@PV@G9>„^_]UWV66bV8< uVB>%+z㉷fWWV{VO9>z|^_]UV6|F96z~96~>u ^]U WV|@;z|% t =u|ヿzHP~HP|@P+Pzz+|=u6|FޱヿxtIx?6zƱF؍jVWr_^N|@;|؋Ʊ؋HxV|㋇:|؊~Fz|FV uz+|=t.6zƱF؍jVWr_^N|@;|ءzHP~HP|@P+P} u&>tvvv0 t FPVkt&>tvvv/  t FPV@z+|=uޱtrޱ|zFVFPVk|؋z|___~#^_]U|@;z}!zH;~>u ]UWV|@;z|1>uz㋇p@P u %zHP~HP|@P+Pz+|=uk>uzpzHPzbz؋jldfn u+PPbPWbPzHP4/6|ƱF؍zVWr_^F96z t=t6|㋇%|؋z|___~#^_]UV6| >Cu F96z^]UV6| >Cu F96z^]U>u P >u]UV>u-6FY+6z6| ~ V >u^]UWVv6z+6| ~uFz+|-P u>7tL~u9U^%F6|F96z~#FFxƅvVN듚#{^_]UV6z+6|F96z~ޱF9xu96zuv 96ztω6^]UWVv d^%FF_|FV z|FV__>|VFPW߱㈇vG9>z|㊇~#^_]UWV>uzH;u|@;||9z@;zu zE9z}Q6f u6„F؋ffN >f|;z zH;6bfP+>f[z|9zt6P6~z@Pz@PW„+^_]Uz@;_u>u >„~ @;zu+Z|9ztz@;ztA6P6~zHP9z„z+|=~]UV|@;z}6P6~zHP9z}6P6~z@P+PPV6zF96~PP6~6z^]UVP P+P6z6P6~6zH;z~6P6~z@P|@;z}6P6~zHP|;z~6P6~|@P.-;z}6P6~66P6~6z+*P PV6zF96~PP6~6z^]UV>~Ou PPP6~P%96|} 6PP6~VF966P6~|@P6P6~6^]UVPP6~PP P6~VF96}^]UWVv~PPl^_]UVF6|V# tFF96z~u%^]U WVvFޱ㋇rtFV+PFP @uo@Pluޱ〿vuPFPV݃96u%+&P@FPl%PvFG9>~i@PluVޱ〿vuPFPVm݃96u%+%P@FPl PvFG9>~ՠ ty=t+VW~_^9FuƱF؋FV9tu9ruǀvuvu!>J5tPFPV܃96u%V'>ouޱ㡔9xts^_]UV9Ft.%+PPn@PF96~F^]UV>t*+PP.@PF96~^]UWVvvvvvvvvv v vxP1Fb@jFd<tL< tG< u;FF+‰F+9~~ F~9F|N)v P&GvP P&F~9F|^_]U~uv Pj6jvF*P6jj6b@]UVvFb@Fj< tv FD*P&<u^]U>tl++P >u >7u7FaF7>uP2 #]U>tN+P>uA>u+P2 #]U>|t||!|;z|]UV>|u*+*P PV|@PF96~|||9z}s +|9">uzH;|~|@|@;zu;^]UV>|tlPP6~|HP$6P6~6|6P6~|@P+*P PV6|F96~^]UV6P6~|@P>|tQPP6~|HP+PPV6|F96~PP6~6|^]UV+V)F |^]U WVnFF؀utF^=t=t>FP)PFP^G-P9PFPw 7I^~wXG^F+PFPFPGVP8^P^G-PMPFPw\ ^_]UVF>u>XtXFX^Gt+'q, t{^Ox 7* 6^F uD^Ox 7* 6^X u+'q, tF~t~u +F~ u=F^]Uq, t>CtB>Bu݋]U>uq,^Gu+]U6^ZP\P&]U%>`t+]U t]U>ft6FP3 t&F.bF*~@`P6>bt)+PPPP .b~@```]UWV>.btF~ ~~ u>!t0FڸRn؋ FFF^F?uRn؋@F~@9FFF;~@~~~ |!9Fuvs>!t|R.!؃u t_R.!~@9}89~2>.b~+>.b9~>!t/9>!t)1.b-P돃>!t(!2>`u+!6>`t>!t J^_]U>!t>.bu>~@uz~9~@u.lz9.bu~H;~@~Tz9.b}$|9.b~~H;~@~>`uX,5'~@;~@}>.b| >.b}Y 2]U2hPFP2" 8FPA6FP#FFPv2 tRvFP2Fv3-$؉FP^FPvFv^? u>`ts~]U>`u]U u q, t>`t u]U$6.b<]U6.b]U.b-P]UB|9.b}9zt0z9.b} rz9.b~s  u2>`u]U`FP>`uF`K|@;.bu=z9|t4H;.bt-`=t =t=t[zH;.bu)`=t =t=txqjcz@;.bu)`=t =t=tE>709.bu'`=t =t=t? 6]UF FFF  PP3P+]U>bDu b@YBYDYP@YPPP8 u@YF uBY@YFBYDY.BY(DY(PXbP@YPP8 ubiPXbP2 uXb>Xbvd+PPPP b+P>bt=+PPPPwPwP+P P>*uWP+PPPP+P2 ]U>bt+PPPP]U]U>bt+PPPPa]U]U+PPPmPAgP.g@YBYDY PXbP@YPP8ab*`b*]U^BYDYPXbP@YPP8^Yb*Xb*[b*ZbF]b*\bBYDYv^7@YPP8^F]U^BYDYPXbP@YPP8^Yb*Xb*[b*ZbF]b*\bBYDYv^7@YPP^F]UFF>dtO~u^^~tcVFFPFP^?u~u+PPP Pn]UFF>dt:^~tcVFFPFP^?u~u]U VF>J5t F F Fs u + t>`uFFFF>.btFF~v~@9/09/|*FFF9Fuo~t:^㋇/FF6 v+PF^F9/}ۃ~t5^㋇/F6v+PF^F9/}ۋFFz~t5^㋇/F6 v+PF^F9/}۸FF~@F;F~ FFF.bF;F~FFF~tV~tPFF-FF9Ft;6.N؋v拀PHF-Fn-F~u$FF9Fu=u:FF.FFCFF-vvp#F FPvvv욪FF;FFF;F냋FF2vvp#FN#Pvvv욪FF;FFF;FFFFFFF tD\~taFFHFF2vvp#FN#Pvvv욪FF;FFF;FF6 v+PF~O~FF=t t6=tD=tN=uF~u/~|&F26.N؋PHFϸ6.N؋P>NuFF뫚*F upF*=tZ=Gt>=It*=OtK=Qt F2z6.N؋PHFf6.N؋P>NuFHF@sF7t, FFF~}6.N^F8Pu㋀PHF~:u PFƒ~uF~u F^]U WVF u + t>`u u_>~@ ~^~@9F~V>.b ~O.b9F~G;tjt 6 VWF9v>.b 6V6.bF9v$t" 6 VWF9vFa*F u*F~u FF= tr=HtT=Pt2u GFFH;} ~tK~ tE9~t@) 9v~26 VvFu OF }~OF9~t 6VWF9v~up^_]U%]UP6!]U^?u*^]U^?u*^>u+P6_6_6_]UvFFz`t^ *^ t+=t>= th=tR~-}X6 FP&FG*=yu8 P/~t)6 P&NNFz<z< 2^? t*Ldz<]UWVv6 :P P PP 6WPG:|V3-"؉F6PvFP<u6 P9P PP P  ^_]UV!P~<tV t P ^]UV"P~<tVPY t%^]UP]U+P]UV"P~<t$VwbP6 t bP^]UVv>u tt4/ t a%+Ptt4^]UFYFPv]UFP8Y t%]U9"Pg]UV>!t~~f~ }`FR D`@DpDpDLb~u !k &6Lb6p6p6`@JF!P^]U>!t !!]U>!}!@+Ps]U>!~!HPs]UWV@>!tnR.! >!uD D tM\ H>!u!FvBP >!E Et u]^_]U4V>7tP G>@u'>2u 2.fP:"PV1V ̓>6tWP6^]UWVv6 :P P PP V3-"؋6 PWGP<u暁 ?^_]UVtR.!؋ t!96!u!.^]UE>!t!!@uR.!؋H!]UWV>!u+6!FR.!9~&R.!؋Ʊ؋G= t8Fuʊ8Ft.+96!|&R.!؋Ʊ؋G= t8Fu8Fu6!fF^_]UtF!I]UWVR.!؋6! vWVGR.!9^_]U>!t 6]U]U>!t 6 ]UWVFRFVbF ȄF JY! gv7~,WVp#F!!F!!FG9~ }F9v }^_]U]UWV6Ȅ0>JY#!!*P!!PWVO9>Vb~N96R~^_]UWVRn؋FFG F6^FPWGv^?uݸRn؃uFFPPvvvF@P FRn؋;~y~GRnV‹؋F ?t 6 6  6 ^FPWGV^?u6  PWGV9~FFt^_]U WV~ uFFFFFF~%vvWvvPWvG9~ vvvvvvv vv&vPvVvPv VF9v}vPvvvPv v^_]U@P:P P PP$ F["F ["P3-"؉FP^FPvFv^?uF v3-"؉FOP^FPvFv^?uFa"F a"P3-"؉FCP^FPvFv^?uٚ?7]UP:P PPP F~"FFP^FPvFv^?uF"FFP^FPvFv^?uً]U WV t PP+PP+PPWPGO~+vVRn؍E F6 FPWGV^?uRn؋ljF~ |^_]UV F FF@F6 3NANB+FFFF9F~FF+PvFBP3F uыFF9F~FvvD9F}DF~O|FN`@FpFpFLbPvvvJF@F F6^FPvF+P^?uك~uPPvvvF@P FF-F@F6  PvvFF9F|FF9F|ˋFFFBF9F}UFF$F9F}$6 FPvFv^?uF+PvFB؉^?uF F!FH!^]U$WV+FFFFv vvvJF+F@FFFF +F@FFF9F~FFF܋FFFFFFFFFV+™NFFV+™NFFH;FuFFFFF FF\F)FF3+¹3+‰FFFF3+3+‰FFFF3+3+‰FF)FF3+3+‰FF9FtgPPvvPPvvv0PPVv~G9~tF P PVWF9vʋF9FtgPPvvꚪPPvvꚪv0PPVvꚪ~O9~tF P PVWF9vʋF9FuPPvvPPvvꚪ~OPPWvPPWvꚪv0PPvV~O9~tF P PWVF9vʋF9FuPPvvPPvvꚪ~GPPWvPPWvꚪv0PPvV~G9~tF P PWVF9vʋFFFFFFFF>Du +F|FF9F}4^_]UWV"P~<t1V)>7u"PWWV"P ^_]UV"P~<t +PPV^]UV#P~<t+PPV^]UVF#P~<tP+PV^]UbWVFF4 F>4ur#PFP2v3 F6 Pv PPI 6^FPWGP^?u6 PFHPFHP P P F ++ }"F؋G-N ;u!?t^F u=t =ti G뺋FF 6 F&PWGv6 )PWGvG^?tCFH;~;6 FPWGv֋^w\wZwX#PFP1 FFF964~&vFHPFr~tF- Pd^_]UF^G(W*FVGFFV+FF#FV9Fr^&%G* th=uÌ9V u@9Fu;FVFVF~u^F+9WwHr9GsAFVFV^&GF^&GFF뻋FV9V u9Ft^&GԋFF+ҋ^;Wr$w;GvFVFV^&u^&*@F!F FtZ^&u#A^&G&G+ҋ^;Ww'r;Gw ^&G&G +ҋ^;Wr w;Gr*#FV+]UvF tv vv#P]+]UWV^F&*𿲂 ^F&GN u^_]U+FFvvvFV tN>#tGFFV^&*@F^&t&t&t&G*=t=t= r=v+^F&9GuÌRP7]U+FFvvvFV u>#t{FFV^&*@F^&t&t&t&G*-= w@.'^F&8GuÌRP?????+]UWVv#9u$##9Tu9Du<<N+PPVFV u+3V#^##FV##<<##^_]U +FF^&*Ì@FV~ u^&u&u^&u+FF&G*=t#=te= tk= t#= ta=t8f u+cFVFVF Ft!vvv u FVFV^&*@FYFV뷋FV묋FV]UV*fG^&G*=wj.*fv&DGGvGv&DG*fv&DGGvGG&wBF u+*fv&DFGG6D뒋*fG^&GPQ*fGv&Dt*fv&DGG&DG&DS>>'>>>>>>b>v*fw*fGWFG GW:b#ti##FVFVFV+PvRv2FV t6#vvvv𸴄PFV t>#u~u+F#G(W*FVGG(FVFV9Fs+FF^&G*=w.v~uFVFVFEN@FVFV/~u)FVJ5OeTF Ftvvv u^&*@FI]U~r+ ^*㋇#]U^ ?*u*F^GG(W*FV~tmG(FVFV9Fs"^&u.ÌRPv uFV9Fr7+^&*@Fvvva ##FV^&*@FFV9Fr^&uF&G*=w{. 7d뇀~uFVRPv  u&$~uFVڀ~uFV*F = =  = = = = = = = = ~uF P vvva~t  ~u]U~tv vv^ ?*u*F^GG(W*FVFG(FVFV9FrF^&G* t:=t =tR=tR,~uFVRPv  u*FF~tOvvva~u8KN܃~u$~uFVRPv  u*F^&*@F@~t7+]UV^G Gu+\+PPFPFV t^&u&G t=t o o 0^GF~ tGW^&G-^GW^&G-FVFPFPFPFP5 FFG 0~u6^ww^G=rw P^GW^u.6DGFGGPSPP8.^FGS=~ ^FG^G^]UF FtCF <^&*Ì@<<<&t&&u&<&*@<+<<]U"< D8JPV\bhntz=uA=eu<=u=u=u=u67(Ptu)PW΄F؁+؁ ~+؁ z+P)P F%PF%PF%PF%PF%PF% %PF%P*PЄF%8 WF%PF% PF% PF%@PvX*PF%PF%PF%PF%PF%PF% P|*PքPڄ%+ұc؄RPք%+ұcԄRP6҄*P*P } Ƌ$FN#҄FF%V@ ‰F~u^r+V +Pދ䄸+PF^Ƌ؊܄*P+PNy׸!+PF=t6=tM=tM=tM= tM=tM~u#Ƌ܄P) %+Po+PN4+C+ݸN+ظY+Ӹd+^_]Uv FP3-FpF^FP ^?ueP ~uv+~~FpP+P]U Pv vFP8^PW^ ?u؋]UWVF7t, FFFNeP PNeP-~Bu~ t ^GW$ ^GWRP^7,Pv1 F^ FP'^F~At^ ?@~F@^ F~Bu9~ t3F^Ow+ |v^G%-؉FFfFPXbPvP8F-A=vR.v^ 97wrvtFF9F}a^Xb*7Wt^FvXb>,u ^Xbt^F.F븋F@^GW^ ^NeF^GW^ )~ t^G-^G%FFFHFk~Du~u ^F:Ff^XbF*F< v70FF^FF$F< v70FF^FN~}FFF9F}u~Bt^F+GW^ F-~ t^G%eFF-^Xb*7Wt^FvXb ^F.FF9F|FF9F|PFPvP8v,Pv1F^GW^ FFF9F|cPFPvP8v,Pv1F^GW^ F5Xb9=[b*PZbPYbPXbP,Pv1^GXb_b*P^bP]bP\bP[bPZbPYbPXbP,Pv1^G]FPXbPab*P`bP_bP^bP]bP\bP[bPZbPYbPXbP-Pv1 ^G W^ 7Ne/m5b^_]U>WVPF˜7t, FˆF tP~ t~ t FĘ7tFĘ7tPT,FĊFĘP^ uFĢT, uPw@Pg u7Ě uRFĘ-A=v.FĘP'^FNFθN;Fu P @PFvFP@PP8FĘ=A|&=B~=Dti=WuF*P<-PFPFР>*= u= u=\t]8&@uFPFPb-P>Po1F*PFPFPFPB-P 듊F*PFPU-PzF)@@NF΋^Ѐ> t P F@@_-PFǍFPi-P>Po1vFP@PPF@@l-붡4F4 FF~޾@PFP@PT,P8^Po-PNePFڀ>Neu>T,It>T,UuFPNePE FPNePF teT,=It=Lt<=St$=Tt;=UuhPFPFPPN9F5^=PFڸPFѸ PFP뿿@v P F~\u!@vT,P'^)@@~u P ~ tFأ4;7.MMMMM>u)>u^_]U F ^Ƈ> FF9F~+FF*@F ^>*=u= t = tL=\th@N;^Ƈ> F~t>>:u > @^Ƈ?FF P FF9F}붃~t~t^=:u @F^Ƈ> P N^Ƈ> v+ tS~u0>@u)^>:uÉFF>*P @:~u~u>@u^>:t2F+F=}^>*7t݋^F>*P ]UVFF ^v=tO= t5= t0=\t}FP  ~t2~tF,vvFF߃~tٸP N^]UWV4FT,P'^F>T,St>T,Lt>T,Tu4 ~tfP<"t<'tUPPFP u48Fu,<\u-PP=btW~='th~="tgP P6P@PP@@P뒋P ϋP ƋP뽋P 봋P 뫋P'뢋P"뙋P\됍FPt-PP6Po1PPFhFPy-P6Po1P=0}E=9~=\t8=fu|=nu!=ruc=tu@=vuA=xuxPPF+PF~XbPvE FPvFT,=DtE~=A| =B>XbvXbP~-PEFPF~udZ{9F욮XbZb9F5Xb=ƿXbv븍FPF;F9Xb=Lt=St=TtvXbP@PPF@@ uzF4^_]UF P'^ȋ^G^+G+@]UVF7tD=ItK= t*= t2 SNIDT,P'^5=A| =B~ =Dt7=Lt=St=Tt=Ut=Wt^]UWV+-P㋟7-Pu?F |+ƋV,G tEEP-PF|Ț?VW$f_^VW_$f_^6_6_6_/  tP-P>-t16_6_6_0 ta_P6FY-PP+P_PP-P^_]UWV t^ tPPF7tE=Fu7^PPFF+ }FP:2 u u 7Fњ tG狝7-P:P pPF؀?uP?=uPPFZPFFPvEF uP-PFP:2 uFtu0>uGGJ >u^_]UFF uRPPF=&t)=+t0=-tF7` F=&t=+t=-u-PW -->u ~u]UV u%Pw_Pg u>u>uu>uT u+|U6_6_6_/  tP-PFu$6_6_6_0 t"a_P6FY-PFu+PP_PP-PFlPwFPg u__9V}9Fs6_6_6_/  tP-P6_6_6_0 ta_P6FY-P+PP_PP-Pn+P6_6_6_^]UWVFFFPF7t- F=LuPP?=uP t]+ƋV,G t uu- uu-PF|-P FPPF~;u ~u+^7t#^FF݈Gփ(|7B+}NƋV,uFP:2 u  G uFP:2 u$!G u>t7F둋^7tF^F t%>tZ^_]UVF7tD-A=w."G B@=87+. ^]U+]U>t&-]U ulPw$fPg uOs&f(fFV>;tP$fP`>u>u&f(f9Vu9Ft6(f6&f6$f-PP>u]URF t؋G,W.FV u+-FVFLN^G,W.ggãz@a]Ug&u u g&Gg&uIHYL&FYg&7bP2XPbP:2 t*o_+XgHY&9Gt8n&GHY&7bP2XPbP:2 t*oL&FYP]U FFFV FVFPF tv vP+]UL&]U WV^G,W.FV u+F^&ÌF9~FǙ+FVLNL&G+;Vr w;FvOL&G+;Vwr;FsDF롋^G,W.ggãz@^_]URI^F9u9G+;V w/r;Fw(^GG+;V rw;Fvv vv^GF u+]U WV^G,W.FV u+F^&ÌF9~ZFǙ+FVLNL&G+;Vr w;FvOL&G+;Vwr;FsDFL&G+;Vrw;Fv.L^G,W.ggãz@^_]UWVFg gu+ggFVFV^&F+H^F&9uÌQ^&FF9F~!F+FFF9F}FF̉FVFF;|~t~u{FVLN^_]Uz@bL&Gdfb]UƆ+Pg&7  t2.P3 t".PP2/PP1g&7P17+PP  u7g&7F>uN/PP2vP1/PP1P~P.P2v./P.P.P3 u+.PP2U/PP1vP1P3@PG-g&P&72W/Pg&7q%g&G uv]URF t؋G,W.FV u+Ev^&7:2 u(Fz@FVFggFLNa^G랋]UVz@+NLFYHYo!6RD, D.t \,&Gt u^]UggFVPP P,=t WVVK=u.EF9FuWV8F tF#F|u+WVF uF|u^_]U WVv~G-=wu.G8Et+gF|t׀<uиQPPW tӊ+G㉷@=럊G㉷.=둊G؉^ヿ.=uVv tFF؋.=+@=TG؉^ヿ.=tÉvF؋.=+@=FvVv u9vvWVF tF+vމvF|u2vF8DtG$v}u+PPW uNWVF u9vr55555#`y^_]UWVv^㋿@=^9.=w G8Et+^_]UWVv~t Ou ~uFF8DuF&+^_]UVFd/FN: uPP5OPP+PPJ+6  PV+PFO~+6 ^FPVF+P^?uݡN9Ft FNP F@ud^]UV u6.,f|P~PFF+Pvv6b/ 'b/Ox7 6b/F t-= t= tјP Ś*=u P ^]UWVF+P6n+PP6b/ '+b/Ox ؊ 6b/F t*=u$~O~v PWGV~r~wJ5^*؊v*F닀~ u&v PWGVO~+Fa대~ uVvF*PWGV?+Ff?^_]UWV6b/#/P/Pq%b/ t/Pp+ u 7+V2/PV4 tV~P2~P3}\t~P3}:t//P~P1/P~Pq%b/ td7+PPP6b/ '6b/PP,fP%6b/ PPvP%6b/6,f6PPP% /P+P^_]U^G Gt_&uu+]U^s+ ^G Gt_&G=ut=xu߸]Uv u+^sG$<t^_&tu+]UV^va t G^G^GGGPF@PPP8 t3^"@F ^?tFF;Fw^F"^^]UV^^F=vFvF@PFPP8 t^"vD"D^]U~u,3$~u73f~wrA3 ^㋇F3]UVvr^~tX^G G"tMtGG W"FVGFFVFV9Fs^&GFN u uFV+^]UWVvV tDDDVa tL|t\>hPVDPP8 u+R/Vft^r1PVDPP8 t/Vft^rD^_]UTTV&]UTTV&*]UFF]UFF+ҋ+FV]U=t]UF=s+;F=t =t)=t=t=t+͚<]U^r@GWTVdF=|#^w PFV t^&ut+]U~ t^ ~s v=|~tvvFV u44XFVTV^&G=uu=xtQ=yt}=zt={t54+PvdP0PR?P2<4PR?P1~ t?4Pv 2+PvdP0B4PR?P2dd=u5FX?^F F ^FFN u^R?I~ tI4Pv 2=t =t =t Q4L4+PvF[4]UF Fu++gFVTV^&G=x|=y~%=zt={t̚=^t =st뺸뵚FV |RPvva]UFtnFuF`tF%=t=|=~F%=t =t%-^㋇\4^㋇\4 ^㋇d4]U^s wl^ww]UWVv^|t|u SV6FF>4u F0>4u^F0^Fx|rMDu D`t=D$<u!VF tl4s4PvD-= v.64FP!64FPt4~,64FP*P64FPtm59={4Pv1 V^45D959=4Pv1nVt^V^464FP4T,\ .YV=  uVa t3V t64v+Pw 64v+Pw 64v+Pt6+Pv1FF:>4u ^F0>4u^F0^Fx64FP+P46>4u@FP3#4^F0^F0^F0=t=t=tFPv2^_]U^GF=sFu1$<t"F$<^G Gt_&~u+]UF*=xt=zt 7+]U^GuDG`t>G$<u*^ ^GFgS^^FG^_&uu^^ ^GWTV=xt;=zt 7+\=^t3*^ dF=}#PC^뢚c|Ͱˋ^w vRPɋ]UWVv~Wl t+jFPFPVO  t~~~~FW t΋FRPWMc~t'}}7뮋+UFV¹ D^_]U^G Gu+K^GWTV_&GP t֚d^G=rw P^GW]UVv|sDu*D`u"D Dt\&zt V t+^]U^r5G Guw w^GW t^_&yu+]U^rG Gt_&\u+]U^&tt&suFVTV+]U^GWTV+ҋ^W;w=v 7+7=|t=}t^G^=v ̋^G]U V^FGGSQ u+WFPFPvV tNHNF^F#F V# Sg tG^]UFPFPv u+^N/NH!]UWVvF|u9:99:9\=V=  t V|t\>`V t 7+V F t^FFvVDPP8 t/Vft^FrD|sBD$<u5$D7VFV  |=w~}7d~uV(^_]U*fFP u 7+/^GWTVFdF^w dPTV u7묃T=uFF~~!=u6V6Tv u~!7aT&*@TNT&*@T^GWw v'TV u]T=t KdNF9Fud^Gw P^GW]UPF u؋G G"uG W"TVGTFVFTV9FwF t}N=yupTVFVdd=u86V6Tv u!^ FV-W^F"FVTVFTFV7+]UFVTVd]UVvD9Fu]~}Fu 7+EFuF`tvV)|r&V=  tVa tDDDuD`tD$<uDD|r|DusFF$<uiF=t=t9SFD$<t 5:5\:959D5\=FD FD$<t9:5D9\=D$<uD=t=t8DD9Ft$<t%F$<tF$L:w DɋD-= v.;F=t=t=t=t=t=tgjpF;FPF;F9F=t=t =t=t$6;;ЋF=t =u75F-=v.H*+҉VF7Fϊ*+҉VF7Fv#5F=ut=ul=t=t릋봋F=uq=tj7 F-= vV.5@5H5P5F-=v.&999T9 w ]^]UWVGFF+FF~G(bG*b,b@vvFPFV uxFFV𡺄9Vt.9Ft&@nFV@BƄDFF^&GHDŽJFLFVNP#T&G+;Vu-;Fu(&u!GFG -RG *b,b^&G@+;Vu<;Fu7&u0GFn؋6D RދG *b,b:nء*bRPFP(bPP8 u+H*b,bPFP(bPP8 tՋF Fu^&t*b,bPF+Pvvv / FV u@nƄD*bRFFFVHJFLFNPDŽT+B@PFP(bPP8 u*b,bPFP(bPP8 uF FtF*b,bFF Ft ~tn+B@ƄD^_]U0WVFn؋@BFV uFFV^F&Fԋ^&?_uFNF^FvF&FҋF9F|^F(nFPEnRvv FF^F,vz F ߋ^,uN^F)nDu+PJHF / F^P3F^&?_uFNF^FvF&FҋF9F|^F(@H9Ftn؍~bPFPFPP8 tb@H9FtY~҃tFVPFPFPP8 t+~u$FVPFPFPP8 uNFGFn؋RFF~uPFPFPP8 u!FҙF멊F$R29u)E+9Trw9DrEE+;Tr w;Dv } u+^_]UDVvRF tY(PF1PFP2P1F t.PFP3F tFPV:2 u ~t F ^G+^]U츴PE u+v+P6#]UpVP?*uP??t 7+PP t瘋7u+FFF!P6P1 t6PFP2F!DP.P6P1 t6PFP2F.DPP tU7uK4P6P3 u+P6P1F6PFP2FF6P~t~u ~u~t ~u~t~uv t^?*t򸴄PF tvvP u΋FFRF t%F9Fu^Gvvv t7_FP}F tvvPn^]U V6R^D1PW4P4PVADD(T*FVD(FVFV9FsvvVa^&*@F؋t uP^]UV*fu 7+/*ft7*fDGDGG^]UV6*fVQ|sgD-= w\.؈G؉?T؃ډT,555=959}}7+^]UV6*fVQD-=wF.M<t*b<u<u+ Du++҉T7+(,C,CCCCCCCCC^]UV*fF.*f"*fFPv  u+^G=t!=tG=t4=tQ=t`=ti7ϋ^'v9~h+^G\^v9wI^vT9W|7^vT9Wwr#ҋ^5^5 ^9^9^]UV*fF.*f"*fFPv  u+^G=t!=tG=t4=tQ=t`=ti7ϋ^v9|h+^G\^v9sI^vT9W|7^vT9Wwr#ҋ^5^5 ^9^9}^]UQ u+]Uz u+]UV6*fVQD=t=t!=t$=t =t=t#Ј ЉT҉T7+^]U$WV6*f.*f">*fWV<  u+(D-= v.-t4WMc%t4Wc98 9=59^5E9^59^5D9^9F8N9F8N:59F8N9F8N:5]VW~_^VWu~ܥ_^VW~_^VW~t_^9F8N9F8N:99F8N9F8N:9]H7*8^_]UWV6*f.*f">*fWV<  u+oD=t=t-=t<=tD7݃<u7Ћ 5 Dtt4Wqc<tы+4؋ Dtt4Wc^_]UWV6*f.*f">*fWV-  u+D-=wt.c8u*9uT9Uu9t+f5E5DtQ559E9Du997s ZZ Z6RZZ!CZZEm^_]U욳 u+]UWV6*f.*f">*fWV-  u+D-=wR.;=u<t*a=u<t+ Eu Dt++҉U733333333333^_]UWV6*f.*f">*fWV-  u+D-=wR.=t <t*a=t <t+ Et  Dt++҉U7떹^_]UWV^G=t=t =t=u&^v*f;t؋F7+^_]UWV6*f.*f">*fWV<  u+W=  t VWsV=  tWVD-= wJ." _TUS5D4E5]545=:9D8E9]9897t        ^_]U *f.