IMD 1.17: 3/11/2014 10:47:15 CP/M 68k for VME10 Version 1.2 Disk 2 Serial number 1041-0000-000095 1984  CP/M 9/30CP/M-68K of 9/30/82 0020-?<NDTJfJL N^NuNVH>.0`".%aN0.%a`.&a`J@gڰ|g|g.&-aN0JLN^NuNVH*n.,Bg?<NDX.Bg?<NDX|m>ajB- .Bg?<NDXJ@g>aJ&|, S`fJkf>a0(k.+ޫ>d/ /<,NPdd`8.Bg?<NDX.Bg?<NDXJ@g>aJn +JL8N^NuNVBW?<NDTJ@gBWa.%a-@.&5aV.&\aL nNN^Nu$/` 4/`"/`2/0/HNLxNu/H/Nu/ o / 0H@0 _NuNVpH@B@H@-n-n -y,.NN^NuNV.,0n/aXN^NuNVH *n (y,BG`RB@0|f<N>aJ@gp`B?B@0|HH@B@H@й,// nN J@g B@0|` RGlc0<JL0N^NuNVH. H||op`FB.GB..N#,fp` y,# , y,#,B@JL N^NuNVH *n(n >.`0SGJ@fJL0N^NuNVH *n(n ~  ?HH@|gJgB@`LSGJGfJ.g> ?g HH@"y,)HFAAgB@`TTHH@|?gB@`pJL0N^NuNVH*n>/. / abPg- > / /. a PG HJL N^NuNVH *n(y,,H- H,H@pFg0- H|4aAJL0N^NuNVH*n>. Jng0G>NL` ` 5pH|JL N^NuNVH*y,B0.-HH-H. HBHЁ-@.,/.NpXJL N^NuNVH*n-<?- R< mBR<@mp``H-H|?Af*H- H@"y,)HFAA|fF B@`$GF ./<\NX|ep`B@JL N^NuNVH *n~I J$fSGJGf y, hcOp"y,)HAoB@0"y,)HFA- HB|AJL0N^NuNVH*n.a>- H@f-H|``- H@c0<``B@JL N^NuNVH*n y,8(| - f.aJ@gp`LB- .a- H|Abp`2.a<>?/ a\>JGfp`- H>?aTR- JL N^NuNVH>.<. *n 0`XB@0|>?<N4T`V>N>`NBB- B-./<\NX`2B.N`&#,`p``H |&rW hNB@JL N^NuNVH*nH`-H>-H??< N(X+@`~(m&l.Y?/-NX\>B@0+W?< N4T.?.?<N"X>?< N4T. ?< N.T> N8`` J@gh|gB@JL8N^NuNV//?N$fN^Nu@H@Y|oYFNu// K MNO*_,_Nu o0<"|QNu o0<"|QNu o/9#(p#Nup:#NuNV`N^NuNVH?>.&. <.:.8.0`&0G,x `,0G,x ``S@| b@0@' PNо|l|g| fJfz| |'0pH@H"t䡀 02G=2AJLN^NuNVH>.<. :. 8.Bn |'0pH@0@2AA0.0G,x JLN^NuNV9H|f==9=H@|Hм' @=9H3=09=@9HA3==9=H|=9=H@======N^NuNVH>.<. 0м'v @*h|m02H4G'>`NzP'Ff:<0H@l02H4G'>@H`0F@S@2H4G'>JL N^NuNVH>.*. <.*n>?<4?/?a, ``9H|g.N9H|fa< 9=g9=H``9=H@9=HAH-@ м-@9=H"n9=H"nRJ9=g6>?<49=H? 2HЁ9=HH/?aV `B@``&JL N^NuNVH>.<. *n :.>?a2T-@0 @"|'v p=P0.H2G'>=@-M=| 0`.?./.?avP=@`>?<4?./.?a `&9H|gJng.NSn9H|fa9=H=@`@>?<4?./.?aJ a9=H=@``|gP| gb`*nJngSnf.JngB@``pJL N^NuNVH. H3=H*@'v. fH`H0@=JPf(H0@,x  H0@=0/<H0@"|,x/0N%0P,Jf|> ?<4?</H?a> a~9=H`*+|'F`,+|'VH0@=BP``` J@gҰ|g``$`"B` `J@g*|g"|g|g` JL N^NuNVBy=>?<4BgB?9=a 9H|fN^NuNVHJy'fB9BG`"0G=00G,x RG|m>(?<O?<Bga\9H|f>?<1?<?<a\9H|f3'JLN^NuNVH J9,g09=y=g$>/<-?9=?9=a|PJ@fp`8,3==09=@H*@-(y-><SGJGfB@JL0N^NuNVH>.*n g 5pH``0R@JL N^NuNVH0.@H*@(. n/g nNg* JL N^NuNVaN^NuNVHB9,a`JLN^NuNVH>.,. *.0`a` H>N`a`0y'"|'0HH, H> H?aT`^3=`V S@3=`J#-`BapH`:. ?aTH`*. ?aT`B```|b@0@( PNJLN^NuNVH?BCB..,. f#,t <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#,t D`#,t JLN^NuCPM SYS Boot error. Open or Read error on Bad file format on CPM.SYS CP/M-68K(tm) Version 1.2 03/20/84 Copyright (c) 1984 Digital Research, Inc. &'\t~CP/M-68K(tm), Version 1.1, Copyright (c) 1983, Digital ResearchXXXX-0000-654321Copyright 1984, Motorola Inc.BIOS 2.15 9    -$'F-$'F-$'frbbbb$% % % $% % % $$$$$$% % $% % % % % $* Saves: CPM small 1950, big 1950 *************/ #define MAXFILES5 int maxfiles5(); /************* * NOFILESZ: eliminates the functions to calculate the size of a file. * Watch out when you append 'fopen(name,"a")' or use 'lseek(fd,xx,2)'. * Saves: CPM small 550, big 800 *************/ #define NOFILESZ int nofilesz(); /************* * NOBINARY: eliminates BINARY low level Disk I/O subroutines. * Watch out when you do binary file i/o: openb(), creatb(), * fopenb(), freopb(). * Saves: CPM small 2200, big 2900 *************/ #define NOBINARY int nobinary(); /************* * NOASCII: eliminates ASCII low level Disk I/O subroutines. * Watch out when you redirect output to a file, or do any ascii file i/o: * open(), opena(), creat(), creatb(), fopen(), fopena(), freopen(). * Saves: CPM small 1100, big 1500 *************/ #define NOASCII int noascii(); /************* * MINIMAL: tags to make "hello.c" as small as possible. *************/ #define MINIMAL NOFLOAT NOTTYIN NOFILESZ MAXFILES5 NOWILDCARDS \ NOASCII NOBINARY /************* * NOSTARTUP: links out all of the CLEAR initialization routines, including * command line redirection (">", "<", and ">>" command line ops) and * wildcard expansion. Also leaves out opening STDIN, STDOUT, and STDERR. * Warning: this could have peculiar side effects, and should be used only * by experienced programmers. **************/ #define NOSTARTUP int nostartup(); programmers. **************/ #define NOSTARTUP int nostartup(); /****************************************************************************/ /* */ /* CTYPE */ /* ----- */ /* */ /* CTYPE.H - macros to classify ASCII-coded integers by table lookup. */ /* */ /* */ /* Note: Integer args are undefined for all int values > 127, */ /* except for macro 'isascii()'. */ /* Assumes: */ /* User will link with standard library functions. */ /* Compiler can handle declarator initializers and */ /* '#defines' with parameters. */ /* */ /****************************************************************************/ /* * Bit patterns for character class DEFINEs */ #define __c 01 #define __p 02 #define __d 04 #define __u 010 #define __l 020 #define __s 040 #define __cs 041 #define __ps 042 #ifndef CTYPE extern char ___atab(); extern char __atab[]; #endif /* * Character Class Testing and Conversion DEFINEs: */ #define isascii(ch) ((ch) < 0200) #define isalpha(ch) (__atab[ch] & (__u | __l)) #define isupper(ch) (__atab[ch] & __u) #define islower(ch) (__atab[ch] & __l) #define isdigit(ch) (__atab[ch] & __d) #define isalnum(ch) (__atab[ch] & (__u | __l | __d)) #define isspace(ch) (__atab[ch] & __s) #define ispunct(ch) (__atab[ch] & __p) #define isprint(ch) (__atab[ch] & (__u | __l | __d | __p)) #define iscntrl(ch) (__atab[ch] & __c) #define tolower(ch) (isupper(ch) ? (ch)+('a'-'A') : (ch)) #define toupper(ch) (islower(ch) ? (ch)+('A'-'a') : (ch)) #define toascii(ch) ((ch) & 0177) ower(ch) ? (ch)+('A'-'a') : (ch)) #define toascii(ch) ((ch) & 0177) RELOC2 SUBCP68 REL CP68 REL CP68 RELCP68 RELC168 REL !"#C168 REL$%&'()*+C168 REL,-./0123C168 REL456789:;C168 REL<=>?@ABCC168 RELDEFGHIJKC168 RELLC068 RELMNOPQRSTC068 RELUVWXYZ[\C068 REL]^_`abcdC068 RELefghijklC068 RELmnopqrstC068 RELuvwxyz{|C068 RELL}~CLINK SUBCLINKF SUBC SUBCLINKE SUBCE SUBSETJMP H ERRNO H PORTAB H STDIO H LIBF A LIBF A !LIBE A LIBE A HCLIB CLIB CLIB CLIB CLIB CLIB cS O LO68 RELLO68 RELLO68 RELlNM68 RELNM68 RELxAR68 RELAR68 REL   AR68 REL3  SIZE68 RELSIZE68 RELbINIT REL INIT S  !MORE C "MORE REL#$%&'()*MORE RELb+,-./01ASSERT H 2OSIFERR H 3SIGNAL H 4SGTTY H 5OPTION H -678CTYPE H 9/*************************************************************************** * * O P T I O N H e a d e r F i l e * ----------------------------------- * Copyright 1983 by Digital Research Inc. * * Date: 1/5/84 * * The CLEAR*.L86 libraries provide a large number of functions which * are not needed by every program, but which must be linked into the program * because their usage is data driven. One example is the floating point * conversion routines in the "printf()" function. The programmer can specify * "%f", "%g" or "%e" conversions which the linker can not detect. If the * program never needs or uses these conversions, the code in the "printf()" * routine will never be used. The "option.h" module gives the programmer * a mechanism of communicating to the linker that certain low level functions * are optional (not used by the program), and can be left out to save space * in the program load image (.CMD file). * * "option.h" provides a set of definitions which allow the programmer * to specify certain options of the CLEAR* Run Time libraries (CLEARS.L86 or * CLEARL.L86) which the program does not use. The programmer can * choose broad sets of options (i.e. "MINIMAL"), or can choose specific * options to stub out of the final program (i.e. "NOFLOAT"). * * Each definition contains a "tag declaration". The tag declaration * will link in a module from the OPTION*.L86 (OPTIONS.L86 or OPTIONL.L86) * library which also contains a "stubroutine" for some internal * function of the CLEAR* Run Time Library. * * For example, the definition of NOFLOAT is "int nofloat();". When * the programmer specifies "NOFLOAT" in the source file and then links the * final program with the OPTION* library, the linker links in the module from * the OPTION* library which contains "nofloat()". This module also contains * certain stubroutines which satisfy functional references to the floating * point conversion routines in "printf()". Thus, the code for these * conversions will not be linked into the final program load image. If * the program happens to use the "%f", "%g" or "%e" printf() conversions, * the stubroutines provided will print an error message and exit. * * We recommend that the programmer compile a separate module containing * the tag definitions, and then link this module and the OPTION* library * along with the rest of the program. For example, to reduce the size of * the "hello.c" program load image, the programmer could prepare a file * (named "opt.c" in this example) that looks like: * opt.c: * #include "option.h" * MINIMAL * Then, after compiling hello.c and opt.c, the link command should look like: * LINK86 HELLO,OPT,OPTIONS.L86[SEARCH * Note that the "[SEARCH]" option is very important, since LINK86 will pull * in all routines in OPTIONS.L86 if you do not use this option. * * * Specific options are documented below. * ****************************************************************************/ /************* * NOFLOAT: link out floating point conversion routines in "printf()", * "fprintf()", and "sprintf()". **************/ #define NOFLOAT int nofloat(); /************* * NOLONG: link out long integer conversion routines in "printf()", * "fprintf()", and "sprintf()". * Saves: CPM small 3200, big 3500 **************/ #define NOLONG int nolong(); /************* * NOTTYIN: eliminates the functions to "read()" from the console. * Watch out when you use STDIN on reads. * Saves: CPM small 300, big 350 *************/ #define NOTTYIN int nottyin(); /************* * NOWILDCARDS: eliminates wildcard expansion on command line. * Saves: CPM small 500, big 650 *************/ #define NOWILDCARDS int nowildcards(); /************************************************************************* * DISK I/O Options *************************************************************************/ /************* * MAXFILES5: reduces the maximum number of open files allowed from 16 to 5. * Note: this includes console files. reloc cp68.rel cp68.68k reloc c168.rel c168.68k reloc c068.rel c068.68k reloc lo68.rel lo68.68k reloc nm68.rel nm68.68k reloc ar68.rel ar68.68k reloc size68.rel size68.68k reloc init.rel init.68k reloc more.rel more.68k `W :aBNW`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#c"h#cE?/ N,0N o AdpNu#cBNuNV0/"/ NBcd0< AW"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVH*n &]&|X nl .X/ /<XN-.P>N3`(]RBF`0`09F@Hмc( @ >=/ aX8|g0 2HЁR29FAHҼc("A#@RyF L2DB` 09F@Hмc( @!|RyFRF09FS@@Hмc( @-P`8 nHHмb: @g nH|` nH"nR nJf`#[*Sn`RyàRy"`RyT`0yRe WRyR`0yRe XRyR`0yRe XRyR`z0yRe X RyR`Z0yRe XRyR`<.Y/ /<XN-.P>N3`H |XrW hN-.P>N3#HJy"f nf./<N&^X`az.HNVHйH @ (sgB@`p3>FN a JL8N^NuNV>XN3N^NuNVH>.l 0.D@=@BFKRF0.H H@|00.H =@nJGlRF-` n  R Sn0.@o` n R SFl n BJL N^NuNVH*nBG`H. f0`RGJfpJL N^NuNVH*n`R  g  g  g| +g -f +fp`p<BG` H@|R 0m 9o0JL N^NuNVH (yH`0R@H>// aDX>|f*|f|iJL0N^NuNV n f>/ ?<NE\`.`&. H?N>TN^NuNVH>< n0(@ n1| .P"n#@> n/( n?NE\Ggp`B@JLN^NuNVH*n|BG`H@SFJgJFn0HH@JL N^NuNVH (n ~*n` JgSGfp` HgB@JL0N^NuNVH *n(n ~` Jg`BSGlBJL0N^NuNVJyg>./<d/<Z~N-.P`J <f&Zf>R/9H/<ZN-.P` yZ>/9ZT/<ZN-.P>?.?.?.?.?. /.N-..ZN-.RyXN^NuNV <FNb.Za6N0."yNRNN^NuNVH.NVH*@`%H>abJL N^NuNVH <^NdSN yNH`By` <f& /****************************************************************************/ /* */ /* S i g n a l H e a d e r F i l e */ /* ----------------------------------- */ /* */ /* Copyright 1982 by Digital Research, Inc. All rights reserved. */ /* */ /* Define the "signal" arguments, so anyone using the function will */ /* not get compile-time errors. Some functions are not implemented. */ /* */ /****************************************************************************/ #define NSIG 16 /* 16 simulated signals */ #define SIGHUP 1 /* Hangup */ #define SIGINT 2 /* Interrupt (^C) */ #define SIGQUIT 3 /* Quit signal */ #define SIGILL 4 /* Illegal Instruction trap */ #define SIGTRAP 5 /* Trace Trap */ #define SIGIOT 6 /* IOT instruction (on PDP-11) */ #define SIGEMT 7 /* EMT instruction (TRAP on 68k) */ #define SIGFPE 8 /* Floating point exception  */ #define SIGKILL 9 /* Kill (cannot be intercepted) */ #define SIGBUS 10 /* BUSERR (non-ex memory reference) */ #define SIGSEGV 11 /* Segmentation (MMU) violation */ #define SIGSYS 12 /* Bad argument to system call */ #define SIGPIPE 13 /* Write on a broken pipe */ #define SIGALRM 14 /* Alarm clock (what a name!) */ #define SIGTERM 15 /* Software termination signal */ /************************************/ #define BADSIG (-1L) /* Error return */ #define SIG_DFL (0L) /* Default action on signal call */ #define SIG_IGN (1L) /* Ignore */ /************************************/ ***********************/  /* sgtty.h - tty control information */ /* Note reduced contents for CP/M implementation... */ struct sgttyb{ char sg_ispeed; /* ignored */ char sg_ospeed; /* ignored */ char sg_erase; /* ignored */ char sg_kill; /* ignored */ int sg_flags; }; #define XTABS 0006000 #define RAW 0000040 #define CRMOD 0000020 #define ECHO 0000010 #define LCASE 0000004 #define CBREAK 0000002 EAK 0000002 ZfB@` yZ>N4fZ <f&ZfRyR>R/9HNX`. yZ0("yZRi yZ>/9ZTNX.ZN(4>md0JL0N^NuNVH BG.a\ *@Z`T./ azXJ@g `V f -[2f(M Ze0RGJ@g.ZaN*|Z -[2f g ` JL0N^NuNVH.a\*@Jg -[2fB` JL N^NuNVH *naJH0@"|Y0H<0`H>?<,/.a\J@g0`|` n p`l`(aH0@"|Y0H:| g|!fR .м,eH>aP`">=aJ@g| =` >>aJ@g|>`>=aJ@g|=`>=alJ@g|=`>=aVJ@g=`|`>*a>J@gJyàg>/N>*NBD`< fXRDJyàg,BWN(|`.TH?aTJfN$.T?< aT.T?< aT`F<*f,>/aJ@g Jyàg>*N>/N` `Jyàg H>Na^fTJf .Za. <f&ZfyR` 0"yZi|# n `V>/a$J@gJJyàg>/N>/N`Jyàg H>Nag< f| n `,H>/<ZaX``W@|b@0@Z PNB0JL0N^NuNVH*n>. UG`^JFg| fB*n` H>NJfB@`PSGo`JGf .[ a|\fa,<SGo`JGf .[aa<.H@fBpJL N^NuNVHa>nfp`>ahB@JLN^NuNVJy"f. . H?N&T`.`&. H?N>TN^NuNVH #f&Z3RBW/9Z/9HN'PJ@l.H/<[NXB@`Jy"f4BW/<T/<N&PJ@l./<[NXB@`N>/9HaJX(|Z`)|[2 Nc>NEx#H#$ $f.[NN0<3ex3,By(#^N#4V>/<\ aX>/<\aX`.0.@H @"|c(.0.@H @"|c(/0aXSnl` <f&Zf <^NfRyR`" <f&Zg yZ0("yZRiJy0fBJy*f4*|`.TH?N TJf.T?< N T`By*JygZ <f&Zg. yZ0("yZRi yZ>/9ZTaX`RyR>R/9HaXBy.HaRJ@f <4Vg .\N09(y,o 3(,.TNJy"f >TN4f yZ>N4fpJL0N^NuNVHJyfJyTfJyg./<dN&^X3 ..T?<#N T.T?< N T>/<L?. N\*|L`R  g`.TH?N TRJf.T?< N T*n`.TH?N TRJf.T?< N TJL N^NuNVH.N*@./.N\X+y$> aBWaJL N^NuNVH.N*@./.N\X+y$>aJ g` n H>aR n Jf`>1aBWaJL N^NuNVH*|[4`./N&XJ@f0-`\JfB@JL N^NuNVHa<.N N>JGfB@`̾|f@.a >|fp`.at`.a | f.N Jg >a ` BWa |Ry0`.a x| f .N JgBWa HRy0`>a 8`a j<JFfJSy0Jy0f: <f&Zg yZ>/9ZTaX`>R/9HaX`|g .\0N`(a <JFfSy0>a ` |fRy0BWa ` .\?N`Jy0fab`Jy0f .az>| f .a `Jy0f6.a <f&Zg.ZTa <` .a<0``lJy0fN!dJ@g >a` BWaRy0`@Jy0fa .a``&.\MN``S@|b@0@[p PNap`~|gvJy0gaX`f`Z| f.N *@ g.ax`(./aFXJ@fK` H>a:Jf.N N>|gJGfBWapJL N^NuNVH.\j/.N&XJ@f(>"a*n ` H>aJf>"a`.\q/.N&XJ@fpJyg09.` <f&Zf09R` yZ0(=@>/?.N\B.K`R  g`H>aBJf`B@`pJL N^NuNVH.N N>|gJGfJLN^NuNV <\c0."y\R\`Jy2fRy2.\xNN^NuNV |#\BBy2N^NuNVJyexf,>NExf.\NN3exRy(Syex0."y$R$N^NuNVH.N*@Jg+|[2JL N^NuNVH.a>| g./<\NX`.N&@./N\X'y$BFK.N N>|ff`H||f>a`.Nr>a.a.>`| g |g|f./* ASSERT macro */ #ifndef NDEBUG #define ASSERT(expr) {if(!(expr)) printf("assertion failed: expr\n");} #else #define ASSERT(expr) #endif RT(expr) #endif  /* OSIF Error handling *************************************/ EXTERN WORD errno; /* error place for assigning */ EXTERN WORD __cpmrv; /* the last BDOS return value (AX) */ EXTERN WORD _errcpm; /* place to save __cpmrv */ #define RETERR(val,err) {errno=(err);_errcpm=__cpmrv;return(val);} /************************************/ RR(val,err) {errno=(err);_errcpm=__cpmrv;return(val);} /************************************/ ??/aP`d`N|"fHN:| f2 <f&ZfRyR` yZ0("yZRi> a>a`I` H>aJf.N N>|gJGfT.NrBWaJL8N^NuNVH*n n g H>a`BG`. n2G/0aX<JFfRGnmܾnl>RWaN>aF`(H>a8H0@"|b:0H|f _g` H>aH0@"|b:0H|f _gJfJfdJL N^NuNVH.NV>. NVGlB@`b n 0pH0@"|b:0H|f 0G _fB@`4BG`& nH"n HA@R RDgB@` RG nJf0JLN^NuNVH yd@RyDo.\N`x n&h./.N&XJ@f` H>aJf`JBE f`.a|g.Nr`bI`J|9[.`.(N>y[.>a.]Nr`PR.NVH*@ S`6 f"%H0@m N2FSI.(Nr` H>N:SdJL8N^NuNVH.aD>|g| f0`(|f.a&>| g./<]NX0JLN^NuNVH.N N>|#g0JLN^NuNVH (nBBn=|,`l nf > a`$K`Snn.],NB@`tRf nfRn`& nfSn`Jnf.]DNN.N N=@|g nfvJnfnfBn0.JL0N^NuNV <HVb.]SNN0."yVRVN^NuNV <4Vep`SV yVHN^NuNVHK.a>|g|f*.I`ܸfB./adX*@`~|g.]lN` `d` I`Rf.N N>|g |gJGfԾ|g.]}N.Nr`B/aX*@aZ <Zb.]N`zBW/9Z/ N'PJ@l@|g|g./<]NX`./<]NXZ` yZ1|>/ aRX.a JL8N^NuNVH*yZT` nR nJfBJL N^NuNVH BG`P(|c0Ge*Pf|/*nfBBW/<cN(X<m>N4f <c`RGyRmJ gv <f&Zf . ` 9ZT*@(|c`RE`0SEJ@f>// NvX:l*nfBBW/<cN(X<m>N4f <c`"(|c*y[*fS*nfB <cJL0N^NuNVH.N N:|#g|!g.]N`.N<3N>0GY #g0GY gV0GYJgJKN>0GY g0GYJg0GY #fB>/aDX`. <f&Zf>/9Ha&X`>/9ZTaX|g$`N>0GY g 0GYJfJL N^NuNVH>.HǏ HG0.H =@>W0N:JnnJLN^NuNVH#ez#*e#âd ydBP~`a<0`JGg <Īeb._NNBGTe ye0L`JGg|`JGf`vJGg`lJGfvBG>aJ@gh``JGf`BWaJ@gV <,efH<9,> N:0`RJGf0|n*``H |^(r W h$N~>aXJ@g` ._N|f > N:B@JLN^NuNVH`.N>0`.a3Lp`ByLKz`H|'g~|\f^ 0m$ 7nBF` FH@| 0m 7o`4H0`| `(| `$|` | `| ``H |^xrW hN029LAA3LSElzp`F.N *@ g .N`p `$`0``|g4| gȰ|!g``JL N^NuNVH0n]:|?` y Pf nfUUdp``p ye> y0P](g<Ue ye> y0`F`F`UdU y PgB@`JUe yeJPg0`0>`B@`(0G`F`F`FgB@`p>`FfB@`p>`FmB@`p>`FoB@`p>`tFnB@`p>`dFlB@`p>`T0g`N0g`H0D@>`@JGgB@`p>`20F@>`*`&HǏ` HǏHG``S@|b@0@^ PN ye0UdU ydPmj < db._0NNT y0Td yd0pJLN^NuNVHBEx n 0f xR n xg n XfxR`><|0|Am|Fn>|`|0m |9n|0``"Dl02A: nH>0RJ@f0JLN^NuNVH*n(n &Mf JL8N^NuNVH *n(n ` gSS`JfHHAJL0N^NuNVH*n ;|A+HJnfB@`p=@>?</.N(\:JL N^NuNVH*n Jmn,A+H>/-?NE\|gN);| m RSm. HJL N^NuNVH*n .0.@?WaT.?.WaxT0.JL N^NuNV. n?aTN^NuNVH*n><m;|A+H>/-?NE\GgN)B@JL N^NuNVH*n BmJnfB@`p=@>Bg/.N(\:JL N^NuNVH*nJmnA+H>/-?N-p\;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.N62\N^NuNV>?. /.N2\N^NuNV._T/<`4N-PX>N3N^NuNVH BWNEx#c#c Byc.Wa>*n`v`RJgHHмb: @fJgZ "g 'fFH>/ RNX(@ f._p/ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHмb: @gJ5pg M2GBRGH`BWN4fBW/ RN7>XJ@g.R/<_aX`>N4f ->f@>/ TN7>X|f>B?<N7p\|f.R/<_aX`$BW/ RN3X|g.R/<_a~X`.a`|gr`JfBaSyc.c N|f._/<_a*XB/9c?9cN\>N3JL0N^NuNV|./NVX. /NV^X._/NV^X.?< NT>N3N^NuNVH*n yc Xc RycJL N^NuNVN^NuNVN^NuNV._N,N^NuNV._N,N^NuNV._N,N^NuNV._N,N^NuNVHNFBW/<WN7&X>/<WN7&X>/<WN7&X n2n B*n`&HHмb: @g H| `HRJf> /.N)>XJL N^NuNV4._/8NVX./8NV^X._/8NV^X.8?< NT>NN^NuNV. /./<`&N9PN^NuNV./. /.N9PN^NuNVH>NGt*@ fp`-gB@`t-g3 b$3cb&p`T-g>/. / N1P`8-gB0../. / N.P``B0../. / N/fPJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ NL|g3b$3cb&p`U>!/</ 4/./ NL|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ NL|g3b$3cb&p`U>!/</ 4/./ NL|g3b$3cb&p`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ NLH,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ NL|g3b$3cb&p`fU>!/</ 4/./ NL|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .`N, ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHNF~>|fp`>NG0*@`JnfU.W/.NVXJ@f U0`R`.W/.NVXJ@fU0`2>/.?NQ\J@g3#b$3cb&p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN3>NN^NuNVHBG`0м`.N4RG|mJLN^NuNVH*n0-|g*.N5-g .NBTB@H+@+@Bm m>N4fJL N^NuNVH>.>NGt*@ f3 b$3cb&p`BF0|f-g6-f. - l>B?N7p\>/<W?NE\-g,>"/</ 4/-/ NL|g|-H>NR:.?<NT||f|>-H?NS T>NG>NFJFf0``3b$3cb&pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?NE\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N7p\Bm +mB@JL N^NuNVHNF~>|fp`>NG0*@`Jn fUJnfU.W/.NVXJ@f U0``.W/.NVXJ@fU0`d>/.?NQ\J@g>NF3b$3cb&p`0U>B-H?N7p\BWB-H?N7p\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>NGt*@ f3 b$3cb&p`v0.`F+n `P . ѭ`F>N86+@ - Ю +@`*3b$3cb&p`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>NGt*@ fp`^0|gB`P-g +m `0-H>NR<.?<#NT>-H?NS T <0.-0S-gJmʾg-gF>"/</ 4/-/ NL|g3b$3cb&p`U>!/</ 4// NL|g3b$3cb&p`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N>F\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <DT` <E #c$.c$?<?< // NC Jngp`pH`RnJng <DT` <E #c$.c$Bg?< // NC Jngp`pH`zRnJng <DT` <E #c$.c$Bg?<// NC Jngp`pH`&RnJng <DT` <E #c$.c$Bg?<// NC Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N+ X|`~H>?// N+ X|`XH>?// N, X|`4.H?N>TRn``|C|5b@0@` PN.NV:ElJFm:0.E=@JnfX .0f* n -f SE. nH?N>TRRn`..H?N>TRn0.SnJ@n.?/.N>F\n`..H?N>TRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?NE\Gg lp`*B@`&`.H?N>T|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?N>TJL N^NuNVH. *n BF:-fp`$JfV-fN>N@+@+@fm`2m>N@JJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?NE\<Bm `n-g>< g -мb" -:>/-?NE\<+mBm `( -:>/-?NE\<;| +mFg mp`H|JL N^NuNVH>NGt*@ fB@`-fB@`pJL N^NuNVH>NGt*@ fB@`0|JL N^NuNV>aJ@g <W`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (ya*T`ZB@0-BA2-@F@J@g>NCB`:B@0-ne `*af>a*@ f>NCB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#a PJL0N^NuNVH >.|?GG0@>NEx*@fB`* R*@(M9GB@0,F@9@.Pa 9aJL0N^NuNVH *nQB@0-BA2-@F@J@g>NCp`(yaػeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #aB@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#aB@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|b*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*yc(Gc.N|f3 b$3cb&p`>Bg/ N\ JL0N^NuNVH>NGt*@ fp`vJnfB@`j-g3 b$3cb&p`L0|g>/. / NOVP`0-g>/. / NGP``>/. / NIPJL N^NuNVH|BG` af a0`RG|m3b$3cb&pJLN^NuNVp2.`F@HaB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@`0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 b$3cb&B`0B@0*@`-f3 b$3cb&B` JL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ NL|g3b$3cb&p`U -"- S¼nB>!/</ 4/./ NL|g3b$3cb&p`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ NL|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ NL|g3b$3cb&p` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// NL|g3b$3cb&p`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4NUPnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// NL|g3b$3cb&p`xU+|Rn neB@0.H=@>"B0.