*f"F*fFFPFPvO  tFPFPvO  u+F9Fu~u ~u~7vQ tvQ tPv tǸPv t^^++v^G]U6*f=  t*f-"P=  tE O u+s]U,WV6*f.*f">*fWV<  u+D-= v. <u  Dut4W)c<um+4ы Du[t4Wc99:u<98=9=59^5E9^59^5D9^9F8N9F8N:9V9:u9F8N9F8N:8v59F8N9F8N:8v5]VW~_^VWu~ԥ_^VW~_^VW~t_^9F8N9F8N:9V9:t[9F8N9F8N:8v99F8N9F8N:8v9]7\       79^_]U*fu 7+c*fGF-"P F^ tڀ~t6*f  u v6*f t6*fgً*fG]UsRPq]U RP_]URPM]UW RP;]URP)]UWV*fF.*f"*fFvQ tvQ u+Iv=  tv u܋^wv tNj^F^_]U" RP]UWV6*f.*f">*fWV<  u+FPV t븅PW tEEE+҉EUEE^_]UWVv~|s}r 7+E$<t D$<un}t|u PW t¸PVs}uPV.|uPW}uف|trE$<t D$<u&W uIV u9|t|uD@PV}t}uE@PW|u\}u8|uB}u|u(}u|u }u}u |u|tu}tk5^_]U츉Pv]U츂Pv]UV^G$<u 7+6F$<tv=} ^6DG^FG^]UV4^u"SPvFPP^_6^]UvF  7+Z~uPv tFF@$F)G 0GFG FFvvFPP]U*fG]UVFƄA t6*fQ u+x6*fF=}" 7ܸP6*f t4~~.*fu|7륋*fuwr^6*f^]UWVFƄA t6*fQ u+'P6*f t^*f^_]UP+P`P-*f`7G l4r u+% ƄF t<,t <;t7ڸ]UWVvFƄP+P`P-*f`7G l~ t  u +.A t*ftuVw^S^_]UWVFFFƄA u6*fQ tƄ?,tƄ FFF%ƄF7t^뭀~ t VO u/~t>/t^VXf^rG^^G^~ u~t4Vb4D^_]UWV+ }؀u u 7 +hF۸ƅF➋FVW䞋_^F ꞊F tV uƅ멀~ t4V4^_]UWV+ }&F؀tRF9uFƇ }\4؀ut4>u8+9?~FF |()>|u^_]U +P>4u]UWV>4u++ }x؀tlnj}t>u^FPEXPP8 tu^E`PFP, t.V4&}t~PEPE t~uFy^_]UVnƌ=t=t H+PDPDXPD^ u+-|^v7 t^D`PDXPP8 tҸ^]UWV>4uF+964+ }F؋G-;Fu?t^F tF=t =t?6G‹FP)PFP^G-P4P7FF}^VW~wX_^G^F+PFPFPGVP8^P^G-P5P^_]UVv>u0>|u8(ء|HV)ء4^]U>5uF>Pt 6P#5P65q%P t+P6P.75P]U WV+ }+؀t$nj}u}t}^u+ uFƋEX+ұcEZU\FV}^t.-RP5P6P%E^+FVvv$5 vv.5P6P%D t>u PP+PP^_]U75P6P%]U6PI.PG tS *5+6PF$=$u*F6PI.Fҋ]MSEM87gfw...GWy -X3Ɏَ.ˀ>tÀ',PQSW 45L!@..E_[YXډ6>%!n> +Ǚ+ƣr" >t 4%!@!@!23À>t3:t PQRW 4%L.!@_ZYXt(!ãNO87=3.e.>eQY.&e?.>e?u.>eQY.et33&=t?`t u, O& t!G& u ! ! PUvS3؎F2u tutu tu tz"ètPF=Xu n []uXPS6G6G[XVSQRW^Nӊ̀8tRVu u@uu4tt 'u ?6;6u7 6<t t+6;6u,6;6u 6 uQ t>z.-6;6t# ,6;6u 6Vu uuGʀPy uʋu$˛tÀFf_ZY[^z$_ZY[^QN8t00uPt?6;6u 6@Nn3ɉNNNNNPF%=Xs:@uO@WVQSNـ؀t 8v ~~VFNF^[Y^_> Su8u1u+u$uuuu u@u3؎ uL![Xϣ%<>t. á3:t >$? %% >t >  .. Ë Q & U] g% >t)>  .. Ë Q & U&]‹6;6u 6 Ë  ъ.€? ъ.tّPUVv NNv$ &İSP=P2\UVvNNv)S3TX;u(@%0=0u@  K    K @B @@ ? j0SeB׳#,k d39 5h!Kx\); yr{Z>\i7M, fˑX^ y cfψp9F ˑX^2[ɤPK+RJeBPUK$C8V ObmQP;$m[ PK$CtT=_Jow{8 ]{~ -wWqO15^KzӲ( /Ċ vp>[`3l_ UVvNNv^]    PWVRQSUӋ~GGMÁ. F ێӎÌF PWVRQSU؎Ӌ~GM4Ŋ݁.$‹H3vFЋ‹G,3vFЋ‹GG5GGƋVF~3؎ ݁t.tS[؎6 >dK~3؋>ߎǣt.mIr<6dt>dt(t.d6;6u 63.d,!6Հ2+;>][YZ^_  Њ&€? Њ&uXف.ف.6;6un 6Ëف.ف.ut+tun t uu...uu$t3@ú3һ,3҇L 3һL3һ E D 2u 2T MD.'WU ÁAt2u Á>d...... Ë>d;t  t2x뀋Ƌ߹w놋+|=C~/URu2y݋M]} xRURQ2֜譋Эȭح3 tr| tыˋ3wtTr)|3 tĊ╊֊͊ߊ2wt)Fu?t ΋?tXx&L\|ss@+L\|s3XPU2R@P"3ۋˋ t  tU tU t ڃD t t ڃX P3ɋ tU t D tU t D t t X P3ۋ t eʃD tU t ʃD tU t ʃD t ʃՁ?X P3RD t eڃD tU t ڃDU t ڃQ3ɋD t eDU t DeY]ыˋX t^a2URVW_^譋ȭحЭf3r EU>JW@W<W8r"f;Tu ;Du;\u; s 2Y[_^=6l3;sb u;wARS3f tPh tj t[+[]蕒sOfhjlsO+fhjhj‹fɰ ut ًʋ3t>dX]uNJ݊Ί򗕊Ԋ2ugNtT ͊ tE rrwr't"XPr rXPr sF3Ջʊ r_s Š t rrwr,t'XPr rXPr3sF32I tB rrwr,t'XPr rXPr3sFdM]EX]䀈e @}~uE þtTe Á rr#5e r  Āu羘e Á Āt&&$Ȇċ6;6u 6ʀ2......Ë6,s r u uraËD uVE DH\LTt@Er9RuWs3݋Ӌ݋ӋX݋ȃى]ME_>dNXMWX......X_:WɎًL &U :uEVW yʀ:u( wɋL?&U?;uuuu_^ÿL\WVS@S>d^._)>dQV@^ VU^Y^VS^ .[WQV@>d~^YQ V@Z^Vi^Y_Ë6V6;6u 6>^ûL ]Ë>D 66;6u 6É>ds6}V>d^W>d^P >dX t YË6û W>ds_>duE)Ë>D 66;6u߃ 6V(^W4]EwMCS>d[_Si[3 t9y۹IsWۿ4ë«(4>d_>dË>D 66;6uW߃ 6W3V Q>d^El >dv_>de-sZ ;6 >t؎sZFFsZ6;6uރ 6؎tsZڎ t6;6uރ 6(G  <<8087>> 0!!! t :t!5!!!"%!!#5!!!"#%!&! t"!""&! t !""PR%.!.!!>!t"!>!t"!ZXPR.!#%!ZX..!.>!PX.!t.>!t..!PR.! t.!.! t.!ZXFC Library - (C)Copyright Microsoft Corp 1986Usage: cv [options] file [arguments].exe.exe.comNot an executable fileCan't find %s + Unrecognized option %s Valid options: /B /C /D /F /I /M /S /T /W /43 /2breakaww%02x rbrconconwconconconaconconaconFloating point error%d aw%d %c %s (pass = %d) "%s" Program terminated normally (%d) %s main%04X:%04X %d: %s COMSPECcommand.com Press any key to continue...COMMAND.COM not foundWarning: packed fileNo symbolic informationMicrosoft (R) CodeView (TM) Version 1.00Copyright (C) Microsoft Corp 1986. All rights reserved. rconwcon|<<(AXBXCXDXSPBPSIDIDSESSSCSIPFLf rbDNRBr ?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmCAAAAADAAMAASADCADDANDARPLBOUNDCALLCBWCLCCLDCLICLTSCMCCMPCMPSCMPSBCMPSWCS:CWDDAADASDECDIVDS:ENTERES:ESCFABSFADDFADDPFBLDFBSTPFCHSFCLEXFCOMFCOMPFCOMPPFDECSTPFDISIFDIVFDIVPFDIVRFDIVRPFENIFFREEFIADDFICOMFICOMPFIDIVFIDIVRFILDFIMULFINCSTPFINITFISTFISTPFISUBFISUBRFLDFLDCWFLDENVFLDLG2FLDLN2FLDL2EFLDL2TFLDPIFLDZFLD1FMULFMULPFNCLEXFNINITFNOPFNSAVEFNSTCWFNSTENVFNSTSWFNSTSWAXFPATANFPREMFPTANFRNDINTFRSTORFSAVEFSCALEFSETPMFSQRTFSTFSTCWFSTENVFSTPFSTSWFSTSWAXFSUBFSUBPFSUBRFSUBRPFTSTFWAITFXAMFXCHFXTRACTFYL2XFYL2XP1F2XM1HLTIDIVIMULININCINSINSBINSWINTINTOIRETJAJAEJBJBEJCJCXZJEJGJGEJLJLEJMPJNAJNAEJNBJNBEJNCJNEJNGJNGEJNLJNLEJNOJNPJNSJNZJOJPJPEJPOJSJZLAHFLARLDSLEALEAVELESLGDTLIDTLLDTLMSWLOCKLODSLODSBLODSWLOOPLOOPELOOPNELOOPNZLOOPZLSLLTRMOVMOVSMOVSBMOVSWMULNEGNOPNOTOROUTOUTSOUTSBOUTSWPOPPOPAPOPFPUSHPUSHAPUSHFRCLRCRREPREPEREPNEREPNZREPZRETRETFROLRORSAHFSALSARSBBSCASSCASBSCASWSGDTSHLSHRSIDTSLDTSMSWSS:STCSTDSTISTOSSTOSBSTOSWSTRSUBTESTVERRVERWWAITXCHGXLATXOR??????DBALCLDLBLAHCHDHBHAXCXDXBXSPBPSIDIESCSSSDS7?$$$ 2|(b$8.'/!HP!0 >&22#2(2.23292>2D2I2O2V2^2d2i2o2u2|22222222222222222222222 2222 2'2.232:2A2I2P2Y2`2f2l2t2{2222222222222222222222  P!8 P!( # !@ l l m% )() . 3 w6 s: r= vA rD I tL O }S |V ~Z ^ vb rg sk wp st ux ~| | }  q { y u p z z { x t  2 |( |(  |( 2 2 2 2          2 2 " # ) / P! 3 P!7 ; P!? $B #F nK nQ oW X[ a` e Pj `p v  z ~      L L   8 $    2 ( 2 2 2 6       2 $( ' 2 2 $ &) . $02 26 2: 2     , ,{{,,{      , ,{{HHHHH,H,{{     , ,"  ,,  ,,z      , ,  {{ { { { { {{ { { { { { { { {{{ { { { { {{{{ { { { { {{  oxH&,PVDztn)E        6ll..  ,,LRTZ,,,,,,,,,, , , , , ,,o" $o$2S2e8>QQQQ  ( ( = ( ( ( ( ( ( D d$^$X$b`` 22@      = @ C F I L O R U X [ ^ a d g j m p s v  #=Cpp G%&`b*,=Z]?>\[#dfFCBD@AEkiSQh(7RjYTW0612;<3459:=].)$8XG%&b`,*=Z]UV^/gZ] H&'ca-+59:!5":/g]]^nm ;FWAIT ; ( ( ( (ST,ST(ST(ST(ST(),STST(ST(),STCL????Word Ptr Byte Ptr .]+[ [[].+ BXBPSIDI[].+-BYTEWORDQWORDTWORDBYWOPTRIllegal instructionIllegal operandSymbol not definedMust be registerWrong type of registerOperand was expectedOperand types must matchOperand must have sizeAlready have base registerAlready have index registerValue is out of rangeRelative jump out of rangeNo immediate modeByte register is illegalCS register illegal usageMust be AX or ALSyntax error ^ not implemented++ - core dumped charintshortlongfloatdoubleunsignedintstructunionnearfar!&*05;sizeof*/:%+-<=>=<>==!=&&||=+=-=*=/=%=W  e s e z(QAe e ge e       e 4( :\rbrbO-QWERTYUIOP----ASDFGHJKL-----ZXCVBNM%.80s: %d: %.80s %.80s %d: %.80s %s = %04XhProgram terminated normally (%d):\%d) %.30s : %.75s%d) %.80srcon*** This is Copyright 1983 Microsoft *** File Load...ShellQuit Search Find...NextPreviousLabel... View Help F1Source F3Assembly F3Output F4Evaluate... Run StartRestartExecuteClear Breakpoints Watch Add Watch...Watchpoint...Tracepoint...Delete Watch... Options Flip/Swap Mix Source Symbols Bytes Coded Registers F2 Case Sense Calls Trace! Go!  0c L*L2  2i >:'-3%;$C0"U ]*jVx2 ,FFF#,BKD F gEnter filename:Enter search string:Enter function name or label:Program terminated normally (%d)ERRORPress Any Key to Continue...Microsoft (R) CodeView (TM) Version 1.00Copyright (C) 1986. All rights reserved.Enter expression:<%s : %s> Enter expression to be added to Watch Window:Enter expression (will break when TRUE):Enter expression (will break when changed): Select expression to be discarded from Watch Window %04X:%04X ???%04X:%04X%04X:%04X[BP-%04X][BP+%04X]SI%s DI%s ??%s %-16s %sInterruptNo such file/directoryNo program to debugI/O errorArg list too longExec format errorNo child processesNo more processesNot enough spaceBad addressInvalid argumentToo many open filesMissing ')'Bad breakpoint commandExtra input ignoredBad registerToo many breakpointsBreakpoint # or '*' expectedUnable to open fileBad type castBadly formed typeOperand types incorrect for this operationNo previous regular expressionRegular expression too longMissing ']'Regular expression too complexNo match of regular expressionSyntax errorUnknown symbolExpression too complexDivide by zeroNo symbolic informationBad type (use one of `ABDILSTUW')Bad flagNo code at this line numberRegister variable out of scopeCannot use struct or union as scalarFunction call before 'main'Bad radix (use 8, 10, or 16)Constant too bigMissing '"'No closing single quoteNo source lines at this addressOperator needs lvalueOperator must have a struct/union typeObject too bigMissing '('Too many watch objectsType conversion too complexBad format stringNot a text fileVideo mode changed without /S optionFile errorInternal debugger error: %dIllegal instructionI/O trap instructionEmulator trap instructionFloating-point exceptionBus errorSegmentation violationUnknow*n signal%02X valid zero specialProjectiveAffineRound nearestRound downRound upChop24-bitUndefined53-bit64-bitNo 8087 presentControl %.4X (%s closure, %s, %s precision) Z iem=%d pm=%d um=%d om=%d zm=%d dm=%d im=%d Status %.4X cond=%d%d%d%d top=%d pe=%d ue=%d oe=%d ze=%d de=%d ie=%d Tag %.4X instruction=%.5lX operand=%.5lX opcode=%.4X Stack Exp Mantissa Value ST(%d) %s %.4X %.2X = + Not a Number- Not a Number+ Infinity+ Infinity+ Denormal- Denormal f)n)v)~))))))))))%d%dnovrflowoverflowNVOV up down UPDNdisable enable DIEIpositivenegativePLNGnot zero zero NZZRno auxcyauxcarryNAAC odd even POPEno carry carry NCCYB++++++++++++++++@++, , ,,,!,$,-,6,9,<,E,N,Q,%04X:%04X %6d %6u %02X %02X %02X %02X %+E%02X %02X %02X %02X %02X %02X %02X %02X %+.12E%02X %02X %02X %02X %02X %02X %02X %02X %02X %02X % E%02X.%02X%02X:%02X%02X.%02X%02X. %x:%x%x %s %02x%03o0xFFFFF%s=%04X %s %s: %d: %s %s %s %04X IPassemblymixedsource%s: %d: %s %s %s: %d: %s %s %s(%s) %s(%s) %04X:%04X \Enter directory for (cr for none)? Enter directory for %s (cr for none)? \rb:+:\ PGDN=Next PGUP=Previous HOME=Top END=Exit #$-rbcv.hlpPATH;\cv.hlpcv.hlprb;charintlongunsigned charunsigned intunsigned longfloatdoubleREAL80CPLX32CPLX64CPLX80BOOL08BOOL16BOOL32ASCIIASCII2ASCII4R char *int *long *unsigned char *unsigned int *unsigned long *float *double *REAL80 *CPLX32 *CPLX64 *CPLX80 *BOOL08 *BOOL16 *BOOL32 *ASCII *ASCII2 *ASCII4 * char far *int far *long far *unsigned char far *unsigned int far *unsigned long far *float far *double far *REAL80 far *CPLX32 far *CPLX64 far *CPLX80 far *BOOL08 far *BOOL16 far *BOOL32 far *ASCII far *ASCII2 far *ASCII4 far * char huge *int huge *long huge *unsigned char huge *unsigned int huge *unsigned long huge *float huge *double huge *REAL80 huge *CPLX32 huge *CPLX64 huge *CPLX80 huge *BOOL08 huge *BOOL16 huge *BOOL32 huge *ASCII huge *ASCII2 huge *ASCII4 huge *???///////00 0000 0'0.0/060=0D0E0K0R0Y0Z0[0\0]0^0_0`0a0b0i0o0v0w000000000000000001 11111111111(121=1>1R1e1y1z11111111111111 2222222222 2,272C2D2Y2m22222222222223333SCALAR *[]struct()voidPROCEDURE .TRUE..FALSE.%#g%#.14g(%#g,%#g)(%#.14g,%#.14g)?CANNOT DISPLAY0x%04X, line %04X:%04X %-16s%s *(bduoxXdiuoxXfeEgGcs%d) %s : %s %d) %s CVHWDBGr+5%05lX-%05lX W %05lX W D  @@AP e+000B1#NAN1#INF1#IND2f$7yACbbMxt69 LX7;C_FILE_INFO ((((( H      \TMP\ x /c COMSPEC  : : ;C_FILE_INFO;C_FILE_INFO(null)(null)+- #E.com.exe  ;C_FILE_INFO;Zx0Nm:Yw/MlPATH\PSTPDTp ::SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZ%C2$.&Y! <> error 2001: Null pointer assignment error 2000: Stack overflow  error 2003: Integer divide by 0  error 2004: DOS 2.0 or later required $ error 2009: Not enough space for environment ;!(!RB OP2PˌÌH؎GHt +Ўځt +ЎNF$6 -؎֋./@ʎں!L!Packed file is corrupt(@td0Gg^|H2YG>~sj_3+N^y(7QEA~$r[z'>8Wf`|D +     8 3  1 W I v g  < + Z o U 0+&=5uiIAe_yQKv)>[lzG>mW'VA0d^G5%r -(cL+K50a\W! 4+As 5"M\|.=tl#/9Ia{(8n_G3|lL,UNzgb  C 0 يjG ZHO8#ʋl[O'zb#&&-&'()oYTA37 *ܪBSZ4^F߽eH$ma9-+ ſi!Űr:PèÙuV õȜȃj@DŽqI#Ƙ_ɆZCɸ̫̚BjΌyέΨϥ$U==ЭpѸ;ҥӢq5Ԙu>3vո5֙׍ׅnZ;׭׿& ב؉bD;Zvٮم]ۋ5TY݁F:ކa޷ Xuߜ G>aT&'*C(,opw-^YTOo:# 1P>C:ZRz;iVQ`voh)whaSLgZS;-%N2,nu9/,,0---|4456667::q:[:E:: :999v9W929 98R88777>p>$@???@ AAaAAAAAB BB#B,B5B CiC`CoDcDPD@D!DDCDDBE[EEE FEEFFFtFAGGIsI+I$IHeHKH(HGGGyGJJIKKgK[K;KKKLLL NMMyNVNGN3N(NNNNNN1P$QLQQQQQ&S-S;SjT`TdVYVKV5V'V VUUUUoUcU[UVVVWYXXXZ[[[v[g[[Z]x]W]N]&]]\\\}\^y^g_J__^bbebNbbaaaaca/a a__nfffGf6f#ffeeeeeekedddfdEd>d!ddcccRcKccbggqgkgXg3ggffffff f_X2""h""!!2!'!%$$##''X''&&&y&B&&&))))l)L) )(((('e*%*i,D,5,++++++f+^+L+C+:+5+-+ +****.--------x-U-E-*-,,,,,,//o/i/P/:/&///..._.H.,0'0"000//2r21u1555y5N5055444q4V4C4+44333w37O7F77 76t6]6A6%65::f:J:1::888287<<<<<<;*;;:::>>>>>[>F>=k=`=*==v@@AcBSCDDDDEErEjEEEDFFGHXHH>I-IxIIJNJJKpKDKKKM MLLL8M-MNNNONNMMMMPR}RQ}QR2T&TTSSSISR(UTTTT?U3UUUUsUUWVVKVVU\[[[[j[V[E[<[.["[fZ ZZYvYdY%YY^^^w^\^A^5^^]]]n]a]]]\\\\_\&aa```u`E``___cccc|cOcDc?c%cbbbbb>baLaffff{fXfBFJ %.75s%d) %.80srcon*** This is Copyright 1983 Microsoft *** File Load...ShellQuit Search Find...NextPreviousLabel... View Help F1Source F3Assembly F3Output F4Evaluate... Run StartRestartExecuteClear Breakpoints Watch Add Watch...Watchpoint...Tracepoint...Delete Watch... Options Flip/Swap Mix Source Symbols Bytes Coded Registers F2 Case Sense Calls Trace! Go!  0c L*L2  2i >:'-3%;$C0"U ]*jp0 p9p?p!!!WCREBM!!!!!!t !!!!K!!M!!!!!!!  !!!DCR!F!!!!!!! !!!!!!!!!!!!!!!!!!EDS!C!!!!!!!#!!!!B!!W!!!!!!!+!!!!!!!!!!!!!!!y3!!!!!!!!!!!!!!!;c!!!!!!!M!!!!!!!C-!!!!!!!!!!!!!!!"L!!!!C!!!!!!!!!!7T!!!!!!!!!!!!!!!-\!!!!!!!!!!!!!!!1d!!!!!!!!!!!!!!!Nl:!!!!!!!!!!!!!!!t-!!!!!!!!!!!!!!!|T!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!+!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! 5!!!!!!!!!!!!!!! R ͻ ͻ ͻ Window CodeView Control Run Commands Commands Commands ͼ ͼ ͼ ͻ ͻ ͻ Examine Break and Watch Modify  Commands Commands Commands ͼ ͼ ͼ Type of Text Color Ā Ā Help-screen headings Headings Keys or commands that you type Keys Descriptive text Text Placeholders that represent your text Variables  ͻ Keyboard/Mouse Commands ͼ ͻ Menu  Selections ͼ  ͻ ͻ ͻ Dialog Command Control Redirection Syntax Commands Commands ͼ ͼ ͼ ͻ Find Regular Exp+ressions ͼ Trace  T [count] Executes current source line or instruction. If (F8) count is given, repeats count times. Traces (Click left on Trace) through functions in source mode, or through interrupts and procedures in assembly mode. Program Step P [count] Executes current source line or instruction. If (F10) count is given, repeats count times. Steps over (Click right on Trace) functions in source mode, or over interrupts and procedures in assembly mode. Go  G [address] Executes until debugger encounters address, a (F5) previously set breakpoint, or the end of the (Click on Go) program. Execute E Executes in slow motion until you press a key, or until debugger encounters a breakpoint or the end of the program.  ͻ ͻ ͻ Expressions Data (Memory Symbol Data and Formatting and Registers) and Addresses ͼ ͼ ͼ ͻ Code and Functions  ͼ , ͻ Break Commands ͼ ͻ Watch Commands  ͼ Register  R[register] [expression] Sets register to value of expression. Uses these registers: AX BX CX DX SP BP SI DI DS ES SS CS IP RF [flag] Sets or clears flag using these mnemonic pairs: OV-NV DN-UP EI-DI NG-PL ZR-NZ AC-NA PE-PO CY-NC Assemble A [address] Assembles mnemonics starting at address (current or last assembly address is default). Debugger prompts by printing next address. Enter instructions. When finished, press ENTER without instruction. Enter  E[type] [value] Enters memory value in type format. Type can be any of the following: A ASCII (8-bit alpha) D Double Word (32-bit hex) B Byte (8-bit hex) S Short Real (32-bit) I Integer (16-bit dec) L Long Real (64-bit) U Unsigned (16-bit dec) T 10-Byte Real (80-bit) W Word (16-bit hex) None for previous or byte Command Keyboard Mouse  Go to help screen F1 Use View menu Open register window F2 Use Options menu Toggle source/assembly F3 Use View menu Switch to output screen F4 Use View menu Go F5 Click either on Go Switch to display/dialog F6 None Execute to cursor line F7 at location Click right on source line Trace through function F8 Click left on Trace Set breakpoint at cursor F9 at location Click left on source line Step over function F10 Click right on Trace Change flag None , Click either on flag Move separator line up CONTROL-U Drag line up Move separator line down CONTROL-D Drag line down Scroll up line in window Move cursor off top Click left on up arrow Scroll up page in window PGUP Click right on up arrow Scroll to top of window HOME Click both on up arrow Scroll down line in window Move cursor off bottom Click left on down arrow Scroll down page in window PGDN Click right on down arrow Scroll to bottom of window END Click both on down arrow Move cursor UP or DOWN key None File  р Load... Load new text or source file Shell Start a new DOS shell Quit Quit debugger and return to DOS ـ Search р Find... Find first regular expression Next Find next regular expression Previous Find previous regular expression Label... Find label (such as function name) ـ View р  Help F1 Switch to on-line help Source F3 Switch to source mode Assembly F3 Switch to assembly mode Output F4 Switch to output screen Evaluate... Evaluate expression ـ р Run Start Restart current program and go Restart Restart current program Execute Execute in slow motion Clear Breakpoints Clear all breakpoints ـ  PGDN for more menus Format for CodeView Commands command [arguments] [;command2] The arguments are C expressions that evaluate to addresses or values. They can use the CodeView operators and constants shown below: Precedence Operators Ā highest 1 () [] -> . 2 ! ~ - (type) ++ -- * & sizeof Radix for Override 3 * / % : Constants Prefix 4 + -  Ā 5 < > <= >= Octal 0number 6 == != Decimal 0nnumber 7 && Hexadecimal 0xnumber 8 || Ā lowest 9 = += -= *= /= %= Ā Notes on Operators and Addresses  The : operator is used to separate address parts: segment:offset  The . operator can specify local variables: function.variable  Source line addresses can be r-epresented as: .[module:]linenumber Help H Displays dialog commands and syntax (not the same as F1 window help). Load L [arguments] Restarts program. New arguments can be given. Breakpoints are retained. Quit Q Exits from debugger and returns to DOS.  Radix N[radix] Sets default radix to 16 (hexadecimal), 10 (decimal), or 8 (octal). Redraw @ Redraws the screen. PGDN for more system-control commands  Redirection Commands [T]>[>]device Redirects output from the debugger to device (or file). If T is given, output is also echoed to the CodeView screen. If second > is given with an existing file, output will be appended. ] ............. Trace ? [,format] ........ Display Expression P [] ...... Program Step X?[mod!][fun.][sym][*] ...... Examine Symbols G [] ................. Go D[] [] .................... Dump E ..................... Execute R [] [[=]] .............. Register L [] ............ Restart 7 ........................ 8087 Register Dump =================Breakpoints==================== =======Watch Statements====== BP [] [] [""] . Breakpoint Set W? ............. Watch BC [] ................... Breakpoint Clear W[] ..... Watch BD [] ................. Breakpoint Disable WP? ....... Watchpoint BE [] .................. Breakpoint Enable TP? ....... Tracepoint BL ............................. Breakpoint List TP[ Tracepoint =====================Modify===================== Y ........ Delete Watch A [] ............................ Assemble W ................ List Watch E[] [] ....................... Enter =========Redirection========= =====Examine Source===== ====System Control==== [T]>[>] . Send Output S[+|-|&] ...... Set Mode N[] . Set Radix < ..... Receive Input U [] . Unassemble Q ............... Quit = ..... Redirect Both V [] . View Source /[] .... Search " ..................... Pause . ..... Current Location \ .... Screen Exchange : ..................... Delay K .......... Stack Trace #[] ..... Tab Set *[] ........ Comment MZ prU3 ZP[P ZPP ZPF ]UNvvFP^wQF@u"bPP FP PP+PPv   3PPPv P Pv, =u> MZt> ZMt P> t +ȡ +ҊԊ*ځ9 |9 s PC +ұ)v tH4P3P + ұRPvP Pv\ =t MP> t^w3P> u> u lP> u > uIF/V> t > t> t v FV FV| r FF  FF> t0  +;Vrw;Fv  FFFV9V|9FsPF+F >t 9 vP{ 3PPPv|P Pv v<]U3 PRPv@P Pvl ]U3P + ұ -RPv |,PFPv^ FPFPA  u3]UhWVv\PvV P  u.PW  tPW  tPt PV PV^_]U3PbPP$]UWVvF=tF=tD?-u?/u4b <u 4H  <un4%FPWK  u  F 9#PW0  u F 'PW  u  F <t*?-t?/t >> > ~> t> u>u> t^_]U+P1Pv7P +ұFV6 6 6 6 FPXP vvvvhPP 6 6 PP> t+6 6 PP6 6 6 P)6 6 PPa6 6 6 PPG 6 6 /PIP16 6 WPqP6 6 PP6 6 PP6 6 PP]U9WVv3~LQt FF؊Q*䩀tv~9n0nWFױ‹FF u~t^_]U3vPbPu]U3vP]ÿ 6+rׁ sI6&6&ƱH60!6<s*3P !DOS 2.0 or later required $6+۴J!66,5!66% !6p"6r36ns6vڻ6nz +3r D!r €t@Ky]^zzsS[CC+Y3P Stack overflow Divide error Floating point not loaded 2@!PY+r ;Nr22U^>!r ƇƇU>tvI]UWVv3VD$<uLF2t .K%=uv !'VN!sF%=uLMt VC!tWuRGuK LV=!rǓD!€u-ѸB!ٺ ?! t> uًѸB!3ɴ@!>!F$ LV=!r;FuhMvYN2LuFuV!F$ LV=!rMuFt VC!dUWVv t"<tV?PVWQPtPWC9}>| ㋇wVPVWPPW^_]UWVZVBFPvVMFVWF^_]U^t3NV?!s thVW :t<uƇG+_^Ãt< t@tD! u ?!rհ /?!r t~t ѸB!> t V딋V뒀> uUWV~3O~߹Aً^_]UWVv~3AًD3:ErtAы^_]UWVv~AZa*$ t tFG:r:w:r:w:u:t r^_]UWV~3Aً~^_]UW~3AOFG8t3_]U^ tB3ɋ!suNV3WVe @u2Q+I!s I t/F@!s 4 tYQ+!s  u@t ^?uYr^_-NV@!s u@t ڀ?uUKv_YNV2r <"s < r<v2טÊUzzsS[CC  t ~uF%!pnFL!UVvZuu |FP uVP<.uFVPy.l PP3PۋAZ6___hhhhhhhHhhhRh2hhM>t F=%tG=u+PV^_]USWV~ t>tWFV)>tFF FV>t F FtF36>u*~}$~ u-FFV؃ډFVFFvWvv >t W+ȉN0FFN >ztu |t ~u3PU^_]U%WV ~tF3F uFHv]>t 9s6>+>uWVvm>tW^_]UF>u6z6v6v ~gt~Gu>u>t 6>t>u 60 |tv t3P$]U3V>u8~O|F~7* 6~v@u^]UWV>uQv ~J3~O|~?*6~6/@uN ƃ>uF^_]UCWVv~>uL5~O|~و*6~P@uFO uă>uF^_]U WV63FF>V6F++~+>u<-u>0u P>0t ~>t~tF^>tFo>u&W~t ~u4>t ~uBvV>t  Wk^_]U3>t+ P]U30P>u>ztXxP]UWVv<*u?F:3<0|3<9.9>u <0u0ȃ0<0|<9~^?^_]UVVO 8FuF<u3^]ÏT3&>reP,3ы&8uы&GA:t<"t< t< uX+O+ tB[%+ $+C P܋ t=<"uV t.<"u}\uOGE7tNVF t%u᪋KK;sD u&&T< t< ÏV3ɋI6, tEuE@$ϋ3I ~EE uN&&VU^g]UWVv~ FfFF t;E u>Eu/M}| * WP9E t3FNEuEu~uF9ErPV5F)EFFӃ}t!uV5{EE)FuEM}| * WPE uFNWPE t F+F+vFN~tM}|ϊ*^_]UW~3@@_]Ug]U]]US]UI]U?]UWVvDtD@tDtL Ld3D~DuDt0<+| ~WtDPgFD@D\FjDuNZu-DP u5DDƇ븸PD tL뛀LWFPDPF9~t1F*^_]UWVR3Dt V@tG96s^_]U^O]UVWX?u)u3$@$XZD6^N؎_^]U^}| @t3]UWV~v׋N;v;s NO! s 3rIs&^_]UWVN/ً~3A;vvD3:EwtAы^_]UMsAwtBH;st4Dt L+HLƌځ t&f&j=t%tH;stDG t&jt= t&b7뽋w3Y;t $@@Mt M tNN3QEt+IAA&;hvurr #+ uu3YRQtWDw+JUXYZSP3RRPPkZ[t WVN FV~W t u y -ۃڋ3 t0<9v' uODO;rX^_]UVW~u8VFHuSr'H6LHt;t DF V:^s0Ls uڃ۱H!r钉T6L3_^]ËN 9Lt Lu?r9ӎ;u9s&;u ١+؎J!r ;uC Library - (C)Copyright Microsoft Corp 1985Null pointer assignment %Z%%M%:%I%Microsoft (R) EXE File Header Utility Version 4.00 Copyright (C) Microsoft Corp 1985. All rights reserved. P@(#)exemod.c:1.8exemod: invalid .EXE file (bad header)invalid .EXE file (actual length < reported)(warning) file is packedinvalid .EXE file (bad header)cannot change load-high programmin < stack (correcting min)min > max (correcting max)RB.exefile not .EXE.exeusage: exemod file [-/h] [-/stack n] [-/max n] [-/min n] hstackmaxmin(dec)(hex)%-32s%8s%16s .EXE size (bytes)%-32s%8lX%16ld Minimum load size (bytes)%-32s%8lX%16ld Overlay number%-32s%8X%16u Initial CS:IP%-31s%04X:%04X Initial SS:SP%-31s%04X:%04X%16u Initial CS:IP%-31s%04X:%04X Initial SS:SP%-31s%04X:%04X%16u Minimum allocation (para)%-32s%8X%16u Maximum allocation (para)%-32s%8X%16u Header size (para)%-32s%8X%16u Relocation table offset%-32s%8X%16u Relocation entries%-32s%8X%16u exemod: %s  ((((( H Error 0No such file or directoryArg list too longExec format errorBad file numberNot enough corePermission deniedFile existsCross-device linkInvalid argumentToo many open filesNo space left on deviceMath argumentResult too largeResource deadlock would occur: Unknown error NVWqrstu23456DUV% ;C_FILE_INFO  (null)+- # PE8087 Y!,AEDIT MAC ]!AEDIT BAK `!CL EXE J!jCV EXE Q!?)CV HLP S!۳EXEMOD EXEr!0MZ O.BuU3~PHP5~PP'~P]Ua~tl ^ww u P +P^wj- } ^wU +RP6r-6p-+n-P^wl- } ^w ^G*>u+ ‹+‹^ -t-F v +P]UfP P6j-=u> MZt> ZMt .P > u> u MP +P ȡ +ӱȡ ڙڃSQ6j-?PFP6j-YFlPFP> u oP! P+PP6j-FV+PRP6j-> t ȡ ڙҊԊ*ځp-r-9V|9Fs P  +ұB)p-r-]UWVr- |=v Pe +P RP6j->> ? PF t+F tb Pv6j-* ;t P v> ;sgD+ұ ؋+ɋ p  F+V] D+ұK ؋+ɋ N~wF^ "FFء^ ^ꋇ @^ F~|؁>^ w^ Ph+ u P* FFF؋ h+F~|Ճ~tJv6D+ұ FV™㋇ h+F;rvDi+P RP6j-B  F=V/ D+ұ FV™㋇ h+FN~w ^_]U WV  ȡ +ҋ +׉FV$FV |=s FFFV  PP6l-+ j +PRP6j- FF +ұ< FVn^ 9Vk|9Fsdf+>f+|(b>b| ` ` ; dd*#b>b|` ` * PF FVn눸P  RP6j- FV FV9V~|9Fsyf+>f+|(b>b| ` ` dd*#b>b|` ` *vPFVn^+Pn^~|#~vf+>f+|*dd*^_]U WV+P+ұ RP6l- +P +ұ RP6j- b>b|` ` *FFFFF~rp-r-9V~|9Fvb>b|` ` *eFV;tp-r-9V~|9FvFb>b|` ` *FVp-r-9V|9Fw ;u~rn-9FsQ~s0~v*f+>f+|Ƌdd*VNFf+>f+|>Ƌdd*5~w~uf+>f+| Fdd*VFF*Pf+>f+|Fdd*FPaf+>f+|dd* P<Fn-9Fsf+>f+|Ƌdd*V f+>f+|Fdd* F*Pf+>f+|Fdd*FP~u,f+>f+|dd* PF%f+>f+|dd* P]n-;~v5FF%f+>f+|Ƌdd*V#N~uՋFp-r-9V}%9Fwp-%-%F w+p-r-f+9f+|*dd* +Pf+>f+|Fdd* F*Pf+>f+|Fdd*FP_f+>f+|dd* P:~^_]UWVP+PP6l-FV-FVf+>f+|dd* PFuFVV+ ;ȡ +ҋ)׋ȡڙڃ-;r-|;p-v PT  t-  p-r-t-^ +PP6l- ^ P6h+6l- ^_]U }WVt-FP+PP6l-FVF ap-r-RFǣ FF 9FrF+F+ ǣ +PPP6l-@PP6l- ~u t6, P6,P P+PP6l--؀F$f+>f+|*dd* +PFN u+P ҊԊ*RP6j-Rb>b|` ` *q@t$f+>f+|Ƌdd*V^_]U3#PPPP]U3 P7PPvP]U3APvDPPDPoPDPP>*t6l-6*`Pv]U.PRP6j-sPFP6j-FPFPr u+]UWVvb>b| ` ` FO u^_]U3Pb P6j-b ` c bb *]Uhd-dHHFPfP6l-y;Ft Pf+Ffdg*]Ud-dHHFPfP6l-/;Ft Pbf+df]U3b]U3f+df]ÿ+6+rׁ~-s6&"6& ƱH60!