//. B0.// NLng3b$3cb&p`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// NL|g3b$3cb&p``>/. / 4NUPU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>NR=@=|`.?<NT n!n 0 oB@09a|`f noR9ag op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(9ag09cr `=@` 09c@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?NS TJng.?<,NT .N^NuNVB?< NT3caB@09a`tyda`~B?<NT09c`$yay@a`,yaya`|"gް|1gа| g|1g`a*`$ya```H |arW hNN^NuNVB?<DNT ycgJycgyaB@``pN^NuNVh=|rBnp n(g -|Qt` n(g-|Pt n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м`-@(nBG./ NSNXJg3b$3cb&p`J,g nl nf,>?/ RNXJ@g3b$3cb&p` n(H>NR< nf.?<NT nf n(g,.?.NT>> n(H?NS T ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHмb: @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9b(NXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHмb: @fJg.HHмb: @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH..,. Jf#b <`Hc #bB`:fzB`(xe 〼b`BJge`#b JLN^NuJg .NuStack Overflow/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321 $C runtimeCON:LST:XXXXXX34567CDEIPcdeipVv<VB.L<VB.L@(#)main.c 1.6 12/28/83cp68usage: %s %s source [dest] [-C] [-P] [-E] [-D] [-I] [-6] [-7] [-3]usage: %s %s source [dest] [-C] [-P] [-E] [-D] [-I] [-6] [-7] [-3]usage: %s %s source [dest] [-C] [-P] [-E] [-D] [-I] [-6] [-7] [-3]## !!!!!!!!!!  "             Z  0       r    | |     %s, # line %d: %s, # line %d: %s, # line %d: too many characters pushed backsymbol table overflowno */ before EOFbad character 0%ostring too longstring too long[[[[[[[[[[ Zj6tdefineincludeundefifdefifndefelseendififlinecan't open source file %s can't creat %s define table overflowNewlabelLabelunmatched conditionalinvalid #endifinvalid #elseinvalid preprocessor command__FILE__LINEline overflowdefine table overflowbad define name: %stoo many argumentsargument buffer overflowdefine recursiontoo many argumentsargument buffer overflow_Lbad argument:%smacro argument too longunexpected EOFcondition stack overflowbad include filebad include file nameincludes nested too deeplycan't open include file %scan't open include file %sinvalid #line argsPPFFHJHLLNNNNDDRRR"!!!!"!!""Fbfnrt#8#@#0#<#4#\$R$L%%%^%^$$X$$$$$$$$$% %%4%8%>%,expression stack overflowexpression syntaxexpression operator stack overflowWrite error on output file : unmatched quoteCannot open Cannot append Cannot create Stack Overflow $_floating pointC RTL - program not linked for Program terminating $Raw I/O   <;X<<="=F=F=F=F=F=F=F<=F=F=F<=F;=F=F.,=:|[]* !!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321 7Jp`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// N)|g37H38<7Jp``>/. / 4N2PU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N.=@=|`.?<NT n!n 0 oB@097|`f noR97g op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(97g098 n(H?N/0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м8p-@(nBG./ N/jXJg37H38<7Jp`J,g nl nf,>?/ RNXJ@g37H38<7Jp` n(H>N.< nf.?<NT nf n(g,.?.NT>> n(H?N/RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHм7^ @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/97LNXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHм7^ @fJg.HHм7^ @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH..,. Jf#7 <`Hc #7B`:fzB`(xe 〼b`BJge`#7 JLN^NuJg .NuStack Overflow$C runtimeCON:LST: EQPdXPPrUsage: more filename.ext File not found --More-- : unmatched quoteCannot open Cannot append Cannot create Stack Overflow $4floating pointC RTL - program not linked for Program terminating $Raw I/O    t>bbbbbbbbbbbbbrbbbbbbbbbbx>bbbbbbb"bbbbbbv66"1001 "0"++***+++7P<>.,=:|[]* !!!!"CP  8l.8lBg?< // N Jngp`pH`zRnJng < p` <!&#8l.8lBg?<// N Jngp`pH`&RnJng < p` <!&#8l.8lBg?<// N Jngp`pH`-M n-PX`-M n0|@B.T`H>?// Nh X|`~H>?// N| X|`XH>?// N X|`4.H?NTRn``|C|5b@0@6 PN.N2:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NTRRn`..H?NTRn0.SnJ@n.?/.Nb\n`..H?NTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?N!\Gg lp`*B@`&`.H?NT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NTJL N^NuNVH. *n BF:-fp`$JfV-fN>N+@+@fm`2m>NfJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N!\<Bm `n-g>< g -мb" -:>/-?N!\<+mBm `( -:>/-?N!\<;| +mFg mp`H|JL N^NuNVH>N#*@ fB@`-fB@`pJL N^NuNVH>N#*@ fB@`0|JL N^NuNV>aJ@g <4 `BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y6*T`ZB@0-BA2-@F@J@g>NB`:B@0-ne `*6f>a*@ f>NB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#6 PJL0N^NuNVH >.|?GG0@>N!*@fB`* R*@(M9GB@0,F@9@.Pa 96JL0N^NuNVH *nQB@0-BA2-@F@J@g>Np`(y6eeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #6B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#6B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|7*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y88(G88.N|f3 7H38<7Jp`>Bg/ N\ JL0N^NuNVH>N#*@ fp`vJnfB@`j-g3 7H38<7Jp`L0|g>/. / N+rP`0-g>/. / N#P``>/. / N%PJL N^NuNVH|BG` 7f 70`RG|m37H38<7JpJLN^NuNVp2.`F@H7B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@8p0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 7H38<7JB`0B@0*@8p-f3 7H38<7JB` JL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ N)|g37H38<7Jp`U -"- S¼nB>!/</ 4/./ N)|g37H38<7Jp`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ N)|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ N)|g37H38<7Jp` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// N)|g37H38<7Jp`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4N2PnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// N)|g37H38<7Jp`xU+|Rn neB@0.H=@>"B0.//. B0.// N)ng37H38<  .5/8N2zX.8?< NT>NN^NuNV. /./<5JNPN^NuNV./. /.NPN^NuNVH*nSm m mH|R` `.NJL N^NuNVH*n-fp`-g m p`Jf&-f>N+@fm`m-g0Hм8\+@5`>/-?N \;@ Jm n m fm0`m p`Sm +m mH|RJL N^NuNVH>N#*@ fp`-gB@`t-g3 7H38<7Jp`T-g>/. / N P`8-gB0../. / N 4P``B0../. / N PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ N)|g37H38<7Jp`U>!/</ 4/./ N)|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ N)|g37H38<7Jp`U>!/</ 4/./ N)|g37H38<7Jp`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ N)H,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ N)|g37H38<7Jp`fU>!/</ 4/./ N)|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .54N ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN">|fp`>N#"0*@8pJnfU.4 /.N2XJ@f U0`R`.4/.N2XJ@fU0`2>/.?N-\J@g3#7H38<7Jp`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN>NN^NuNVHBG`0м5<.N*RG|mJLN^NuNVH*n0-|g*.N-g .NpB@H+@+@Bm m>NJL N^NuNVH>.>N#*@ f3 7H38<7Jp`BF0|f-g6-f. - l>B?N\>/<4?N!\-g,>"/</ 4/-/ N)|g|-H>N.:.?<NT||f|>-H?N/N#">N"JFf0``37H38<7JpJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?N!\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N\Bm +mB@JL N^NuNVHN">|fp`>N#"0*@8pJn fUJnfU.4 /.N2XJ@f U0``.4/.N2XJ@fU0`d>/.?N-\J@g>N"37H38<7Jp`0U>B-H?N\BWB-H?N\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N#*@ f3 7H38<7Jp`v0.`F+n `P . ѭ`F>NR+@ - Ю +@`*37H38<7Jp`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>N#*@ fp`^0|gB`P-g +m `0-H>N.<.?<#NT>-H?N/"/</ 4/-/ N)|g37H38<7Jp`U>!/</ 4// N)|g37H38<7Jp`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. Nb\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng < p` <!&#8l.8l?<?< // N Jngp`pH`RnJng < p` <!&#  #include "stdio.h" #define EOF (-1) main(acnt,avar) int acnt; char *avar[]; { static FILE *fchan, *fopen(); if(acnt != 2) error(1); if(!