<s3P6+۴J!6-+3 , P P 666{3PUPQP PPY+r ;tr22USVF uNF3؋F<ȋ^VF u3RPv v ;Vwr;Fv3ҋ^[]U^>!r ƇƇUyvgȉNV2zF2t .y%=uvN!'VN!sF%=uy{t VC!tWuRuK zV=!rǓD!€u-ѸB!ٺN?! t>NuًѸB!3ɴ@!>!F$ zV=!r9%Fuk{vgȉN2zuFuV!F$ zV=!r{uFt VC!UWVv t"<tVPVWP|PW6 VPVWPPW^_]U^t3NV?!s /t(VW :t<uƇG+_^]Ãt< t@tD! u ?!rϰ /?!r t~t ѸB!> t V뎋V대> uUVW~3O~߹Aً_^]UWVv~3AًD3:ErtIIы^_]UWVv~AZ $ t tFG:r:w:r:w:u3:t rIIы^_]UW~3@@_]UVA!cU^ tB3ɋ!sPuNV3WVe @u2Q+I!s I t/F@!s 4 tYQ+!s  u@t ^?uYr^_NV@!s u@t ڀ?usAwtBH;st4Dt L+HLƌځ+t&&=t%tH;stDG t&t=+t&7뽋w3i;t $@@]t MtNN뚌=+t&G3QEt+IAA&;vurr #+ uu3YRQtWDw+JUXYZSP3RRPPMZ[t U WVF6<t'!CûsS[CCûD!r €t@Kyô0!Î&6,5!%!6"636s6ڻ6r3]s ]2â u#>r <"s < r<vטÊUsPX t ~uF%!FL!UVv~u6D u0Du!D^ DƇDDhtuZDuTDuE>^ tD^ DDƇd멸PoD t DL3^]UVv~u9Du Vs3h~tb~uDPh t VM0tu8V8$DDttd DƇ3D^]UV3522U5u&4$ t PЋ23Iك@!25^]U~u(@"sPsq">Ps#X~u܃66_?,3ы&8uы&GA:t1<"t< t< uX~u܃66_?e+ tՋZ~u܃66_?%~u6, ʋË6ؾ%~u$66C 33ɬ< uTetN~u&?Ë6جF~u t < t-u~u&E| t~u &E&]< t< <\u<"u <"u< t<"u|\u O~uUՎ3ɋI6, tEuE@$ŋ66͋."."ϋ>""3I&~ u&N]U~|9F|F%^㋇P]UVF N؋Fږf؋Ӌ^]Uv!Ћ3III@!]UPڋд !]UWVv~ FfFF~t~u3EuEu~uF9ErPV5F)EFFӃ}t!uV5EE)FuEM}| * WPnE u!FNvVEPF=t)FF+F+v^_]U~|~ |F ^㋇]ûsS[CCUWVvDtD@t L DuLd3D~DuDt0<+| ~WtDP'FD@D\FhDuL~u+DP+ u3D^ DƇ_ 뺸PD tL띀LWFPDPF9~t)F*^_]UVW~u8"VFHuSr'H6rHt;t DF V:^s0rs uڃ۱H!r钉T6r3_^]ËN 9Lt ru?r9ӎ;u9s&;u ١+؎J!r ;uU^}| @t3]UWV~v׋N t5;v;s NO s 3rIs&^_]UWVv3Dt V^@tG96>s^_]C Library - (C)Copyright Microsoft Corp 1985@(#)epmsbnr.c:1.5Microsoft (R) EXE File Compression Utility Version 4.03 Copyright (C) Microsoft Corp 1985. All rights reserved. 6@(#)exepack.c:2.23exepack: (warning) omitting debug data from output file can't pack file onto itselfinvalid .EXE file (bad header)can't change load-high programRBcan't pack already-packed fileinvalid .EXE file (actual length < reported)out of memoryerror reading relocation tableout of memoryfile not suitable for packingusage: exepack exepack: exepack: DNRB@(#)bufio.c:1.4Out of space on output fileOut of space on output fileMZ' +RB OP2PˌÌH؎GHt 1+Ўځt +ЎNF$6 -؎֋./@ʎں!L!Packed file is corrupt+".j+j+:  ;C_FILE_INFO  @(#)syserr.c:1.1Error 0No such file or directoryArg list too longExec format errorBad file numberNot enough corePermission deniedFile existsCross-device linkInvalid argumentToo many open filesNo space left on deviceMath argumentResult too largeResource deadlock would occurUnknown error!"<=>?@Rdtuv !?& error 2000: Stack overflow error 2001: Null pointer assignment error 2002: Floating point not loaded error 2003: Integer divide by 0 DOS 2.0 or later required $ Not enough memory on exec $ Bad format on exec $ Bad environment on exec $ Abnormal program termination Unknown error  .Jg}z"MZ: $+Ux *P P@PKPFPxPFPD]UWVv~*@F8=a| =z- FuAF FV  F F + LJ F96 w^]UWV+㋿ tW<F96 w^_]UWVv~,؈FNЋ֋#‹֊N ^_]UWVv~Ƌπ#‹ ^_]UWVFF؊*ƉF^^^ ^ x^F* P^7|3Nj^P^ 7.3Nj^ ^N* P^ 73Nj^ P^7*3Nj^N u^+6 ^+6  u^^ %+^ + u^ ^_]U+PF+ҊԊ*  RP6 D6 PPvC=t  G% ]UWVv~FO u^_]UWV^F^~* thPv  t5^*@@** F+Ҋ va^-^F ?%r^/%^F9u+ ^%t^_]UWV> u+FPFPFPFPv FF^㋿ tPFPW;DF P8+PFP^ :vvm u^ 8vFPvv t ZFF 9Fr)FF9Ft]6^_]UWVFPFPFPFPv FF^㋿ tPFPWE:9F P7+PFP^ :Pv^G%vFPvv ~ t^ 7^*^O%*;rG%^~^G%*^FF^F~F^F9Fv^ 7_FV |=vP P1F^FFV_F^F| ^G% ^G%+&^G%FF 9Fr)FF9Ft^_]UWV+Fƃ%rFƃFƃr6 PPPD G% ^_]UWV+P6 6 6 @+96 vD㋿ t,PFPWB86 PPv_D=FI t+^_]U WV uFV]FV66vv!\@FvF+v@F+ҹ%F9vsv+㋿9~wFヿu+^_]UZ^  u P4P/v ^ 7vvv]U츤PXPd>>t4P"P%>P*PPP0CPoP)>> t6 ARPrPP=P}P=PP=P"P=P P=> t6 <P/IP+P.]UWV Ox ?* 6 U7u^_]UV^]UVtց^]Uh!j!6 FP< G t P6b!FP<b!G t Pf]Uh!j!6 FP< G t P2]Uh!j!6b!FPY<b!G t P]Uh!j!]UF+2h!j!6 PPv3A;Ft P6b!vPvA;Ft P]UF+h!j!6 PPv@;Ft 8Pb]UF+h!j!6b!PPv@;Ft UP-]UF+h!j!]U~t(~t~ut!7 l! 4t! l!] &~t~ut! l! t! l! ]UFPt!FPt!]U~rF Pt!FPt!]UWVv9s+6 WPP;;t5WPl! u^_]UVVVV^]U> t6 8PEPv+]UWVv<:t <\t!t(+FX.tH^XFFXu0>!u1PF^FF.uFȢ*F!!PR~tP tuP*PPP=PrP8PP8PP8P PX8Pg7FFt! l! F~tc*FvPP CPP7 u-PPP7P P7P+P5)vƘPt!F*FvF^*Pt!FN~wt+ƋƘPt!F^]UrPHPt!ppPt!rp=tppPt!rp=tsPt!rtPrP+PtP uPt*PPuP;P(P6P*PPP;PP6PP6P(PT6P*PPP_;PPX6P P 6P/5rU]U~t!9Fr+^`$<u]UrPFPFPr~rr~rr~t5~t,!w!!F`FPt!NFt TKF%F t=u n~unPxFPnF+Tv^]UF  F+j!h!6b!vv !vv tFFF+FFFFPt!~u*F=t =t =t 'FP~u~u vv~t6 @1 F]U> u+B*P PA2F u* P-PPN2P Pw2P1F]UV+F^F?u^]U츜P6 a2PF1]UWV> t  g> tT> u6 t1ttPV16,6 ?0P0  > u! F؋F u<@u^؊*䣆 F< tw< ts+  t < t< t ?u ƅ JP P0 uPMPa"> t <  ?tT tG ; ؊G D t > u6x* Pa*t tփt-@tkx* P**u+w t҃ t+ t t u'ƅ gP P/ tPj t Gƈ x* P)u^_]UV> t "  h OF u " w~ t~ tF=+tUv= t=&tZ=*uȸ@ø뾃> u~:t> u 둸댃~ t ~ tzF= u lF u\=+uT~*uHF <~F u,=-tܣ !=,uQ=-t=/up=:uF=;u9B~\t<~_t6~.t0~$t*~:t$~ar~zv~Ar~Zv ~0r~9wFFF t~uh uF ^]UVF^?a| ?z- ^^?a| ?z- ^;t+FF^?u^]UD=tPPh Pvg8F~u+=t "  F=tPPh PF$ P8^Ƈ k=u-c=tPP\h PF P7"  FF9Ftlw]UVP!PM,! t~t@ eF[ uPP uF =nu +PP+PPPPP >!u!!Pv!P/7!1Pv!P+b! uyP4Puir!PFPFP6!: t8!PNPP+P P+6!:*PjP!6r!vvv6!, ^]UV  zP!PF .P!PG!P5 uP!P5!~utP$ P@ uPP P'FFuNus, PPP*P P*P)6!""  =u+P^]U F "  =u?+Pv ~t'.PvHFP4 u vv4]U.PvFP4 u Pv4vP!FVRP2#F+GvFP4vvF#! !t.6f 6d "F؋FVW6f 6d # FV!!FVd f ]UWVFvG^8.tF~Fk^8u~ƃk!FjjP u,vPP(P P)P( +FFn!p!FV t(Rv "d؋FV9W}9Gw PFVRP!d؋FVGWdFGdFVWvv!F Ftevv!d؋FVWvv!Gd2FV9Wu9GuF Gvv֋FVFVdWFVn!p!^_]U@ 3" =tav=t=t5=tkPP+PFP FPN +PFPPFP+PFPPFPv+PFPPFP+PFP멡"  q=t=t= u/=uI"  ]U +!!p!n!r!!!b! !!v!  ]UWVv~|:u!ur!!r!9!u>!u+ =u>" t"  =u>" @t>" tPP+P P#P=u>" @t>" tP/P> t>!u">" @uIPP$P P%C>!t?> t8nPv!PsPTR>" t>" tv!PP;> t"6 5#P P$P#>b!t!9r!u > u>!u>v!tv!P!P u6!"+F!v! uN!.uP!P,/!P/!Pv!P` tv!PPkP!P#! uPPH!Pv!Pl#b! uPP^]U WVv~*F *N;|F9FG=a| =z- F*u_^݀p!uPF6*p*PPqP>s+P.P&>$v>4s4+P.P4P.PwDP>6v.6* P*G tP`P: 2>"s"+P P"P PvvDTFVFVDTF Ft(vvFVEUvv FVD T>,tpP׃ tPP| ^_]UDWVFF FuC~u~FCSFVRPvvDT FV뵃~uvv+FFN~FVCSvvDT^_]UV FVF Fu1vvvF؋WFVG WFV6* P>t6* PFPs+P P>P P0^w wwwP6*o 6* PF Fu6w'+ҹ t+ƋV P6o>t6* P^]UF*~t+,6 6>*t6* PW>,t!׋]UWV^Ox ^?* v^Ox ^?* vi ^_]UV^OxF^7*vFP@u.^OxF^7*vFP^]UP+PR]U !!@0PP]U]UVv,F=tvFFuNu;FusT^ 7v^Gv+ҋ+^ Wv^+PPvv^G% ^]UVh!j!!!!N#6!t!+Ƌ>b!tV+6!!^]UVNp3d!f!tvvFPFP6f!6d!vvv tFh!j!d!f!NN#6d!t+ƃd!f!~u&+P6f!6d!3vvF=td^]U&PPF u4PP PPP PP.v2F=uW!vPFPFPFPv tPPPPvv~uU!+FFvv{+PPv߃ u h!j!FV!vF=td~ua!v5Fv)FF+҉FV+PRvvFN u+PPv߃ uvvvڸPPFP~et!mFtFVvFVFV=PFP t&PFPXP6+PPvvރ u+PvvvUvڸPPFPV=uv!7PPvGPPsP PPv]UV^^ l nu]n! p!tT6p!6n! n!p!FVTn!p!DTlnD%4D%2vvln9Vu9Fu^4^ 2+nl^]U WVvv>b!t!PP!\/!!>!t8!!PPz6r!6!!6!!! !tH6!6!~ DPP/!!FVT!!vv믃>b!u! t+NjEPP+!!6!FP6!6!6b!/у +PRP6b!6!6b!56!6b!'v6b!b!G tPPܣ!>b!u t6!6b!D>b!t6b! b!>!t6! !F^_]UVv 6b!+PN ub!G tPP;^]UVv6b!FPV6b!KV^]U츜P ~tvpPP=P Pf~tvPPP PAPP >v!tJ>b!t 6b! v!P>!t9>!t 6!p >!t!v!P!P.>!t 6!H ~tv v ]Uvv]U츀PP @ti6 PPJ@tKPP P PY ),APPP P P6 PE PP]U>t6 @u P@t+]UWVN9FsvvXaF++ҊԊ*FV+PRv6;Vu;Ft(++PFP6 ~r+^_]UWVN9Fsvvk>uF++ҊԊ*FV+PRv6;Vu;Ft(++PFP6 ~r+^_]UWV~DFr PF uPP+HwP㉇  uLJv+ƄF؍D^LJFGF@r^_]UWV6~ tdž~^_]U^~F~]UV6  t ㋇ ^]U^ F ]UV+Fޱ늇΀uޱ΀D^]UWVv>u6 ㉷v硂6Džv^_]UV6 t#㋇v u LJ^]UWVv96u3狝㋅vv96u 狝v㋅^_]Uvv/]Um^ uP'P^LJ]UV^㋷uP>P@u?VƄ5+^]UF=r Ps Ƈ5 +ҊԊ*FVF@% 5FV]UFV G'F5u 9Fu v]UWV^㋷uPRP@t?㋿VPV? t]ɀ v^_]UWV uN㋿5t' u4 WF t WfP㋟ǀ̀Ƅ5F؋F^㋿?^^ƀV t$~t WC t WyP^_]UWV^㋷@uvv  ?V]^狅 ^_]UVFV }%;6tPPV6F^]UFV E%P=]UWVFP3~^_]UWVFP3v^_]UH!Ku3SH!@[]UWVvDtD@tDtL LD u-D4 uP> D tDDtDLJ6 |uD5 DDž6 DD6 tP D  t DDCL*^_]UWVvDtD@t L DuLd+D~DuD4 t@<+|D@D㋇6 HD ~WtDPMF\FDujuCDPq uQv DDƇ4 LJ6 D릸P D t L@D̀LWFPDPF9~tF*^_]0U^>!rƇ( Uc NlNV2 6< PPdP0!$ D!r €t( @Ky5!  %C! '" &6, 36 6 ڻ6 " &,43&=t*  t 3u( tH ]UP GU 9e3( t>!CFL!   %!;s OO UWVvDuD@uzVD㋇8 FV DPS }C~t;L PFP" Q PFP  PFPv"FP +D^_]UWVv+D$<u@DuD4 t'+DF ~PtDPQ ;FtL DD^_]UVvLx *Vf^]UV tVvv +^]UWVv 3FPvvvVg^_]UWVv~Mx Ƌ*WV^_]UWVv;vz vWPvFvV 9~u ^A^_]UWVv FfFF~t~uFDuD4 tm~uF9DrP4v^F)DFԃ|t t4v;D)FFDV@t9^FLjNvvDP ~)~u DF+F+v^_]UWVvDt^~ wXDFDtQ~ uV.FVF VrDtdv vvvDt=tD uLD4 u9PD tDDtDLJ6 DP+PPvFVu=tP+PPvFV+Pvvv~ u!F Fu2DN^+N^~ u FVFVD㋇6 F~} FV9V~|9FvDtFRPvvN^+ډN^|tVFRPRPFV-RPRP;Vu2;Fu-+DD^( t`DO ~^? uOL+Pvvvu=uKD6 tvD }%Dlj)|+^_]UWVv|}DDF( t DuP+PPvFV }Du(D4 uDȋڋFV++DFDt^( t| = uFG9e F2t .c %=uvVF$ Ǵ=!s=uF%=u >! D!€t d d >!f t VC!tQuL@u u@ e V=!rѸB!ٺb ?! t>b uًѸB!3ɴ@!>!F$ e V=!r7FuUf NN2e uFuV!F$ e V=!rf uFt VC!U^( t3kNV?!s /( t(VW :t<u( G+_^)]Ãt< t( @tD! u h ?!rϰ /h h ?!r t~t ѸB!>h t V뎋V대>h uUWV~V!_U~t~t  tH j J l ~uF J D H ,>F u#5!F D O%!FH ȣJ j l ;D u ;F u3Ћ]ÜPRR؃>B uH J =tb9D u29F u,UVVEE<uD FF F]ZXˣn p UWVQSD H F J Pn DD[Y^_]ZX˸PNs P tP6r r ʻ XN6.z SQR2PPr ZY[UVW~3O~߹Aً_^]UW~3AيFO8t3_]UWVv~3AًD3:ErtIIы^_]UWV~3Aً~^_]UWV~vߋN t2^_]UWVv~EttE uE4 u 9Eu}uE ƈe*^_]UVA!U^( tB3ɋ!s( uNV3WVe @u2Q+I!s I t/Ft @!s 4 tYQ+!s  u( @t ^?uYr^_cN uWV@!s u( @t ڀ?uUVvDtDttd+DD^]UWVv^=atD=rt =wt3+FF^?+uNFF%=t=t3=t3FF+Ft^?tu@߿ ڋ^?buPWvuF }sFtDFtDDv FF*^4 DLJ8 +DFD^_]UWVvv u9D u3D4 uDƅ4 Dž6 DNtu@Du:D4 u%>tDDƅ4 Dž6 d+^_]UWVv~u9Du V+_~tYuDPi t V}tu/Vh$DDƅ4 Dž6 +D^_]sAwtBH;st4Dt L+HLƌڌ;t&| & =t%tH;stDG t& t،;t&x 7뼋w3j;t $@@^t MtNN뙌،;t&| G3QEt+IAA&;~ vurr #+ uu3YRQtWDw+JUXYZSP3RRPP[ Z[t UVWv3ڬ< t< t<-t<+u<9w,0rҋˋ؃ܓu؃_^]V3622UtP ^r3]s ]2â& u#>$ r <"s < r<v ט ÊU^}| ( @t3]UVWNF3҃ u~ UWV~v׋N5;v;s NO s 3rIs&^_]UVWRV ;t@t 3_^]UWv t3I@!_]Ubg WVvFF9<%t+ |0u;F02<-u'<+u < u >u FP= uVP<.uFVP=Ft9=Nt<=ht'=lt=pt%>tt>u5P:P.PU+P듸4>tNNYYZZZ ZY Z Z Z ZrYYY Z ZY ZY Z ZY>t>uIG u:=F=%tG=u+PP<t>uG t^_]UWV~ t>t>uWFV)>tFF FV>t F FtF+6>u*~}$~ u-FFV؃ډFVFFvWvv>t W,+ȉN0FFN >tu t ~u+P^_]UWV ~tF^>uWFVFF^>u F Fu ~u F^FVFV+FF^&?u>t ;v6>+>uW Vvve>tW^_]UF>u66v6v ~gt~Gu>u>t 6>t>u 6p tvS t+P]U3V>u4OxF7* 6v@u^]UWV>uMv ~F/Ox?*66/@uN ʃ>uF^_]UpWVv>uP9Ox^&?*6^&P@uFN u>uF^_]U WV6+FF>VF++~>u<-u>0u PN>0t ~>t~tFa>tFs>u&W~t ~u7>t ~uFvP>t  Wq^_]U3>>t+ P]U30P>u>tXxP]UWVv<*uF:+<0|3<9.9>u <0u0ȃ0<0|<9~^?^_]UV 8FuF<u+^]Ï " &>$ rEP,3ы&8uW^[%+ $+C P܋ t 7tNV< 2 t #uEڪKK;sD܉&> & < t< <\u<"u<"u< t<"u|\uOUU" 3ɋI6, tEuE@$W _ϋ.@ 3I<;Ct~EE uN]]UVDu+DDDD ƃ; u+^]UW~3@@_]UVW~u8 VFHuSr'H6 Ht;t DF V:^s0 s uڃ۱H!r钉T6 3_^]ËN 9Lt  u?r9ӎ;u9 s&;u ١" +؎J!r ;u Y+r ; r3UWV+Dt V@tG96 s^_]Ë r59 s%Pرً" +ËشJ!Xr$H .  ËsUVWN FV~W t u y -ۃڋ3 t0<9v' uODO;rX_^]øUWVS3F }׋VFVF }׋VF V uNF3؋F<؋NVF u3RPv v';Vwr;Fv3ҋ t؃[^_]UW~F ^Nt f_]USW3F }׋VFVF }VF V uNF3F3 uEJ؋NVF u3RPv vY;Vwr ;Fv+FV +FV u؃_[]22ô!2eC Library - (C)Copyright Microsoft Corp 1986- %Z%%M%:%I%Microsoft (R) Library Manager Version 3.04 Copyright (C) Microsoft Corp 1983, 1984, 1985, 1986. All rights reserved. @@(#)liblup.c:1.2 %)+/5;=CGIOSYaegkmqpage size too smalltoo many symbols@(#)libomp.c:1.10Invalid object module " near %lxH in file "Fwrite to extract file failedwrite to library file failedwrite to extract file failedwrite to library file failedwrite to extract file failedwrite to library file failedwrite to extract file failedwrite to library file failed: module redefinition in file ignored..objwbcannot create extract file "%s"): symbol redefinition in file ) ignored): symbol redefinition in file ) ignored@(#)newcomm.c 1.5wtcannot create listing "%s"rtcannot open response filertcannot open response file syntax error (bad file spec)syntax error (switch name expected)syntax error (switch val expected)rbLibrary does not exist. Create? unexpected EOF on command inputwbcannot create new library%s: invalid library header.invalid libraryLibrary name: .libpagesizeunknown switch%s: page size too small--ignored.obj%s: module not in library; ignored.Operations: syntax error (bad input)syntax errorList file: comma or newline expectedOutput library specification ignored.libOutput library: missing terminator.bakcannot rename old libraryrbcannot reopen librarywbcannot create new library@(#)newcrf.c:1.3error writing to cross reference fileerror writing to cross reference fileerror writing to cross reference file.internal failureOffset: %08lxH Code and data size: %lxH@(#)newmas.c 1.8error writing to new libraryLIBrb: cannot access file.: invalid library header; file ignored.__.SYMDEF: invalid format(%x); file ignored.** Error: %s; cannot continueStatus: %x@(#)newvmm.c:1.1VM.TMPVM.TMPVM.TMP has been created.Do not change diskette in drive %c:cannot open VM.TMPVM.TMPinsufficient memoryno more virtual memoryMark: not allocatedFree: not allocatedcannot write to VMcannot read from VMx``(xt, R L ;C_FILE_INFO\TMP\" 4    (null)(null)+- ##1b<> error 2001: Null pointer assignment error 2000: Stack overflow  error 2003: Integer divide by 0  error 2004: DOS 2.0 or later required $ error 2009: Not enough space for environment  error 2002: Floating point not loaded BOsRB OP2PˌÌH؎GHt +Ўځt +ЎNF$6 -؎֋./@ʎں!L!Packed file is corruptnBOWMZz. (o0p!#"V"%h l U3PHP#PPPJ]UVF NF;F ^7 t_8FuXD=St/4=Dt =It=Nt7 NF  =dt=it=nt=stɋ^?u72=PVB t,P^F7l@u P+P^7 uōFPPPP tvG6 PPP~p ^7 +P^]UVv uP6 +^]UpWVvV4@PVW^_]U3B>huL>ht h?u$vPP uhhh? u hh]UvF=#uv|F@t~ uF]UWV>"t6""wv t tuX uN~ƈGvs t t tuGu" u""^_]U3 WVv~4<u<^_]U3>| ~9|$ ㋇2]U3+Pv]UWV > u9v2P6: uP64PP FhruFPuO=:u|=PP t;u =PvFL6 vP<r=u'v=u*F u ^PvP t `PvW~t5 uvPP[+PP @t|PvPPDDDrPP  tPP6 PPPhpWpGpDPP+Pk u6 Pr=us6 PP uh.PPWTt=uC h> utPDp tTwPpዞtA#t'P{FW^GvDP =PD^wP^F uPs\?.uGPP u 6 VP F6 Pr=t&~t 6 s ^_]U3Pv v vvv P0]U3(~t6 6PPPPv v vvP >| *P PP]U3PPP]UF7FPFP~/t ~-t/F*]UTV^?t :uF/PvnF\Pv^F9FvFFF uFFF.PvF u!+PvF^FvFF9Fr^^]U^F8uFF^F u^?u+]U wWVP^7 tP^wFP6 F<uViPn t4^G^wWP G^F uOPVmP+ tW^wtW&VpP t^wWOPԬG9~v]9~wP^wsP6 #-F^72;F}+F@P^70^^?uP6 P^7^_]U V6 V4 u^]UD VvVVDP_DVF@@PM^F uDVF@@P/^F uFFPt utP+PKF~uBDF u5> uwP>t ^wF u=t/P^wP6 > tFP PtPDF ueFP^w tFt^wP+P~4> tFP P^wP3F֋V9V |9FsF^놀> t&Pv^w'P6  > u P0 ^^]U WVv~~.t^FF^F u^?u.GvW^_]U .PvF t؀/t \t.u^ vv;]U .PvF t؀/t \t.u+PvIFF+FPvvvF+FFP]U츼 WV^tFPw.+F؉DVNPFP^wNPFP! t~u9PFP uFF؍XPFP^wDuFPXP@tFDXP^we tVt<P6 FV^F t5?VtVDtDF؉F uVuYDtRNPFP^wXPFP^wDPXP@EWFP^w(PtEWFPg4 uԋ^w(PtEWFP34 u^_]U.VvP`MPPRP+P u`WPv t\PP+P 2V4+P( F=u>u\PP+P FF^]UWVv~F9~vn<ti<$u^|(uX)PDPVF tCDPgFP FN+;|*^)vW~vF듬G9~vG+^_]U3WVv~Wt8 u4 u+^_]U WV=PvF t FF6$4v tt u t~u6 P=u+,v" P F u vDvFPvF@P D tvP~t ~w|FP t\\?u!PPF+)F@Pty D uKvFDP'F> u}~vPP6 > tt4P $D6$^_]U WVv~"6 DPX =u V ;rڋ+F^_]UWV6$4v  tt u u|t&P6 K|=t$PW  uD}(u)PWj F uG^FDEPmFDDF+FFv vF FF@PD uAP6 vvvt P P ~|v>0v^_]UWVv^@F9vv3^O|^؊* v@t LjF u uP+O\u^O|^؊* vQ uN 녃u}vW p^_]U츈VdžxPv uQPP^ FPxxtGF ~t<~ txO}x7*FvQF u+PvzP\ SPzP F t+Pvj P P~ ؉^\t :tF\vv Pj P u WP^ j UP+xF=[tFj xO}oxF=]t = t=u;~]t^vj P  u^xO|4x7*0^FFxO|x7*xcF= t=ux8xO|x7*xO}xF7^]U3VvvvV( u+<[u]PV u^]ÿ6+rׁns6&^6&\ƱH6Z0!<s 3P-6+۴J!6j p+3U PyPr[666 31PPPoPPY+r ;rUVvDt D@uDt L LD u)DRuPD tD|u DSDDDtPtDPXD  t DDwL*^]UWVvDtD@t L DuLd3D~DuDRt0<+| ~WtDP FD@D\FhDuLu+DP u3D DƇR 뺸PD tL띀LWFPDPK F9~t)F*^_]UVC!rFt t UvP6]Ug v= ]UWVvDt(D@u"V*V DP }D^_]UWVv3D$<u!Cûf h sS[CCûD!r €t@Kyô0!Î&6,5!%"!6V "6X 36T s%6\ ڻ6T r3]s ]2â u#>r <"s < r<vטÊU WVvQRPD3+¹3+™RPFV^㋿t ƙ u~~G<RPF RPi3SQȋF ڙRPN^OQSQȸmЋFǙRPN^)FVFVȋFڙځN^FljF~  FVDPFFHFF F> tFP t n^FV^_]UP53IX t~u FU3%! V T FL!UVWNA~3ی=uWOOPW$;uBtHs; t2r#=u0GG3;u%MLt^Z믋 AA+@F3_Y _^]UVvDtDtt3d3DD^]UVvu6D u0DRu!D DƇRDDhtuZDuTDRuE> tD D DƇRd멸PD t D L3^]UVv~u9Du V<3h~tbuDP? t V0tu8V $DDttd DƇR3D^]UVDu3DDDD ƃ;zu3^]ÿ߹3 tȀQȀY3t@UV3522U5u&4$ t P-Ћ23Iك@!25^]UWVv^=atB=rt=wt1FF^?+uNFF%=t=t4=t4FF3Ft^?tu@޿ ً^?buPWvF }3@FtDFtDD2^㈇RD3DFD^_]UbWVv F F   x<%t  3  2<-u '<+u   < u > u   FP+ uV P<.u FV P.*  PP3PIۋN**********************> t> uF G u7:F=%tG=u+PV<<t> u G t ^_]UWV~ t > t WFV )> t FF  FV > t F FtF3 6 > u*~}$~ u-FFV؃ډFVFFvWvv1> t W +ȉN0FFN > t u  t ~u3PU^_]UWV ~t  F3 F  uFv@> t 9 s6 > +> uWVvm> tW^_]U"꡴ F> u 6 6 v6 vZ ~gt~Gu> u> t 6 6> t> u 6    tv t3P$]U3V> u8 O|F 7* 6 v @u  ^]U5WV> uQv ~J3 O|  ?*6 6 @u N ƃ> uF ^_]UWVv~> uL5 O| و*6 P^@u FO uă> uF ^_]U bWV6 3FF> VF++~> u<-u> 0u P> 0t ~> t~tF^> tFp> u&W~t ~u4> t ~uCvV> t  Wt^_]U3> t+ P]U30P> u> tXxP]UNWVv<*u  ?F:3<0|3<9.9> u <0u 0ȃ0<0|<9~^?^_]UV 8FuF<u3^]U~u(@^sPsq^>Ps#X~u܃66_?,3ы&8uы&GA:t1<"t< t< uX~u܃66_?e+ tՋZ~u܃66_?%~u6, ʋË6ؾ%~u$66C 33ɬ< uTetN~u&?Ë6جF~u t < t-u~u&E| t~u &E&]< t< <\u<"u <"u< t<"u|\u O~uUՎ3ɋI6, tEuE@$ŋ66͋.^.^ϋ>^^3I&~ u&N]Uv Ћ3III@!]UP ڋд !]UWVv~Ǚ 0FǙ0F^_]UWVv~ǙdPVǙdRV^_]UWVvl FlFF^^ ^^ EFG~|݃tWMtGW@tGW34GW't GWE^_]UfVF!]U9 U:U;V!U^>!r ƇƇUWVv~ FfFF~t~u3EuERu~uF9ErPV5F)EFFӃ}t!uV5EE)FuEM}| * WPE u!FNvVEP&F=t)FF+F+v^_]UBWVv~ uVo u T~3PFPnFP;| "3)3PPPnAG:G\GFPW?F^_]U^}| @t3]UV^W+  FVFP8 > t%VM 6tFVFP D^]U^t3NV?!s /t(VW :t<uƇG+_^]Ãt< t@tD! u ?!rϰ /?!r t~t ѸB!> t V뎋V대> uU츊;WVv~uv vVC 3PxP3PFPFPv v@u\PV' u.PW tvxPVv|FVP) u v 랸PVW;PRvxPWv)F>t+P.PWPvxPWvFWvF^_]UWVRv vvvF@u*>u#^?\t?t:tP uFPV,PFPV6 tVWGWe؀y\t PWKvWAv vWv'F@u>u P3P ut^_]UWVN&ً~3ˋvD3:EwtIIы^_]U^ tB3ɋ!suNV3WVe @u2Q+I!s I t/F @!s 4 tYQ+!s  u@t ^?uYr^_NNV@!s u@t ڀ?uUWV~uFvFt@F<uF@FF^u N~~| PFF~t^7FFPF^ u!~ t v ߃ F$^ ?v3P4WPI@<u~|J3P PWP#FGF^򀿪tGFFN uG~t^7WF~G^?ut GFv<uFFFPgFF^F?"uFFFF9F| P4] t FFFF=}~, ^7ރ~ uv ރF@F~t"G~t.FFF9F}1^?"u\G^FGF3P4WyP~t"G G ^FF^_]U~|~ |F ^㋇H ]ûh j sS[CCUދVvG!]UVW؋^ ã F  6 F )!) !U.<.&< ~t~t 32.5.6F F2t .E %=uv !'VN!sF%=uG t VC!tWuRM uK F V=!rǓD!€u-ѸB!ٺ ?! t> uًѸB!3ɴ@!>!F$ F V=!r9FukG vIȉN2F uFuV!F$ F V=!rG uFt VC!UVWU^vvw7^W]U^WN^W]U^vvw7N^W]UE vgȉNV2wts~t?K-J J-+JSVPDDPDDPDDPDDPtDDPDD^[FV;v&+KKr ;v+KKr~tNAr Ns;r~twPS&+;vPSQRPDDZY[J![rH!rPJ H&ڴH!r&,3v QNY~tٴJ!&3~t?KJJ+J+P~DDPuDDPlDD߃~uFFFFvN!v AA\ \v F)!tR#%!ZYƐ~ыt&K3&GP&GS&G!R&K3&G&GWV&6G&&GS&&GPK.H !sT<u#< u< u $3JJ+JG tKu״ !L!_Y^NjЭҋQ3P4¸!5!SIˎ!sT<u#< u< u $3J?KJG tKu״ !L!_XЌ+DZtӋ3PRP!5!SIUSVW3F }׋VFVF }׋VF V uNF3؋F<؋NVF u3RPv v,;Vwr;Fv3ҋ t؃_^[]USW3F }׋VFVF }VF V uNF3F3 uEJ؋NVF u3RPv v;Vwr ;Fv+FV +FV u؃_[]2tU^FtK~ t3ɋѸB!rPF uFVy+;N P ѸB!FVyN P B!ՋVNF B!rƇUVWv3ڬ< t< t<-t<+u<9w,0rҋˋ؃ܓu؃_^]UN0bG t I!&, tI!3A3ҹbG tSJ!B[&, t;r J!J!ڋË]UVF N؋Fږf؋Ӌ^]C Library - (C)Copyright Microsoft Corp 1985@(#)mamsbnr.c:1.4Microsoft (R) Program Maintenance Utility Version 4.02 Copyright (C) Microsoft Corp 1984, 1985, 1986. All rights reserved. 6@(#)make.c:1.23out of memorymaketools.iniPATHCOMSPECC2out of memoryunknown errorr%s - %s syntax error: macro with no name:syntax error: colon missingout of memorymacro expansion larger than %d pTarget->name = %s dependents = %s build = %s /\.%s(%d) : make : usage: make [/n] [/d] [/i] [/s] [name=value ...] file %Z%%M%:%I%8%s: macro expansion larger than %d$**$*$@%s: macro expansion larger than %dout of memorytarget does not exist '%s'%s %sdependent '%s' does not exist, target '%s' not built %s %s %s '%s' - %s (ignored)'%s' - error %d%s.*multiple sources <>| %Z%%M%:%I%%Z%%M%:%I% macro definition larger than %d%s = %s infinitely recursive macroout of memoryrt;;rt^ J.exe.bat.com?*@(#)syserr.c:1.1Error 0No such file or directoryArg list too longExec format errorBad file numberNot enough corePermission deniedFile existsCross-device linkInvalid argumentToo many open filesNo space left on deviceMath argumentResult too largeResource deadlock would occurUnknown error !"4FVWXhz{|}!& ;C_FILE_INFO ((((( H   (null)+- # : : .com.exePATH;\; ;C_FILE_INFO;C_FILE_INFO error 2000: Stack overflow error 2001: Null pointer assignment error 2002: Floating point not loaded error 2003: Integer divide by 0 DOS 2.0 or later required $ Not enough memory on exec $ Bad format on exec $ Bad environment on exec $ Abnormal program termination Unknown error = d  7 ;Zx0Nm:Yw/Mln ~ TZPSTPDTp SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec.com.exe###B#!MS$MOUSE..VPQRS.G u.G[ZYX^Nbc P@  CK(:d0??0?@`px|~|Fw7  Xdw  : d w  *** This is Copyright 1983 Microsoft ***dUv v v v= t=t= t=u T|tP^ t t tvv v v ] uZ.>t.. uPBX.m ..u.>upؙ66Сr6&QPSQRWVU<wS،Ȏ؋[!."{!u PXt0 kKwy>u%}2>t@  B>u}}2z%!}2J`B   HqHu3os|MHtv0$F.˃}+~JQFpF rF Ë ؋ km6&pÙ6&r>|-> þSt_3FDF DF QFþY t߾e oq sukm^FNJ>.vØtt#  j FdM+͸͸.;r.3.d(V..&؋Ȋ"u F.#^.#^....>#u.&խJuêËխ3ëJu2á }>t>ukgi t""Ԋʴ3MF 3OF >u&>Gu |!$!Éwy{}6>X3#KÀ>t !{ !ÌȎÐs" uwlkktp+8n>ynmmdtr+Ȱ >ueP#t->|t!u Qpr6M>OȎXt u ,]^_ZY[X%u };Kv>u>kt&rplϋeBJBrpȋJIs/=teut&|#g3iNp+txr+vzJӋI5s$2pr>|u|>t5>ku-{teut>t %.*Ë>~6VP3ɋ.l>t.áx6z.&խ#3Ju"2C&>#u8BU&%&%GMu]&%CٰJ&ðBU&&&&&&GMu]&&&C먋x""dd*t$|#؋Gr$ uؾ؋OreMuÀ>t.Ë>x6z~6|^À>t.Ë>~6r++6΋6À>tË6>.66+Պ.3Y } +~*Y } RQQ26Y;r+YZ +~*~ 2;r+u|8t  tÀ>t Ë>ӡ+6;r+ä3>|t6x~;}+=} z+}؋z6;~x$z366Ë"2˖.ÿ@&>N66Ë6o>q(6s>u6o>q6s>u;|;~;|;}|;;{| ;PS$u P?&&&& ss>t &&.Wt t@u&& u$&&`&bwr P>?tS@@^ r2PS[Xu _>uE0u@^Z Z&r@ءce=uN>uG>t@t u1\Z [XPSRZ[XPSR Z[XPSRZ[XPSRZ[XPSRZ[XÀ>tJPSQRȎ ZY[XÀ>t5PSQRȎ>ZY[X %QN 72&N*** This is copyright 1984 Microsoft ***3ء$0t<0u$.&t<0t .&ЀQW.&V.V.&~.~6&4`t@t+@t#w"<t< u2،Ȏ;Q;YȎ؈3ƅ]_YÀrVP%ȎX^πw!.6Ύޣ2.6..X }ÊËË VƄ]X}2 ÈWX3s_Wƅ]VXێÎ3QsY+%G_W&5X&E_WR&5Ƅ]VX&E&e$Z_WRQS؎V38ot/oOws+Ŋ$u<tFv|8.t,.W ~[YZ_WQ2튍\]ZێÎsY_Ì؎UF؋vF].UFv؉F]3؋K t3m3 u33@uy6t2ɬ< t< tt @2 !&5&u&&M$!r K&E&ú<:tCB'22 u|<uu uz{}<z{}<>"! "+Q3KuYP. Xϭ}z{>}uË}2J`2J J } uyt ! !.GO8ar NtLtRMOUSE: Mouse driver already installed $MOUSE: Microsoft Mouse not found $MOUSE: Internal Error 1 $MOUSE: Mouse found -- interrupt jumper missing -- mouse driver not installed $ --- Installing MSX MOUSE Device Driver V5.03 --- $--- Installing MOUSE Device Driver V5.03 --- $PSQRWVUȎ؎>}F PP$>t Ā$$ 2tt #Q ȉQ3҉6p>rĨ t(uY6[>]S6U>Wt(ue6g>i_6a>cY[>tPSQRWVUȎ؎>}ְ$ְ Ř؋ְ$ְ ŘP3Ћ6p>rԱ##Q чQ9Qt&wY6[>]S6U>W##Q Q9Qt&we6g>i_6a>cYPSQRWVUȎ؎}@u#t>t6Q66p>r3҉б## ч9t&wY6[>]S6U>Wб## ч9t&we6g>i_6a>cر$$?>r w # QȠMZ4 WcU~|~~ mP&^G F~tNv6 n } ^w~uJ^wFV w=v P~|~sPPF P+PP6 =Et=Et=Vt=ZtPh+P(6 '+P7]UWV+Pn؋bd-RP6 PFP6 h=t 6 nf8t PFGF;w> t=PFP6 =t 6 lF+ұ]RP6 PGF~u=>vP=PTPFP6 w=t 6 ^_]U3PPvP]U3vvPZ>| *P PP]U3pPPGP P9P]ÿ6+rׁ s6&J6&HƱH6F0!<s*3P !DOS 2.0 or later required $6+۴J!6, +3 I+43P error 2000: Stack overflow error 2003: Integer divide by 0 error 2002: Floating point not loaded 2@!P#)Y+r ;rUWVvDtD@t L DuLd3D~DuD>t0<+| ~WtDPFD@D\FhDuLu+DP u3nDDƇ>뺸PD tL띀LWFPDPzF9~t)F*^_]2U^>!r ƇPƇ<UvA]UWVv3D$<ut'+DF ~PtDP;FtL DD^_]UWVvFPvvkvV^_]U8WVvvvWPvtFvVS9~u ^A^_]U^FtK~ t3ɋѸB!rPF uFVy+;hjѸB!FVyhjB!ՋVNF B!rƇ<U2>F2t .%=uvl!'VN!sF%=uKt VC!tWuRuK V=!rǓD!€u-ѸB!ٺl?! t>luًѸB!3ɴ@!>!F$ V=!r8Fukv#YN2uFuV!F$ V=!ruFt VC!fUWVv t"<tVPVWSPPWE9.}>.| .㋇VPVWPPW^_]UWVV6FPvVFVWF^_]U^<t3NV?!s PtjVW :t<uƇ<G+_^Ãt< tP@tD! u  ?!rհ /  ?!r t~t ѸB!>  t V딋V뒀>  uU^P tB3ɋ!sPuNV3WVe @u2Q+I!s I t/F"@!s 4 tYQ+!s  uP@t ^?uYr^_-NV@!s uP@t ڀ?uUvfYNV2!CûsS[CCûD!r €tP@Kyô0!2Î,&6,5!~% !6"636s6ڻ6r3]s ]2â: u#>2r <"s < r<vט.ÊU n t ~uF~%!FL!UVvnu6D u0D>u!DDƇ>DDhtuZDuTD>uE>tDDDƇ>d멸PO D t DL3^]UVv~u9Du V3h~tbuDP  t V0tu8V$DDtt d DƇ>3D^]UV3522U5u&4 t 6%@!25^]UbWVvFFx<%t 3 2<-u'<+u < u >u FP+ uVP<.uFVP. PP3PIۋN_q{[v>t>uFG u7:F=%tG=u+PV<<t>uG t^_]UWV~ t>tWFV)>tFF FV>t F FtF36>u*~}$~ u-FFV؃ډFVFFvWvvY >t W+ȉN0FFN >tu t ~u3PU^_]UWV ~tF3F uFvn>t 9s6>+>uWVvm>tW^_]U8F>u66v6v[ ~gt~Gu>u>t 67>t>u 6 tv t3P$]U3V>u8O|F7* 6v}@u^]UKWV>uQv ~J3O|?*66$@uN ƃ>uF^_]UWVv~>uL5O|و*6P@uFO uă>uF^_]U xWV63FF>VGF++~>u<-u>0u P>0t ~>t~tF^>tFp>u&W~t ~u4>t ~uCvV>t  Wt^_]U3>t+ P]U30P>u>tXxP]UdWVv<*u?F:3<0|3<9.9>u <0u0ȃ0<0|<9~^?^_]UV 8FuF<u3^]Ï,3&>2reP,3ы&8uы&GA:t<"t< t< uX+O+ tB[%+ $+C P܋ t =tNV48 t )uEڪKK;sD u&6&< t< <"u t<"u }\uOuÏ,3ɋI6, tEuE@$ϋ3I ~EE uN&8&UWVv~ FfFF~t~u3EuE>u~uF9ErPV5F)EFFӃ}t!uV5EE)FuEM}| * WPE u!FNvVEPF=t)FF+F+v^_]U^}| P@t3]U^O]UVW?u)xu3$@$D6N؎"_^]UW~3@@_]sAwtBH;st4Dt L+HLƌځt&&=t%tH;stDG t&t=t&7뽋w3Y;t $@@Mt M tNN3QEt+IAA&;vurr #+ uu3YRQtWDw+JUXYZSP3RRPPFZ[t sS[CCUWV3Dt V@tG96fs^_]UWV~v׋N t5;v;s NO s 3rIs&^_]U8WVN&ً~3ˋvD3:EwtIIы^_]UWVN FV~W t u y -ۃڋ3 t0<9v' uODO;rX^_]UVW~u8JVFHuSr'H6Ht;t DF V:^s0s uڃ۱H!r钉T63_^]ËN 9Lt u?r9ӎ;u9Fs&;u ١,+؎J!r ;uFC Library - (C)Copyright Microsoft Corp 1985error 2001: Null pointer assignment @(#)setenv.c:1.2usage: setenv [envsize]setenv: Envsize must be <= 65520setenv: Envsize must be >= %dsetenv: unrecognizable COMMAND.COM\setenv: unrecognizable COMMAND.COM%s: Environment allocation = %ld setenv: Maximum for Version 3.1 = %d J!>u J!>u,J!