(fchan=fopen(avar[1],"r"))) error(2); dopage(fchan); while(TRUE){ switch(prompt()){ case 'Q': case 'E': case 3: exit(0); case ' ': dopage(fchan); break; case 0xD: doline(fchan); break; } } } error(n) int n; { switch(n){ case 1: printf("Usage: more filename.ext\n"); break; case 2: printf("File not found\n"); break; } exit(1); } prompt(){ static struct { int funcnum; long int vp1, vp2; } bpb; static int ch; printf("--More--"); bpb.funcnum = 3; ch = toupper(bdos(50,&bpb)); printf("\b\b\b\b\b\b\b\b \b\b\b\b\b\b\b\b"); return ch; } toupper(ch) int ch; { return((ch >= 'a' && ch <= 'z') ? ch - 'a' + 'A' : ch); } dopage(fchan) FILE *fchan; { static int i; for(i=20; i--;) doline(fchan); } doline(fchan) FILE *fchan; { static int c; while((c = getc(fchan)) != EOF && putchar(c &= 0x7F) != '\n'); if(c == EOF) exit(0); } `3B |BN3`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#84"h#88E?/ NN o AdpNu#88BNuNV0/"/ NB88d0< A3"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNV ng>av.4F n /(NX#8>f>aP.8>a`>a`"BWN.8>a`$.8>a``H |4rW hN`N^NuNV0.`.4HN`.4bN`` |gܰ|g>NN^NuNV.4rN38B.8B?<2NT>a38L.4{N098LN^NuNV nam nzn 0.|`0.N^NuNV38N`.a098NSy8NJ@fN^NuNV.N^38P|g".5Jy8P?98PNT| f y8PfBWNN^Nu0/"/NBNuNVH BWN!#8T#8XBy8R.4a>*n`v`RJgHHм7^ @fJgZ "g 'fFH>/ RNX(@ f.4/ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHм7^ @gJ5pg M2GBRGH`BWNBW/ RNZXJ@g.R/<4aX`>N ->f@>/ TNZX|f>B?<N\|f.R/<4aX`$BW/ RNX|g.R/<4a~X`.a`|gr`JfBaSy8R.8XN|f.4/<4a*XB/98T?98RN\>NJL0N^NuNV|./N2X. /N2zX.4/N2zX.?< NT>NN^NuNVH*n y8X X8XRy8RJL N^NuNVN^NuNVN^NuNV.4NN^NuNV.4NN^NuNV.4NN^NuNV.4NN^NuNVH*n(n BG`|lRG0&@5<0+|f|mB` wg Wf>?</ N\<`p ag Af>>?</ NN\<l>?</ N\<`>B?N\`$ rg Rf>Bg/ NN\<`B`@JFlB`8Bk 6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/. /.aPN^NuNVBW/. /.aPN^NuNV>/. /.aPN^NuNVHN#BW/<4 NBX>/<4 NBX>/<4 NBX n2n B*n`&HHм7^ @g H| `HRJf> /.NXJL N^NuNV4.4/8N2X./8N2zX  ********************************************************* * * * Disk Initialization Program for CP/M-68K (tm) * * * * Copyright Digital Research 1983, 1984 * * * ********************************************************* * * * prntstr = 9 BDOS Functions readbuf = 10 * seldsk = 9 BIOS Functions settrk = 10 setsec = 11 setdma = 12 write = 14 sectran = 16 flush = 21 * .text * start: link a6,#0 move.l 8(a6),a0 base page address add #$81,a0 first character of command tail scan: cmpi.b #$20,(a0)+ skip over blanks beq scan cmpi.b #$61,-(a0) get disk letter blt upper upshift sub #$20,(a0) upper: cmpi.b #$41,(a0) compare with range A - P blt erxit cmpi.b #$50,(a0) bgt erxit query: move.b (a0),d0 put disk letter in message move.b d0,msgdskx ext.w d0 put disk letter into range 0 - 15 sub.w #$41,d0 move.w d0,dsk move.w #prntstr,d0 ask whether it's really ok to init move.l #msgdsk,d1 trap #2 move.w #readbuf,d0 read reply move.l #buf,d1 trap #2 move.b buf+2,d0 if answer isn't Y then exit cmpi.b #$59,d0 beq doit cmpi.b #$79,d0 bne exit * doit: lea buf,a0 init disk buffer to empty directory entries move.l #$e5e5e5e5,d0 move.w #31,d1 bloop: move.l d0,(a0)+ dbf d1,bloop move.w #setdma,d0 set up dma address for write move.l #buf,d1 trap #3 move.w #seldsk,d0 select the disk move.w dsk,d1 clr.b d2 trap #3 tst.l d0 check for select error beq selerx move.l d0,a0 get translate table address for sectran move.l (a0),xlt move.l 14(a0),a0 get DPB address move.w (a0),spt get sectors per track move.w 8(a0),drm get directory entry count - 1 move.w 14(a0),trk get starting track (=offset) clr.w sect start at sector 0 clr.w count count of initialized sectors * dloop: move.w count,d0 while count <= drm ... cmp.w drm,d0 bgt exit move.w sect,d1 check for end-of-track cmp.w spt,d1 blt sok clr.w sect advance to new track add.w #1,trk sok: move.w #settrk,d0 set the track move.w trk,d1 trap #3 move.w #sectran,d0 do sector translate move.w sect,d1 move.l xlt,d2 trap #3 move.w d0,d1 set sector move.w #setsec,d0 trap #3 move.w #write,d0 and write clr.w d1 trap #3 tst.w d0 check for write error bne wrterx add #1,sect increment sector number add #4,count increment count of directory entries bra dloop and loop * exit: move.w #flush,d0 exit location - flush bios buffers trap #3 unlk a6 rts and exit to CCP * erxit: move.l #erstr,d1 miscellaneous errors  erx: move.w #prntstr,d0 print error message and exit trap #2 bra exit * selerx: move.l #selstr,d1 disk select error bra erx wrterx: move.l #wrtstr,d1 disk write error bra erx * .data msgdsk: .dc.b 'Do you really want to init disk ' msgdskx:.dc.b 'x ? $' * .even buf: .dc.b 126,0 dual use buffer -- console input & dsk output .ds.b 126 * xlt: .ds.l 1 translate table address spt: .ds.w 1 sectors per track drm: .ds.w 1 maximum directory entry number sect: .ds.w 1 current sector trk: .ds.w 1 current track dsk: .ds.w 1 selected disk count: .ds.w 1 number of directory entries written so far * erstr: .dc.b 'Error',13,10,'$' selstr: .dc.b 'Select Error',13,10,'$' wrtstr: .dc.b 'Write Error',13,10,'$' * copyrt: .dc.b 'CP/M-68K(tm), Version 1.2, Copyright 1984, Digital Research' serial: .dc.b ' XXXX-0000-654321' * .end ``(NV n  g amP Am PnH|A30< "<`NB0< "<NB9 Yg yfA <2< Q0< "<NC0< 29BNCJg @# h3 3 3ByBy09y nZ29y m ByRy0< 29NC0<29$9NC20< NC0<BANCJ@f.RyXy`0<NCN^Nu"<0< NB`"<`"<-`Do you really want to init disk x ? $~Error $Select Error $Write Error $CP/M-68K(tm), Version 1.2, Copyright 1984, Digital Research XXXX-0000-654321`9!BN`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#"h#E?/ NYN o AdpNu#BNuNV0/"/ NBd0< A"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVa.aJ@gBW?</.NX/NV\N^NuNVaP.aJ@g BW?.?. /.NX/N+PN^NuNVa.aJ@g,.BgBg?</.NX/NVP?NPXN^NuNVHa.aZJ@g n>(.N-@ n PNO> N;JBW/.NLjX` .N8> N;JJLN^NuNVH>N:*@:E;n;n;n;n 0. `NB Bm . ;@`PB . ;@Bm`>;|+n ;|Bm`&+n BmBm``|gа|g|g` JL N^NuNV .e <dB@`J n0P~gp`2 n0P~(g n. aJ@fB@` n.aN^NuNVJygJyf > N;JJyf>/<*N;X`>/<4N;XN^NuNV.a6-@>Bg/.NG.\.a -@.PaJ@f .N^NuNVH n:0E~g .`f0E~g n h PJft n. a/ n!_ n*h(m>-G|8-||0fSF n h PCf|g|f|f$ n!L n h 20(`1@ .` n h Jhf, n0 n!L02`F@"n"i 3@ .`0"n"i 2)A@f* n0 n!L02`"n"i 3@ .`J|f n!L`d>/ NJX-@ n: n-h |gLBW/ NJX-@.ap*@.?</ NJ\/BgBg?<?WN9 -@`>/ NJX-@>?<N:T./.BgBg?<?<N9 -@>?<N:T./.BgBg?<?<N9 -@02`F@>?<N:T./.BgBg?<?<N9 *@./ BgBg?<?< N9 -@./.BgBg?<?<N9 -@`κ|Jf n>(G|| n0(|fSF>?<N:T. n/(BgBg?<?<N9 -@>?<N:T./.BgBg?<?<N9 -@`> n.a/ n!_0E~(g n. a/ n!_ .JL0N^NuNVH n&P S2g0+|g kk:0E~gB@`BF=F0E~(g . a@.Pa@`T n *k0E~(g$(k kf7|.]/ a X-@`.]/ a vX-@JgJng n (` n0(H-@0`Jg$Jf&M` UJ@g. l PCf$*l;| l 0(Hѭ 'M 6.`j T%fr l P)g l P*f^(l l PNf0 l Jm$ l n l 0C l 1|` l P$f l )h T%'L `Jg^ mfVJng ,88C`8,|o.N90|9@`|l.N90|H9@`|`xJg8Jf&M`x6Jng .D"n#@` .D"n3@`L.Q/ a X-@g.Jng nJgJnf nJhf6 *L'M` `JgDJf.N8&L` f&M` f Sfp `p06`.Q/ a "X-@g&Jng nJgJnf nJhf&M`.a(J@g n&P`p`ZJgPJf.N8&L`N f.Jng n!|` nBh|f6`&L`.Q/ azX-@g&Jng nJgJnf nJhf&M`.a J@g n&P``Jg, f&M` f Sfp `p06`.a 4J@g n&P`|`fJgr.a>md Uf^.Q/- aX(@ gJJnf0l.a ԰GgJng0.a °Gf$0S6 nBh n0C``Jg4Jf. mf&Jng n!|` n1|&n``JgJf mf&n``Jg f&M``rJgJf&M`r f&L`b`LJg2Jf&M`L f S fp `p/6`0 mgD` kf T$f l hf 'l `JgJf&M`g 'n `` U=f&m` UEf6 mf.6 - >?<N:T'@ ;k;|B ``x-m0`&n`vBWBg0m/?< ?+N~ &@`R> Bg/-?< ?+N~ &@`.> Bg/-?< ?