>su  <>:setenv: @(#)semsbnr.c:1.2Microsoft (R) Environment Expansion Utility Version 2.00 Copyright (C) Microsoft Corp 1985. All rights reserved. J 6Error 0No such file or directoryArg list too longExec format errorBad file numberNot enough corePermission deniedFile existsCross-device linkInvalid argumentToo many open filesNo space left on deviceMath argumentResult too largeResource deadlock would occur: Unknown error (:;<=NOcdef~% ;C_FILE_INFO  (null)+- #  y  (C) Copyright Microsoft Corporation, 1986 Microsoft(R) C Compiler Version 4.0 Release Notes This document contains information related to Version 4.0 of the Microsoft C Compiler and libraries for MS-DOS(R). The information contained in this document is more up to date than the printed manuals. As a result, where information in the manuals conflicts with information in this document, this document should be assumed to contain the correct information. General Notes NOTE TO WINDOWS DEVELOPERS This version of the Microsoft C Compiler includes updated libraries. These supersede the libraries that are included with the Microsoft Windows Software Development Kit Version 1.01. The Windows-specific libraries can be found on the start-up source code disk in a subdirectory named WINLIB. These libraries should be used to replace the corresponding files in your Windows Development Toolkit. The README.DOC file in the WINLIB subdirectory on the Startup Source Code disk provides more information on the use of these libraries. FLOATING-POINT OPERATIONS UNDER DOS 3.2 If you are running IBM(R) PC-DOS 3.20 and trapping floating-point exceptions in your program, you may find it necessary to patch PC-DOS 3.20 to get proper operation when floating-point exceptions occur. Please refer to the file named PATCH.DOC in the PATCH subdirectory on the Utilities disk for instructions on making this patch. New and Changed Features The following lists describe important new and changed features in the Microsoft C Compiler. In some cases, the changes fix errors in the previous compiler and may change the behavior of programs that relied on the erroneous behavior of the previous compiler. PACKAGE CONTENTS A large-model version of C3.EXE named C3L.EXE has been included for users whose programs have functions that cannot be optimized by the normal (small-model) C3.EXE because they are too big to fit in 64K of memory. If you rename C3L.EXE to C3.EXE and install it with the other compiler passes, you should be able to optimize much larger functions (depending on your available memory). The sources for the C start-up are included in the release, along with a MAKE file and a readme file. PLEASE NOTE: These sources are included as a convenience for users who wish to modify them for some special purpose. However, Microsoft Technical Support WILL NOT be able to provide support for questions about modifying these routines, nor do we make any claims of future compatibility with this code. New versions of the MOUSE.COM and MOUSE.SYS files are included in the release for users who use a mouse with the CodeView debugger. These new versions allow the CodeView debugger to save the previous state of the mouse cursor whenever the user changes screens. Be sure that you substitute the versions of MOUSE.SYS or MOUSE.COM provided in the re9lease for any earlier versions of these files. MSC AND CL DRIVER CHANGES "Source listing" Prompt The "Source listing" prompt and its corresponding place in the MSC command line are new for Microsoft C Version 4.0. If you are upgrading from Version 3.0, MSC command lines in batch files or MAKE description files may need to be revised to work correctly with Version 4.0. Specifically, if a Version 3.0 command line specifies an object listing, it will produce a source listing instead with Version 4.0. /Ze and /Za Options The /Ze option (enable extended keywords) is now the default, while the /Za option has been added to explicitly disable extended keywords. If the /Za option is used, a new default define is emitted (NO_EXT_KEYS) to indicate that extended keywords are disabled. Do not use the /Za option in conjunction with the /Gc option. If you do so, a new start-up will be required, and you will not be able to reference C library functions in your program. /Gc Option If you compile with the /Gc option, either you must declare the main function with the cdecl keyword in your program, or you must change the start-up so that it uses the correct naming and function-calling conventions when calling main(). /Zi Option The /Zi option causes the compiler to emit symbolic-debugging information for use with the CodeView(TM) debugger. Note that this information causes a substantial increase in the size of the corresponding object- and executable- file sizes. Optimizations involving code motion or code removal can cause the CodeView debugger to think that some local symbols are no longer in scope when, in fact, they are. As a result, the CodeView debugger treats references to these symbols as unknown-symbol references. To avoid this problem, compile your program with the /Zi option, and do not specify any optimization (/O) options. Since optimization is enabled by default, this combination of options disables only code-motion and code-removal optimizations. If you explicitly specify any optimization options, all optimizations that are enabled or disabled by those options are performed. /D Option The MSC and CL drivers can now handle more /D options (the maximum is still 20, but the practical limit used to be much less) and have more directories specified in the INCLUDE environment variable on the command line without running into command-line-length limits. Note that this does not have any effect on the length of the command line you type when invoking MSC or CL. The command line is still bound by the DOS limit of 127 characters. NEW AND CHANGED ERROR MESSAGES Bad "FILE=" Parameter in CONFIG.SYS You should set the "FILES=" parameter in your CONFIG.SYS file to a value greater than or equal to 20. If you specify a value less than 20, you may run out of file handles during compilation. In some cases, if the compiler tries to open an include file and is out of file handles, it displays a "Cannot find file" error message instead of a "No more file handles" error message. New Error Messages We have modified the parser to try and correct the "cascade errors" (long lists of pseudo-errors caused by a single error such as a missing right parenthesis (")") or semicolon (";") generated by the previous version of the compiler. This is done using a "token insertion" technique, which tries to insert a valid token at the point at which the error is detected, in order to recover and continue in a reasonable manner. Whenever this occurs, the compiler emits one of the following error messages: 143: syntax error: missing before 144: syntax error: missing before type 145: syntax error: missing before identifier 146: syntax error: missing before identifier In all cases, the parser inserts the and continues parsing. This is still an error, even if the parser inserts the correct token. The program will not attempt to generate code after such an error is detected. The user must fix the error and recompile. Another new error message, 147, has been added: 147 : array : unknown size This error is similar to error 133, but it handles the case where the array name is not known, as in the following example: extern char (*p)[]; p++; Since in this example p is a pointer to an unnamed array of unknown size, p++ cannot be calculated. Internal and Unknown Error Messages Fatal, error, and warning messages that should not occur (such as internal compiler errors and "UNKNOWN ERROR" warning or fatal errors) have been changed to indicate that the user should contact Microsoft Technical Support. In the case of internal compiler errors, the compiler displays the following line: (compiler file '', line ) The and values indicate the name of the compiler module in which the internal error was detected and the line number in that module where the error was d9etected. This information MUST be included in any report to Microsoft Technical Support. Note that the line number at which the error is detected in the user's file is given in the usual place, in parentheses following the source file name. New Warning Messages The following new warning messages have been added: warning 73 : Scoping too deep, deepest scoping merged when debugging warning 74 : non-standard extension used - '' warning 75 : type of switch expression cannot be long - converted to int Warning 73 is issued when /Zi is used and the static nesting level is greater than 13. Any items declared at levels below this will act as if they are in the same scope in the program. Thus, if a variable name is redeclared in a deep level, you will not be able to access all instances of that variable in the debugger. In Microsoft C Version 3.0, several constructs were allowed where the construct was syntactically illegal but not caught, or where the construct was intended to be compatible with a part of the then-current draft of the ANSI C standard. Some of these constructs have been kept in the language but are allowed ONLY if the Microsoft-specific extensions are enabled (/Ze). In these cases, if warning level 3 is specified, warning 74 is emitted to indicate that a nonstandard extension is being used. Note that this warning is not displayed for ALL Microsoft-specific extensions (specifically, usage of the extended keywords), but only for items whose behavior is different from that in Version 3.0 when extensions are not enabled. We strongly advise you to rewrite code that uses any of these extensions, since some of them may be removed in future versions of Microsoft C. This will enhance the portability of your programs now and in the future. The following six cases produce this warning: 1. Use of a cast to produce an lvalue, as in the following example: int *p; ((long *)p)++; This construct was allowed in Version 3.0 because of a compiler bug that has since been detected. However, in many cases this is a reasonable (and useful) construct, so Microsoft C allows it if the /Ze option is used and gives an error otherwise. Note that your code will be more portable if the construct in the example is rewritten as shown below: p = (int *)p + sizeof(long); In Microsoft C, the code generated for both examples is identical. Note that certain casts that were previously allowed are no longer allowed, even with -Ze. Specifically, casts that would increase the size of an object are disallowed, as in the following examples: int i; (long)i = 0xffff0000L; char near *p; &((char far *)p) However, you can freely cast values to shorter types or cast pointers to be pointers (of the same size) to different types and still maintain the "lvalueness" of the item. 2. Redefinition of an extern item as static, as in the following example: extern int foo(); static int foo() {} This is not allowed by the draft standard, but it is benign in our compiler and has some history behind it in the UNIX(TM) world, so we have maintained support for it under /Ze. 3. Use of a trailing comma (",") in a function declaration to indicate variable-length argument lists, as in the following example: int printf(char *,); The draft standard changed after the release of Microsoft C Version 3.0 to the ellipsis form (,...). Microsoft C Version 4.0 supports the new form but, for compatibility, also allows the old form to be used if the /Ze option is given. 4. Benign typedef redefinition, as in the following examples: typedef int INT; typedef int INT; The current draft of the ANSI C standard does not allow redefinition of a typedef name in the same scope (although it is allowed in inner scopes). Microsoft C Version 4.0 allows redefinition in the same scope if the typedefs are identical. 5. Macro formal parameters in strings and character constants, as in the following example: #define print(x) printf("x") Use of this feature generates a warning at level 1 (not level 3), as this feature will be replaced in the future by an alternative method that is provided the ANSI C standard. 6. Mixed character and string constants in an initializer, as in the following example: char arr[5] = {'a', 'b', "cde"}; This is the only form of mixed-string initialization that is allowed. You cannot use multiple strings or a string followed by character constants. New Fatal Error Message There is one new fatal error message: fatal error 50 : code segment '' too large This message is displayed whenever a code segment gets within 36 bytes of 64K in size during co:mpilation. A 36-byte pad is used because of an bug in some 80286 chips that can cause programs to exhibit strange behavior when, among other conditions, the size of a code segment is within 36 bytes of 64K. The linker outputs a similar message if combining segments causes the size of a code segment to fall into this range. LANGUAGE CHANGES Keywords You should not use "const" or "volatile" as variable names in your programs. These words are reserved for future expansion as keywords. Structure/Union Nesting The maximum legal number of nested structures/unions has been increased from 5 to 10. Converting Short Pointers to Long Ints The conversion of short pointers to long ints has changed to reflect the way that other values are converted to longer types. In Microsoft C Version 3.0, the following code would cause p to be converted to a short int, then to a long int: char *p = NULL; long i; i = (long)p; if (i == 0L) {  . . . } However, all other length-increasing conversions first convert the size, then convert the mode. (For example, converting char to unsigned long first converts the char to signed long, then to unsigned long.) As a result, in Microsoft C Version 3.0, the "if" expression in the example was true in this case. As a result of the change for Version 4.0, the code in the example first converts p to a far pointer (by loading the appropriate segment register value), then changes that to a pointer. Thus, the "if" expression in the example would likely fail, since the segment registers do not usually contain 0. NEW AND CHANGED RUN-TIME LIBRARY FEATURES Model-Independent Code Helpers Mixed-model programming support has been enhanced by adding model- independent code helpers. That is, calls to long arithmetic helpers such as __lmul and __ldiv now use model-specific names so that you can mix objects compiled in different models without running into problems when, for example, one object expects __lmul to be a near function and one expects it to be far. Note that this DOES NOT apply to the regular library routines -- they are always model specific, and you must be wary of how they are used in mixed-model programs. Start-Up Code The start-up has been changed so that it does not use the stack to store the environment array. This change will prevent stack-overflow errors on start-up when very large environments are being used. Changes to Library Functions printf and scanf The printf and scanf families of functions have been extended with new formats. These new formats include formats from the draft ANSI C standard and Microsoft- specific formats that allow you to specify pointer/address sizes for formats that correspond to pointer/address arguments. For example, in a small-model program, you can pass a far pointer to a string into printf to print the string as shown in the following example: foo(s) char far *s; { printf("%Fs\n", s); } One consequence of this is that, in the scanf family of functions, the %F and %E formats are no longer supported. Since these formats were equivalent to the %f and %e formats, respectively, you can replace them directly without changing program input or functioning. rename The arguments to the rename function have been reversed, so that the function interface is now defined as shown below: int rename(oldname, newname); This change was adopted in order to conform to the definition in the current ANSI draft C standard. The Microsoft version of the rename function was originally defined before the rename function was included in the library section of the draft. You must change any uses of rename in your code and recompile them before you link with the newest libraries. signal The signal function can now trap floating-point exceptions. There are several new support routines that can be used by the signal-handling function to clean up the 8087 or emulator so the program can then be continued (see _fpreset, _clear87, _status87, and _control87 in the library reference manual). spawn The spawnxx functions have been changed to avoid loading the execxx functions also unless the P_OVERLAY flag is actually referenced in the source code. This change should reduce code size by 2K to 3K for most users of the spawnxx functions. If you have code that uses the P_OVERLAY feature, you must recompile this code before linking it with the newest libraries. Changes to Documentation The following section describes features that were added or changed after the documentation was printed. USER'S GUIDE Assembly-Listing Files (p. 68) Assembly-listing files (generated by the /Fa option) cannot be assembled directly when the C sources include C-common (uninitialized global) variables. These are denoted in the .ASM listing by a comment line starting ";.comm ..." Current: versions of MASM do not support this concept, and so they are converted to extern references in the .ASM file. Simply initializing these options to 0 in the C source code and recompiling with /Fa will fix this problem. Removing In-Line 8087 Instructions (p. 80) The Microsoft C Compiler does not have "true" in-line 8087 in the sense that the code generates software interrupts to library code, which then fixes up the interrupt to either use the emulator or the 8087. This can be removed by simply assembling the following program and linking it with the C program: public FIARQQ, FICRQQ, FIDRQQ, FIERQQ, FISRQQ, FIWRQQ public FJARQQ, FJCRQQ, FJSRQQ FIARQQ EQU 0 FICRQQ EQU 0 FIDRQQ EQU 0 FIERQQ EQU 0 FISRQQ EQU 0 FIWRQQ EQU 0 FJARQQ EQU 0 FJCRQQ EQU 0 FJSRQQ EQU 0 END Assembling and linking this program with your C program will save execution time (the time required to patch all the interrupts the first time). However, the program will run only if an 8087/287 is present. Using NULL in Medium and Compact Memory Models (p. 175) Note that in medium and compact models, NULL must be used carefully in certain situations. NULL actually represents a NULL data pointer. In memory models where code and data pointers are the same size, it can be used with either. However, in memory models where code and data pointers are different sizes, this is not the case. The example func1(dp) char *dp; { ... } func2(fp) char (*fp)(); { ... } main() { func1(NULL); func2(NULL); } passes a 16-bit pointer to both func1 and func2 if compiled in medium model, and a 32-bit pointer to both func1 and func2 if compiled in compact model, UNLESS function declarations are added to the beginning of the program to indicate the types, or an explicit cast is used on the argument to func1 (compact model) or func2 (medium model). Customized Memory Models with Near and Far Functions (p. 185) If you use a customized memory model when compiling a program that uses both far and near functions, you should be aware of the following issues: o The chkstk function should be called ONLY in functions that are compiled in the same model as the libraries being used. For compatibility with XENIX(R), the chkstk function name cannot be model encoded. o The float-calls interfaces (generated when the /FPc, /FPa, and /FPc87 options are used in compiling) are not model encoded, so the same restriction is placed on functions containing floating-point calls: they must be compiled in the same model as the libraries being used. XENIX/DOS Portability for Version 4.0 (p. 347) If you move code between XENIX and DOS, Microsoft C Version 4.0 raises several issues. Because the names of code helpers (for example, __almul) have been changed, users who port objects compiled under Version 4.0 will also have to move copies of the relevant helper functions from LIBH.LIB to XENIX, since the current XENIX C compiler and cross-development libraries are from a different version. Beware of porting object files that reference the setjmp or longjmp functions from XENIX to DOS, unless you compiled the object file with the -dos option. The DOS versions of these functions use a larger buffer size and may cause memory to be overwritten. You can port such object files from DOS to XENIX without problems, and you can successfully port the corresponding source files in either direction. Compiler Limits (p. 409) Section H.3.5, "Compiler Limits," states that there is a limit of eight actual arguments to a macro. This is not true. There is no fixed limit on the number of actual arguments to a macro. However, there are practical limits due to limitations on macro definition size and expansion. RUN-TIME LIBRARY REFERENCE MANUAL SHARE.COM Program The Library Reference sometimes refers to the DOS program SHARE.COM. This may be SHARE.EXE in some versions of DOS. _amblksiz (p. 31) The description of this variable should note that adjusting this value affects only far-heap allocation (for example, standard malloc calls in compact, large, and huge models, and _fmalloc calls in small and medium models). However, adjusting this value has NO effect on halloc or _nmalloc in any model. chdir (p. 120) For the chdir function, the current working directory is always relative to the current default drive. Thus, if the current working directory is A:\BIN, the following call does NOT change the current working directory, since DOS does not change the current default drive when chdir is called: chdir ("c:\temp"); To change the current default drive to drive C, call the system function as shown below: system("c:"); chsize (p. 123) A bug in DOS may cause CHKDSK to report an allocation error after a file is truncated. The; following sequence of steps causes CHKDSK to report this error: 1. The file has x + 1 clusters allocated. 2. It is truncated to x clusters. 3. A seek is performed to somewhere in cluster x + 1, followed by a write. After the file is closed, CHKDSK reports the allocation error. The only way to avoid this problem from C is to read or write at least 1 byte before performing a seek. If the file has read/write access, simply reading a single character after the truncation is sufficient. If the file has write- only access, a 1-byte write can be performed, although this makes the file 1 byte larger. Note that this error occurs only if the seek past the end-of-file is the first operation performed on the file after truncation. fcvt (p. 163), gcvt (p. 221), ltoa (p. 272), memcpy (p. 280), and strlwr (p. 380) These functions return pointers, so the declarations of these functions under the "Summary" headings should read char *fcvt(value, ndec, decptr, signptr);  char *gcvt(value, ndec, buffer); char *ltoa(value, string, radix); char *memcpy(dest, src, cnt); char *strlwr(string); respectively. fmod (p. 186) The return value from this function (the floating-point remainder) is not compatible with the draft ANSI C standard. However, it is consistent with the current UNIX System V definition, and it will be changed when the Microsoft C Compiler fully conforms with the ANSI draft C standard or when the System V definition is changed. halloc (p. 236) The halloc function also returns NULL if the allocation request cannot be satisfied for reasons other than lack of available memory, such as an illegally specified huge array (for example, trying to allocate a 50000-element array of 6-byte items). int86x (p. 243) and intdosx (p. 248) In the descriptions of the int86x and intdosx functions, change the line After the interrupt returns, the function copies the current register values to outregs and restores DS. so that it reads After the interrupt returns, the function copies the current register values to outregs, copies the current ES and DS values to segregs, and restores DS. lfind and lsearch (p. 259) In the descriptions of these functions, change the "Return Values" section to read as follows: If the key is found, both lsearch and lfind return a pointer to that element of the array pointed to by base. Otherwise, lsearch returns a pointer to a newly added item at the end of the array, and lfind returns NULL. malloc (p. 273) The malloc(0) fragment does NOT return NULL, but instead allocates a zero- length item (that is, a header only) in the heap. The resulting pointer may be passed to the realloc function to adjust the size at any time. memicmp (p. 281), stricmp (p. 373), and strnicmp (p. 381) These functions all convert alphabetic characters to lowercase before performing comparisons. Thus, the following fragment returns a value greater than 0: stricmp("A", "_") movedata (p. 288) In the "Summary," the srcseg, scrcoff, destseg, and destoff arguments should all be declared as unsigned int, not int. _nmsize (p. 295) The ptr argument should be declared as "char near *ptr", not "char near ptr". open (p. 298) Because of a bug in DOS Versions 2.0 and 2.1, attempts to open a device (such as CON) sometimes succeed and sometimes fail. This inconsistent behavior also occurs if the stdio-level file-open functions (such as fopen) are used. The bug is fixed in DOS Version 3.0 and subsequent versions. When opening a file with open, one of the access modes (O_RDONLY, O_WRONLY, or O_RDWR) MUST be specified. It does NOT default. When a file is opened in text mode, ^Z is interpreted as an end-of-file file character on input. Also, when files are opened for writing (or reading/writing) in text mode, the run time checks for a ^Z at the end of the file and removes it if possible. Using the fseek and ftell functions in combination to move around a ^Z-terminated text file can cause improper behavior in fseek near the end of the file. perror (p. 303) and strerror (p. 377) In the "Summary" for both of these functions, the sys_errlist argument should be declared as follows: char *sys_errlist[sys_nerr]; pow (p. 305) Under "Return Value," change the sentence If x is 0 and y is negative, pow sets errno to ERANGE... so that it reads If x is 0 and y is negative, pow sets errno to EDOM... This change reflects the current ANSI draft C standard. Also change the sentence If x is negative and y is is not an integer, the function prints... so that it reads If both x and y are 0, or if x is negative and y is is not an integer, the function prints... The pow function does not recognize integral, floating-point values greater than 2 to the 64th power. (For example, 1.0E100 is NOT recognized as an integral va;lue.) The return value has been changed to be compatible with the ANSI draft C standard. printf (p. 306) If printf is called with a floating-point format specifier and the corresponding argument is infinite, indefinite, or not-a-number, the output from printf will look as follows: Value Output ----- ------ +infinity 1.