+N~ &@` .aJ@g;|;kB &M``, n PEfN n hfB.Q/- a2X(@ g.Jnf( n0(|0|g n0,HѨ &n`.a(J@gn.Q/- aX(@ g0Jnf* n1| n1k n0,HѨ &n`>Jyf" m PrW h N`0U~g&M0S6``| kf7|0Uf&m`r U$f:6$;|`\ U%f:6%;|`H`4 Uf0-||;@&M`,``S@|0G~gF n&h. n/( aXJ@g* n2G0 n"n!i  n!K 0G~g.A-H\Ad-H`.`/\/.a$PY\Y`K` .aN*X\cK`"(M`./aLXJ@g&T(*X\cX\c(n\*n`` &U'T 'd.aJ@g Y\Y`(Y мdbIKd&\`h U!K&]'\ kgT0+|0fJ k hg k 0(|0g k 7h`$ k hg k0(|0g k7h`c-K`j0G~(g. n.aB/ n!_ n. a,/ n!_ `*0G"|~00|@@f n.a/ n!_ .JL8N^NuNV n h fB@` n h fp`| n PEf n hfB@`` n PEf n hfp`F.U/. aXJgp`0.U/.aXJgB@` n0("n 2)AnB@`pN^NuNVH (n *n n0"n"i2Af./ n/(aP` T"n X n0"n"i 2Af./ n/( aP` T"n X U XJL0N^NuNV n PDf n 0 .`` n BP n PCf .` n P$fx n h PCg n h PDfZ n0D n1| n h PDf n"n"i!i` n h0(H"n#@ n 0 .`x n P%fj n h PCg n h PDfN n0C n1| n h PDf n h ("n3@` n"n"i1i .`BN^NuNV n PEf n hf n hmp`B@N^NuNVH n&P>0G~gB@`fBF=F*k UOf(-RF`..U/ aVX*@ gJng -`0-H(`B@` 0G~(g(k |@fr*l(l Jng UDf TDgB@`Jnf UCf TCgB@`JngJg -` ,+@`Jg0-`0,;@ n p` TOf*RF*,0`B@`z`W@|b@0@z PN`6.Y/ ahX(@ gJng ,`0,H*0.n`B@`*0`؅`䘅`//NP(`//NHP(`//N:P(`" (`" (` `nB@`pH(`vlB@`pH(`dmB@`pH(`RoB@`pH(`B D(`: F(`2JgB@`p(`$` ȅ`B@`R`S@|"b@0@ PNJng.?<N:0T*@`JFg.?< N:\T*@`;D n pJL8N^NuNVH n(P.U/, aX*@ gJnf0m.a=@lB@`Jng.a=@lB@`>|g|g l hgB@`0`X~`j~`d~``~`\~Jnf 0-S@=@` -S=@`<~Jnf 0-S@=@` -S=@`B@`0`H |&rW hN8Jng:C;np`B@JL0N^NuNV n PDfp` n hg n0(|0fB@`pN^NuNVH n*P.a>g n*P(m .aJ@f .aJ@g0`:(`.a~J@g lgU% TDf8N`x.aXJ@gl TDf8NU>/ NJX.?</-NJ\/BgBg?-?<N9 / n RG``H |^rW hN0JL0N^NuNVH~`.f .-@SGJf .gp`0JLN^NuNVH n PBf,>?< n/(a\>?. n/( a\`DBFA-H./.a4X-@ мdt n fj n0P~gN. n/( NX(@ g,JngJg JnfJlf| n-h=| `|`|=| >?. /.ar\> мd||f*Jyf>/<`N;X`>/<mN;XK`>RW?</a\Xe|f.?NRT`|f>/<{N;X0JL0N^NuNVH n>0G~f|@g |>g|?f .`|g|f:> n/(NJX*@>/.NJX/ n P "n X `N0G~(g. n/( abX/ n!_ . n/(aFX/ n!_ .JL N^NuNVH n0`nBF>9 n h PEgRy n PHf& n*h `. a<@*m UBg.a*@ n0>?</.a\>NT3BW?. /.at\B@`b>?< n/(aT\>?. n/( a>\`2 n f n. a8m> n/(aX8m n h 0P"|~00|g n"n"i !i n h 1D n h 0C n h 1| n0&.N-@>?./.NG.\`"` |gF|Bg|Hg~|Igv>?. /Pa2\J@g0 n f( n PEf n hf n hl0.`>?. /.ar\:0JL N^NuNV0. `<.?.NRT`/.?.NR\``|g|gʰ|g0.N^NuNVH n0`" n(h n fN TEfH lg lf8.N9.N;BW/ NLjX.N;0.`d` n h hfp` n h0(|f n f nm 0.|=@` n>?.RWW?< n/( aP??.W?< n/(aP?aX0.``< n f0.``( nm.U n/( NX*@ g n h hgJnf mg& mgJng g f>?< n/(a\> n.?.?NPX mf.?.?./<NPP.?.?./<NPP>?. /.a\0.``4 n.NJ@gf0.|=@.?. n h>(?NPX n h1n>RW?. /.a,\.??.NPX0.`F n f. nm&0.|=@>?. /.a\0.``.U n/( NX*@ gLJnf Jml mm0-D@;@ nRP`&Jng Jl m -D+@ nRP``H |rW hHN>?./.NG.\>?. /.aH\>m0`\>?. /.a\\>m0`@>?. /.a|\>m0`$ n fz>?</.ND\*@ g^.?.?</.N<,P> n0P~g. n.NJ@g n. n h?(NRT`>?. /.ND\*@ g.?.?. /.N<,P>`j n g&>?</.a\>?. /.a\>`< n h g$ n0P"|./<N8X` .N80JL0N^NuNVH nl&>W?./<N;\0.|=@ n l&> W?. /<N;\0. |=@ >9Ry>W0. H?SW/<N;\JGo>/<%N;X>?.W?.?. /<*N; JLN^NuNVH? n P=g n hn n:( n P=f` n(h TfP*l (lBG UCf>-0|m|n TgxBWBg0G/?<?N~ -@.NJ@g n1l`<>W?</ a4\<|l.?W?NPX0|"n3@` UCf*l (l.NJ@f.NJ@f UEf mf&L(M*KB@H-@&@.NJ@g,6, UEf mf mg=m=m`&M`J TEf0 lf( lg Jyf UW?</.a\6|l.?W?NPX|RF g2 SW?</ a\=@=k>?.0G/??NI -@ nm n hf 0.|=@./.Bg?< n?(?<'N9 -@>?. /.a\`pJL8N^NuNVH n PfP n*h  UCf `@Jyf6 U0G~g n h hf.U n/( NX*@ g~Jng4. n/(Bg?< ?<?<'N9 / n!_`B mn ml2. n/(Bg?< ?<?<'N9 / n!_ n g0G~f|?g|>g| f<9Ry>??</.aPBW?<N:T.N*@>?. / aB\:9RyJEo>/<KN;XJFo>/<TN;X>?<N:T.N*@>?. / a\JEo>/<YN;X0.`pJL N^NuNVH n P@f n g>9Ry>?Bg n/(aP:9>?. n h /(a\8.?.?NPX3JynB@`p<0RyJ@g<9>/<^N;XRyJGo>/<gN;X>?. n h /( a~\8.?.?NPXJFo>/<lN;X0.`pJLN^NuNVH n*h n:0E~(g n(h 8. 0`& nJhf Jn fJno>/<qN;X`Jn gJno>/<zN;X`>?.Jn gBg`?</ a`P`Jn gB@`p=@ Jn fN>9Ry>?JDgBg`?</ a P>?.?/ aPJGo>/<N;X`$>?.?/ aP>?.?/ aP`B>?< n/(a\>?.?. n/( aP`>/ / ??. NS. J@f0E~g" UFf TFf0-lf .NQ `>?</.ax\BF0E~g( mg0-|0f lg 0,|0gRF`zJn f0E:0F2E"|0H<>0F"|0/0/<N;P``H |rW hNJL0N^NuNVH n*P<BG0F~f|Bg~|@gv|>gn|?gf|"g`|#gZ| gT|!gN>?. / Pa\@0F~(g>?. /  ap\@>?. /.a(\@JGg n.N/ n 0JL N^NuNVHBF n*P`&m SEf-m 0`| kg0` n0` n h hf kf0` n h hg n h P$f, n h hg n h P$f kf0`@ km0`2 n(h kn> n/( aXJ@f0` n(h TEf lf 0,kg+L >?</ a@\ n+h n0|:``S@| b@0@ PN kg0` kf0`>?</ aF\*K`D n g(n >.`SGJgH>/97NXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHм70 @fJg.HHм70 @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH?BCB..,. f#8 <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#8 D`#8 JLN^NuNV/. /.N2 98N^NuNVH..,. Jf#7 <`Hc #7B`:fzB`(xe 〼b`BJge`#7 JLN^NuJg .NuStack Overflow$C runtimeCON:LST:3c.outunable to open %s read error on %s File format error: %s %s: ( ) stack size = data start= bss start=%s%s: unmatched quoteCannot open Cannot append Cannot create Stack Overflow $4floating pointC RTL - program not linked for Program terminating $Raw I/O   t>bbbbbbbbbbbbbrbbbbbbbbbbx>bbbbbbb"bbbbbbv66"1001 "0")))V)V)b)))7"<>.,=:|[]* !!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321 kf0`Z>?</ a\*K``||b@0@ PN`(.N*@ n RF>0G~(f.0JL8N^NuNV n0P~g, n PEf n hf n0(n fB@`Fp`B> n/(aXJ@fB@`* n0P~(g> n/( aX`pN^NuNVH n>(0|0gp`60` p`.p`*`S@|b@0@$ PN>/<N8XB@JLN^NuNVHBG n PEf n h f.N8`4JygBW?</.a:\.aX>`BW?</.a\0JLN^NuNVH n hfBG`.a>0. H@SG n PEfZ n0(`8 n hl0. `p` n0HѨ 0. HH@`x`U@|b@0@H PN`Z n P=fP>?<N:T. n/(BgBg n h?(?<N9 / n!_0. HH@`pJLN^NuNV.U/.NX-@fp`(Jng n (` n0(H-@.NN^NuNVH n (PX (| nl.aBW/< n /NUPJ@l n ./<aVXBW/<X n /NUPJ@l n ./<a&XBW/<X n /NTZPJ@l n ./<aXYn`tX n *P -g.aD`XH`:By`JRy`BRy`:Ry`2Ry`*Ry`"`.a`H |Vr W h(N``0.SnJ@fa*.a\Jy fBW`>NajJL0N^NuNVH`"0`a3a#a*@ gT0`:.N`B.Nr`6>?-/-N:\` .N``|Kgذ|Lg|Mg``N``>ab.NU>| f>aH`v.NU>| f`>a(.NU>|%g|f|f .aD`,>?/<a,\``|%g|(gr|.g`.NU>nJL N^NuNVH a>nB`Pa<0`*a|:|f.Qa~.??NSX*@`BWBgaRH/??N~ *@`a4>?aT*@`a.?aT*@`a.?a(T*@`a:aR*@ g./ Bg???ah *@`0G~(g8a*@ fB`na(@ fB`^./ BgBg??a *@`&a*@ g./ BgBg??a *@``|C| b@0@ PN JL0N^NuNVH*|`R.NU| fBJL N^NuNVHBF`b.NU>0`:0`NF0|@`@F0|@`4F0|@`(>?/<a\`H |rW h`N`JLN^NuNVHBFBD`~.NU:0`TN0|@`^N0|@`RN0|@`F0RDJ@f>BF`8JDg=G=F .`(>?/<ad\`H |rW h`N`JLN^NuNVH~*n`SGm.NU<| fJGoB .JL N^NuNVRy Jyg$>/</<8/<NZ >?.?.?.?.?. /./<NZ.F/<NZXN^NuNVJyg&>/</<H/<NZ `.`/<NZX>?.?.?.?.?. /./<NZ.k/<NZXN^NuNV>?.?.?.?.?. /.a>NajN^NuNVH>a*@:;n ;n +n+n JL N^NuNVH> ax*@:C;n;n  JL N^NuNVH> aJ*@:D;n+n  JL N^NuNVH> a*@:O;n+n  JL N^NuNVH*y 2.HЁe .ma 2.HЁ# JL N^NuNVH *n(n ~`JgH`B@SGlJL0N^NuNV./<aXN^NuNV n f>/ ?<Ns\` . H>aN^NuNV yo>/ ?<Ns\.. H?NTTN^NuNVH*n><m;|A+H>/-?Ns\Ggp`B@JL N^NuNVH>?.?.?.?.?.?. /./Ng`K` H>a0RJfJL N^NuNVH? n>|m| o|(m|*o n hf 0.|=@ n-hBC=C n*h(M=|0G~(gRn n(h n hg n0(|0g@|g8|g2|g. nl& mg0-|0f lg 0,|0fRC0`& mfRn`. mg lfRn``W@|b@0@ PN<.RF`|0`>N;J`Sy.N;`Sy>NT`Uy>NT` n f.N;` .N;Ry`0D"|./<N;X`x> n?(?aX``0G~g n>`>NO`80G~g n>`>NO` lg0,|0f mg 0-|0g >NO`>NO`и|gJng0 @"|0H=@`0 @"|0H=@0n"|0.N;`v|f ` &@ n +fR>/ NLjX`, n -fR>/ NLjX`>/ NLjX`>NRN` >NRN`>WNRN`>WNRN`>?</ NP\`ȸ|f>`>?-/ NP\`|f>`>?,/ NP\`JL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|7*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y8 (G8 .N|f3 7387p`>Bg/ N\ JL0N^NuNVH>N*@ fp`vJnfB@`j-g3 7387p`L0|g>/. / N*P`0-g>/. / N"P``>/. / N$bPJL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ N'|g37387p`U -"- S¼nB>!/</ 4/./ N'|g37387p`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ N'|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ N'|g37387p` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// N'|g37387p`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4N0PnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// N'|g37387p`xU+|Rn neB@0.H=@>"B0.//. B0.// N'ng37387p`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// N'|g37387p``>/. / 4N0PU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N-=@=|`.?<NT n!n 0 oB@096|`f noR96g op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(96g098r `=@` 098@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?N-TJng.?<,NT .N^NuNVB?< NT386B@096`tyd6`~B?<NT098`$y6y@6`,y6y6`|"gް|1gа| g|1g`a*`$y6```H |6rW hNN^NuNVB?<DNT y8gJy8gy6B@``pN^NuNVh=|rBnp n(g -|+t` n(g-|+t n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м8"-@(nBG./ N.XJg37387p`J,g nl nf,>?/ RNXJ@g37387p` n(H>N-< nf.?<NT nf n(g,.?.NT>> n(H?N-T ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHм70 @g H|`HRSGJgJGfJL0N^NuNVH *nSn|f `|f ` .&@ nH=@R=|.g n f=|`=|`.g=|.g:`:..gj S=g>/<N8X&k.N'Jg@&k kg0+|0fB@`pJ@f .g.BgBg?<?<$N9P&@|>?./ N\=@ nf.g nl.?W?.NPX`.g<.`ng|g nlJno|f4BW?./ NG.\"n2)An>?./ NG.\|o8|fFBW?./ NG.\"n2An,>?./ NG.\|n0.|=@<.RF`.?.W?.NPX`|f -` ,&@.N'&@ g SCfJkg BW/ NLjX`P0`RC>/<N;X`|g|g|*gذ|-g``||)b@0@ PN nH80RJ@fJCgN n fF nl> mg lf>?.?./<N;P`>/<6N;X0.JL8N^NuNV n g n f0.`.AN;`.HN;`.ON;`t.WN;`d.^N;`V.eN;`H.mN;`:.uN;`,>/<|N8X``S@|5b@0@ PN`\0.`@.N;`H.N;`:.N;`,>/<N8X``H |hrW hNN^NuNVH n>0|8mB`0G~g(n` n(h0G~(fB@`p<g n&h 0T"|~00|gz|gp0S"|~00|fZ n gR n gJ n gB l hf|f0 n!l>?. /.a,\*@ g ` n!L`V0S"|~00|gB k hf|f0 n!k >?. /.a\*@ g ` n!K 0. `:=|`H=|`@=|`8=|`0> /<N8XB`v`S@|b@0@ PN0n2Ҽ0H=@fB`<0n*P`$>/ a.XJ@gJFg>/ aXJ@g `PJUfBJL8N^NuNVH n0(n n. g n P=gB@`8. | n>(0|0| f||gB@`p<g|fp`0>BE n0` n hnRE``|Cg|Dg|Og0`n|gB@`p`t|fp`h|gJEfB@`p`T0`P|g 0|0fB@`p`:| gB@`p`,>/<N8XB@``S@| b@0@ PNJLN^NuNVH 0. |=@ n:0E~(g n*h n(h `0E"|~00|@@f n*h0` n (l n (n><` n (8|Cf n8(JDfBG`4|f><`(|m |n><`|m |n><`><`>?. / a\>>?. / a\8Do0`0>| o0`0< >`H>?. / a\>`2><`* n hg><` n hl><`><`>?. / a\>?. / av\>< `>?. / a^\>0E~(gl|n >?. / a2\8Do0`0>`2>?. RW/ a\<|o n o| o0`0< >| l0< `0>`|n| l0< `0> n h f>< ``|(|'b<@0@ PNJng n1G0JL0N^NuNVH>N:*@:E;n;|;n ;|+n ;n;n JL N^NuNVH n>0`8 n hg n hf$. n?( n?(a X*@`4BWBg n/( n?( n?(N~ *@ n;h n+h n;h ` n> n?(N:T` n. n?(N:0T` n. n?(N:\T`p n. n?(N:0T*@:N `LBWBgB?< n?(N~ *@|Gf. g:G`|Ff . g:F n;h `. f> n/(a~X``. f> n/(a^X`0G~g$. f> n/(a0X`n ./<BgBg n?(?N9 *@0G~(g> n/( aX+@ > n/(aX+@ ``H |:r W h,NJL N^NuNVH n P#N;J n*( n>( n<( n0`Z. g>/<N;X`>/<%N;X`D. g>/<+N;X`>/<2N;X`. g >#N;J n>/<8N;X`. g >#N;J n.a`JgT n0(`4./<;N;X`8./<@N;X`&.DN8``U@| b@0@ PN n0(`>/<`N;X`>/<dN;X`./<jN;X`>/./<pN;P`>/<{N;X`>?/<N;\`./<N;X n>?/<N;\ n>ah>)N;J`V./<N;X`D n-h .a~`0 n>/<N8X``U@| b@0@ PN`> n0P"|./<N8X``|C| b@0@ PNJLN^NuNVHBG ."N4G@RG .-@ <Jf>$N;J`"6pH<| m>WW`>W0N;JSGlJLN^NuNV n g ng 0.|0g.N;` nf .N;N^N>NN^NuNVHBG`0м5.N*RG|mJLN^NuNVH*n0-|g*.N-g .NpB@H+@+@Bm m>NJL N^NuNVH>.>N*@ f3 7387p`BF0|f-g6-f. - l>B?N\>/<3y?N!\-g,>"/</ 4/-/ N'|g|-H>N-:.?<NT||f|>-H?N-T>N>NLJFf0``37387pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?N!\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N\Bm +mB@JL N^NuNVHN>|fp`>N0*@8"Jn fUJnfU.3o/.N1XJ@f U0``.3t/.N1XJ@fU0`d>/.?N,j\J@g>NL37387p`0U>B-H?N\BWB-H?N\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N*@ f3 7387p`v0.`F+n `P . ѭ`F>NR+@ - Ю +@`*37387p`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>N*@ fp`^0|gB`P-g +m `0-H>N-<.?<#NT>-H?N-T <0.-0S-gJmʾg-gF>"/</ 4/-/ N'|g37387p`U>!/</ 4// N'|g37387p`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. Nb\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng < p` <!&#8.8?<?< // N Jngp`pH`RnJng < p` <!&#8.8Bg?< // N Jngp`pH`zRnJng < p` <!&#8.8Bg?<// N Jngp`pH`&RnJng < p` <!&#8.8Bg?<// N Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// N X|`XH>?// N$ X|`4.H?NTRn``|C|5b@0@5 PN.N1n:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NTRRn`..H?NTRn0.SnJ@n.?/.Nb\n`..H?NTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?N!\Gg lp`*B@`&`.H?NT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NTJL N^NuNVH. *n BF:-fp`$JfV-fN>N+@+@fm`2m>NfJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N!\<Bm `n-g>< g -мb" -:>/-?N!\<+mBm `( -:>/-?N!\<;| +mFg mp`H|JL N^NuNVH>N*@ fB@`-fB@`pJL N^NuNVH>N*@ fB@`0|JL N^NuNV>aJ@g <3o`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y6*T`ZB@0-BA2-@F@J@g>NB`:B@0-ne `*6f>a*@ f>NB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#6 PJL0N^NuNVH >.|?GG0@>N!*@fB`* R*@(M9GB@0,F@9@.Pa 96JL0N^NuNVH *nQB@0-BA2-@F@J@g>Np`(y6һeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #6B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#6B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXNuNV ng0.|0f n f .N;N^NuNV nlf n hgZ n0(|0fL n g 0. |0g: n hf>?.?./<N;P`>/<N;XN^NuNV./<N;X n l nm n>a,` n>a>?. /<N;\N^NuNV0.n g. ?. ?./<aPN^NuNVHJyfD. N; n h>al n h > n h?(/<N;\`( n h > n h?( n h?(a XJLN^NuNV.N;>a> /<#N;X..N;>a> /<2N;X n g ng 0.|0g> ?. /<=N;\`6 nf> ?. /<VN;\`> ?. /<oN;\N^NuNV0.||o .N8>/<N;XN^NuNV nm,.N; n >aB>/<N;X`*.N; n >a>/<N;XN^NuNV.N; n >aJng.`.?./<N;\N^NuNVJng n gJnf n gB@`v n PfF n PCf< n hf0 n h hl n h hf n h hgB@` > n h?(/<N;\pN^NuNVH>N:*@:E;n;n BmB ./. N:X JL N^NuNVJno nn>/<N;X`Jno>/<N;XN^NuNVH*n ;|A+HJnfB@`p=@>?</.NV\:JL N^NuNVH*n Jmn,A+H>/-?Ns\|gNV;| m RSm. HJL N^NuNVH*n .0.@?WaT.?.WaxT0.JL N^NuNV. n?aTN^NuNVH*n><m;|A+H>/-?Ns\GgNVB@JL N^NuNVH*n BmJnfB@`p=@>Bg/.NV\:JL N^NuNVH*nJmnA+H>/-?N[\;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.Nc\N^NuNV>?. /.N`j\N^NuNV./<NZX>NajN^NuNVH BWNsv##By.a>*n`v`RJgHHм @fJgZ "g 'fFH>/ RNX(@ f./ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHм @gJ5pg M2GBRGH`BWNb BW/ RNdXJ@g.R/<.aX`>Nb ->f@>/ TNdX|f>B?<Ne\|f.R/<;aX`$BW/ RNa8X|g.R/<Ja~X`.a`|gr`JfBaSy.N|f.h/<Ya*XB/9?9N2\>NajJL0N^NuNV|./NX. /N\X.i/N\X.?< NT>NajN^NuNVH*n y XRyJL N^NuNVN^NuNVN^NuNV.nNZnN^NuNV.nNZnN^NuNV.nNZnN^NuNV.nNZnN^NuNVHNtBW/<NdX>/<NdX>/<NdX n2n B*n`&HHм @g H| `HRJf> /.NVXJL N^NuNV4./8NX./8N\X./8N\X.8?< NT>NN^NuNV. /./<NgPN^NuNV./. /.NgPN^NuNVH>Nur*@ fp`-gB@`t-g3 3p`T-g>/. / N_\P`8-gB0../. / N[P``B0../. / N] PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ Nz|g33p`U>!/</ 4/./ Nz|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ Nz|g33p`U>!/</ 4/./ Nz|g33p`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ NzH,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ Nz|g33p`fU>!/</ 4/./ Nz|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .NZn ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT`3VBN3F`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#8"h#8 E?/ NLN o AdpNu#8 BNuNV0/"/ NB8 d0< A3V"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVH~ nm~`0G #3>Bg/93N\33l.3/<3N JXN>/<3z?93N \<|g.3/<4N JXN y`3zg$ y`3zg.3/<4N JXN.3/<4.N JX 93|й3й3-@.3|at.5 ?<+NT.3aX.5 ?<+NT.3a<.5 ?<=NT.a".42N J.a.45N J.3a.5 ?< NT y`3zfb>/Y?93N \.4GN J.aN>/Y?93N \.4SN J.a&.5 ?< NTRGnmJLN^NuNVH*|3B%BG`0 .<| l|0`|7 .-@JgRG|m./<4`N JXJL N^NuNVH*|3B%BG`8/< /.N2P<|0/< /.N2P-@JgRG| m./<4cN JXJL N^NuNV>?. /.NN\N^NuNVN^NuNVH|BG` 4ff 4f0`RG|m37387pJLN^NuNVp2.`F@H4fB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@8"0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 7387B`0B@0*@8"-f3 7387B` JL N^NuNVH BWN!#8#8By8.3ea>*n`v`RJgHHм70 @fJgZ "g 'fFH>/ RNX(@ f.4j/ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHм70 @gJ5pg M2GBRGH`BWNBW/ RNZXJ@g.R/<4|aX`>N ->f@>/ TNZX|f>B?<N\|f.R/<4aX`$BW/ RNX|g.R/<4a~X`.a`|gr`JfBaSy8.8N|f.4/<4a*XB/98?98N\>NJL0N^NuNV|./N1LX. /N1"X.4/N1"X.?< NT>NN^NuNVH*n y8 X8Ry8JL N^NuNVN^NuNVN^NuNV.4NN^NuNV.4NN^NuNV.4NN^NuNV.4NN^NuNVHNhBW/<3oNBX>/<3oNBX>/<3oNBX n2n B*n`&HHм70 @g H| `HRJf> /.NZXJL N^NuNV4.4/8N1LX./8N1"X.4/8N1"X.8?< NT>NN^NuNV. /./<5 NPN^NuNV./. /.NPN^NuNVH>N*@ fp`-gB@`t-g3 7387p`T-g>/. / N P`8-gB0../. / N 4P``B0../. / N PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ N'|g37387p`U>!/</ 4/./ N'|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ N'|g37387p`U>!/</ 4/./ N'|g37387p`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ N'H,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ N'|g37387p`fU>!/</ 4/./ N'|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .5 N ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN>|fp`>N0*@8"JnfU.3o/.N1XJ@f U0`R`.3t/.N1XJ@fU0`2>/.?N,j\J@g3#7387p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNV.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHNt|>|fp`>Nu0*@JnfU./.NXJ@f U0`R`./.NXJ@fU0`2>/.?N\J@g3#3p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVNa>NN^NuNVHBG`0м.NaRG|mJLN^NuNVH*n0-|g*.Nc>-g .NpRB@H+@+@Bm m>Nb JL N^NuNVH>.>Nur*@ f3 3p`BF0|f-g6-f. - l>B?Ne\>/<?Ns\-g,>"/</ 4/-/ Nz|g|-H>N:.?<NT||f|>-H?NT>Nu>NtJFf0``33pJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?Ns\>Gg mp`J-gJg-g;| `;| `>0- D@H/?Ne\Bm +mB@JL N^NuNVHNt|>|fp`>Nu0*@Jn fUJnfU./.NXJ@f U0``./.NXJ@fU0`d>/.?N\J@g>Nt33p`0U>B-H?Ne\BWB-H?Ne\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>Nur*@ f3 3p`v0.`F+n `P . ѭ`F>Ne+@ - Ю +@`*33p`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>Nur*@ fp`^0|gB`P-g +m `0-H>N<.?<#NT>-H?NT <0.-0S-gJmʾg-gF>"/</ 4/-/ Nz|g33p`U>!/</ 4// Nz|g33p`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVHK;| .+@+@;|:./. / NgP>.BgNlT0JL N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. NlD\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <rR` <s#.?<?< // Nq Jngp`pH`RnJng <rR` <s#.Bg?< // Nq Jngp`pH`zRnJng <rR` <s#.Bg?<// Nq Jngp`pH`&RnJng <rR` <s#.Bg?<// Nq Jngp`pH`-M n-PX`-M n0|@B.T`H>?// NY X|`~H>?// NY X|`XH>?// NY X|`4.H?NlTRn``|C|5b@0@ PN.N:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NlTRRn`..H?NlTRn0.SnJ@n.?/.NlD\n`..H?NlTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?Ns\Gg lp`*B@`&`.H?NlT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NlTJL N^NuNVH. *n BF:-fp`$JfV-fN>Nn+@+@fm`2m>NnHJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?Ns\<Bm `n-g>< g -мb" -:>/-?Ns\<+mBm `( -:>/-?Ns\<;| +mFg mp`H|JL N^NuNVH>Nur*@ fB@`-fB@`pJL N^NuNVH>Nur*@ fB@`0|JL N^NuNV>aJ@g <`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y*T`ZB@0-BA2-@F@J@g>NqB`:B@0-ne `*f>a*@ f>NqB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@# PJL0N^NuNVH >.|?GG0@>Nsv*@fB`* R*@(M9GB@0,F@9@.Pa 9JL0N^NuNVH *nQB@0-BA2-@F@J@g>Nqp`(yeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|f*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y(G.N|f3 3p`>Bg/ N\ JL0N^NuNVH>Nur*@ fp`vJnfB@`j-g3 3p`L0|g>/. / N}TP`0-g>/. / NuP``>/. / NwPJL N^NuNVH|BG` f 0`RG|m33pJLN^NuNVp2.`F@HB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 3B`0B@0*@-f3 3B` JL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ Nz|g33p`U -"- S¼nB>!/</ 4/./ Nz|g33p`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ Nz|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ Nz|g33p` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// Nz|g33p`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4NPnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// Nz|g33p`xU+|Rn neB@0.H=@>"B0.//. B0.// Nzng33p`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// Nz|g33p``>/. / 4NPU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N=@=|`.?<NT n!n 0 oB@09|`f noR9g op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(9g09r `=@` 09@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?NTJng.?<,NT .N^NuNVB?< NT3B@09`tyd`~B?<NT09`$yy@`,yy`|"gް|1gа| g|1g`a*`$y```H |rW hNN^NuNVB?<DNT ygJygyB@``pN^NuNVh=|rBnp n(g -|t` n(g-|~t n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м-@(nBG./ NLXJg33p`J,g nl nf,>?/ RNXJ@g33p` n(H>N< nf.?<NT nf n(g,.?.NT>> n(H?NT ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHм @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9NXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHм @fJg.HHм @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH?BCB..,. f# <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD# D`# JLN^NuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNV/. /.NH 9N^NuNVH..,. Jf#f <`Hc #fB`:fzB`(xe 〼b`BJge`#f JLN^NuJg .NuStack Overflow$C runtimeCON:LST:.dc.l .dcinvalid initialization*line %d ~_lN%d: <CDEOjj *rN t  ~ Z hhhh t  ~ Z h  h h4hhhhhhhhhhhhhhhhhhhhhhh XXXXXvvX|xjZb(:J^hpdlbjjvalue assigned to char truncatedvalue assigned to char truncateddivide by zeromodulus by zero+,-2<E! <!!0!0!0!0!0!0!0!0!0!0!0, ("b >?BC+++,J+P,~//.../ / / / / //00.//000/////010101011122222move sr,R%d move ccr,R%d move R%d,ccr function existence testmove.l #,-(sp) tst.l (sp)+ addaddno code table for %sillegal structure operationmove.l r%d,r%d move.l r%d,r%d move #%d,r%d L%d:move (r%d)+,(r%d)+ dbra r%d,L%d bra L%d L%d:L%d:bra L%d L%d:L%d:bra L%d bra L%d L%d:%s L%d cdsize: invalid type %dstructure operation not implementedr'DLTadfglt333333333336656n6n6n6n6>6>6n6n6n6* .0123456789ABCDEFabcdef7V7V7Z7Z7Z7Z7Z7Z7Z7Z7Z7Z7r7r7r7r7r7r7f7f7f7f7f7f7~ .0123456789ABCDEFabcdef8777777777777777777777778@(#)main.c 1.7 12/28/83c168can't open %scan't open %scan't create %searly termination of link fileintermediate code error %c,%dintermediate code error - %c,%dintermediate code error - %c,%d"%s", ** %d: "%s", ** %d: (warning) (warning) expression too complexusage: %s icode link asm [-Tav] ,- +, , , , , ,() ,     , , , , ,()   "" 00  () , ()   z z      , , ,  (),  (),  (),              " " " , ,  (),            #1, _fpltof D0,  (), D0,() #1, _fpltof D0, -, D0,+ -, ,+  (), ,()  $  X            , , ,  , (), ,()  , ,() ,()  , ,() (  < < <<  <Hjjjj j           () , , , , , , , , , , , ,  ,  , ,()  (), ,  ,()  (),()  ,()  V V \hhh hh h h  hp p (       ,  ,  ,       >>   , , , ,  , ,  , , ,  ,  ,       (>> H H H H V jj  x   ,  ,  ..  8 , ,  , ,  H H H H  dv ,  ,         , (),  ,  , ,  ,  ,      " , :  FR ` r  , , , ,  , (), (), (), ,  ,  ,  ,  ,  ,  ,     . > N b p|    r  ,  (), ,   ,    "  > 4 N b NR   ` r  ,- +, -, , ,+ -, , ,+ -, , ,+  , (), ,  -, (), ,+  -, (), ,+  , -,  , ,+ -,  , ,+ -,  , ,+  , , ,  -, , ,+  -, , ,+ , , ,  -, , ,+  (), , ,()  ,() (),  (), , ,()  (), , ,()  (), , ,()  (), , ,()  (), , ,()  (), , ,()  (), ,()  (), ,  ,()  (), , ,()  (), , ,() ,  (), , ,()  (), , ,()  $  X  ,,,,Fff         00NNNj j           F F j   8` (), ,  (), ,()  -, (), ,+ -, , ,+  (), , ,() , , ,  , ,()  , ,()  , ,()  h h hh  <hhhh<<< <         $ <<  0 F \,f    0Nj  F  ` , h:: -, , ,+ , , b~ , swap , swap b -, , ,+ -, , ,+ -,  , ,+ -, , ,+  -, , ,+  -, , ,+  (), , ,() b  :X r       ,- +,  , ,() (),   6 6 66 JJ JJ , ,  hh  < < <<     h< 0 - +,  () (), -, , ,+ -, , ,+  -, , ,+  -, , ,+  (), , ,()  (), , ,()  (), , ,()  (), , ,