#INF -infinity -1.#INF indefinite .#IND not-a-number .#NAN The Microsoft C version of the printf function is incompatible with the draft ANSI C standard, since it does not allow negative field-width and precision specifiers. putenv (p. 316) Note that the environment manipulated by putenv is local to the process currently running. You cannot enter new items in your command-level environment using putenv. When the program terminates, the environment reverts to the environment of the parent process (the DOS level, in most cases). However, this environment is passed on to any child processes that are spawned (exec'ed), and they set any new items added by putenv. rename (p. 329) The capability to rename directories is available only when running DOS 3.x. scanf (p. 336) The input for a %x format specifier is always interpreted as a hex number; the leading 0x (0X) is not needed as it is in the language. Thus, if the input is 0xffff, the result returned from scanf is 0, since x is not a valid hex character. The correct input would be ffff. If the data file contains leading 0x (0X) characters, the correct format specifier is "...0x%x". signal (p. 350) Change the function declaration under the "Summary" heading so that it reads as follows: int (*signal(sig,func))(); sopen (p. 354) Contrary to the list under "Return Values," this function does NOT return EINVAL if SHARE is not installed. It does not detect whether SHARE is installed. If SHARE is not installed, DOS simply ignores the sharing mode. spawnl - spawnvpe (p. 358) Contrary to the "Note" under the "Return Value" heading, the spawn functions DO pass on to the child process all information on open files, including the translation mode, through the environment passed to the child. A special entry called ";C_FILE_INFO" is passed to the child. It is normally processed and deleted from the environment by the C start-up code. However, if spawnxx is used to spawn a non-C process (such as COMMAND.COM) this entry will still be in the environment. Also, since the information is passed in binary form, printing the environment will show graphics characters in the definition string for this entry. It should not have any other effect on normal operations. strcspn (p. 373) and strspn (p. 388) These functions return unsigned integer values, not integer values, so the declarations of these functions under the "Summary" headings should read  unsigned int strcspn(string1, string2); unsigned int strspn(string1, string2); respectively. strerror (p. 378) In the example for this function, change the lines strerror ("open failed on input file"); strerror ("open failed on output file"); so that they read printf("%s\n",strerror ("open failed on input file")); printf("%s\n",strerror ("open failed on output file")); respectively. strstr (p. 389) The "Description" and "Return Value" sections should read as follows: Description The strstr function returns a pointer to the first occurrence of string2 in string1. Return Value The strstr function returns a pointer to the first occurrence of string2 in string1, and NULL if it does not find string2 in string1. tmpnam - tempnam (p. 401) In the description of these functions, line 2 of the first paragraph of the "Description" section should read as follows: If string is NULL, then tmpnam leaves the result in an internal static buffer. Thus, any subsequent calls will destroy this value. In the "Condition/Directory" list, if P_tmpdir does not exist, tempnam uses the current working directory as a last-resort place to create the temporary file. A note should be added that tempnam uses malloc to allocate space for the created file name, and the user is responsible for freeing this space when it is no longer needed. tzset (p. 407) In declaration of this function under "Summary," change the line char *tzname[2]l so that it reads char *tzname[2]; va_arg - va_start (p. 419) Under the "Summary" heading, add the following #include directive to the header: #include CODEVIEW REFERENCE MANUAL Using the CodeView Debugger with the IBM PC Convertible To use the CodeView debugger with the IBM PC Convertible, you must start the CodeView debugger with the /D, /W, and /M options. (The /D option is desc<ribed under "New Options" below.) Using the CodeView Debugger with Assembly-Language Programs When writing stand-alone assembler programs that will be debugged with the CodeView debugger, the class type for the code segment must be 'CODE'. For example, declare segments as follows: sseg SEGMENT para stack 'STACK' sseg ENDS dseg SEGMENT word public 'DATA' dseg ENDS cseg SEGMENT byte public 'CODE' cseg ENDS The CodeView debugger is more limited when debugging assembler programs than when debugging C programs. The following limitations apply: o The assembler does not write line numbers to the object file. Therefore, assembled programs cannot be debugged in source mode. The source file can be loaded and viewed in source mode, but you must switch to assembly mode to debug. o The assembler does not write information on the type size of each variable to the object file. Therefore, you cannot use variables in CodeView expressions (you can still use constants). This means that the Display Expression command, the Watchpoint command, and the expression versions of the Watch and Tracepoint commands do not work for assembled programs. Instead, use the Dump command and the memory versions of the Watch and Tracepoint commands. For example, assume your program has the following declaration: var_a DW 30d You can use the following commands with this variable: DI var_a L 1 ;* Dump var_a as an integer WI var_a L 1 ;* Watch var_a as an integer TPI var_a ;* Break when var_a changes (length 1 is default) o Symbol names are normally converted to uppercase when assembled. If symbols in your source file are lowercase, you may want to turn off Case Sense from the Options menu. o Procedures will be shown on the Calls menu or with the Stack Trace command only if they use the Microsoft calling conventions (see Chapter 10 of the Microsoft C Compiler User's Guide). Similarly, local variables can only be accessed if they are stored in the same way as in Microsoft high-level languages. o To view global symbols, you must specify the module. For example, use "X?.*" rather than "X?*". New Options The following new CodeView options have been added: Option Purpose ------ ------- /2 Allows two video adapters. You must have two video adapters and two monitors. The program display appears on the current default adapter and monitor, while the debugging display appears on the other adapter and monitor. For example, if you have both a Color Graphics Adapter and a Monochrome Adapter, you might want to set the CGA up as the default adapter. You could then debug a graphics program with the graphics display appearing on the graphics monitor and the debugging display appearing on the monochrome adapter. Microsoft Mouse support will be disabled on the debugging display if you use this option. /D Turns off certain IBM-specific functions, including NMI trapping and 8259 masking. This option is required for IBM-compatible machines that do not support these functions, such as the IBM PC Convertible, the Tandy 1000, and the AT&T 6300 Plus. CONTROL-C and CONTROL- BREAK do not work if this option is used. Sequential mode is set automatically; use /W with /D to enable window mode. /I Forces the debugger to handle certain IBM-specific functions, including NMI trapping and 8259 masking. This option can be used to enable CONTROL-C and CONTROL-BREAK handling on computers that the debugger does not recognize as being IBM compatible, such as the Eagle PC. Window mode is set automatically; you do not have to specify /W. Compatibility With Other Programs Sidekick There is a problem with Sidekick that may cause improper operation while running in the CodeView debugger. Sidekick improperly restores the video parameters on return; using the Redraw command (@) after returning from Sidekick may correct the problem. Superkey The CodeView debugger traps the keyboard interrupt so that the CONTROL-C, CONTROL-BREAK, and SYS REQ keys will function as interactive breakpoints. As a result, S<uperkey does not work in the CodeView debugger. The same problem may occur with other keyboard- enhancer programs. Control Keys Control-S will not work on non-IBM machines, since the CodeView debugger does not perform its output through DOS. Display The CodeView debugger does not recognize symbols for C labels, and it does not work correctly for include files that contain executable code. Breakpoint on No-Code Lines The manual indicates that the CodeView debugger will attempt to set a breakpoint on the next-closest line if the specified line has no executable code associated with it. The CodeView debugger will actually display an error message. Case-Sensitivity Option The Case Sense item from the Options menu only applies to symbol-table lookup. It does not apply to regular expression searches using the Search menu. Assembly and Unassembly Occasionally when code is displayed in assembly mode or with the Unassemble command, code similar to the following will be shown: FE30 ??? Byte Ptr [DI] These are instructions that Intel(R) recommends against using, since there are equivalent opcodes and the instruction may not work properly on all machines. You should not see this type of code under normal circumstances, unless you are disassembling data. The CodeView debugger cannot assemble 8087/80287 instructions. Stack Trace To make it easier to debug assembly-language programs, the stack-trace function (and Calls menu) try to display the stack frame in assembly-language routines. As a result, the last function in the stack trace is __astart rather than _main, as described in the manual. Reporting Compiler Problems When reporting problems with the compiler we ask that you please provide the following information to help us in tracking down the problem: o The compiler version number (from the logo that is printed out when you invoke the compiler using the MSC or CL command) o The version of DOS you are running (use the DOS VER command) o Your system configuration (which machine, total memory, total free memory at compiler execution time) o The command line used in the compilation o A preprocessed listing of the program (produced using the /E, /P, or /EP option), or if the problem appears to be in the preprocessor, the C source(s) and ALL include files referenced o All objects/libraries (except standard ones, but please state which standard objects/libraries you are using) needed to link, if necessary Having that information will be of immense help to us in solving your problem quickly. FILES=20 DEVICE=CIO.SYS DEVICE=DEVDMDSK.BIN 8 DEVICE=DEVMM.SYS 000 EXE [! z[MOUSE SYS `! X#SETENV EXE a!)4#README DOC e!2CONFIG BAK!dir /w EXE V!-LIB EXE Y!rMAKE EXE [! z[MOUSE SYS `! X#SETENV EXE a!)4#README DOC e!2CONFIG BAK ![GAUTOEXECBAT!=main() { } V!-LIB EXE Y!rMAKE EXE [! z[MOUSE SYS `! X#SETENV EXE a!)4#README DOC e!2CONFIG BAK ![GAUTOEXECBAT !\A C !=>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOO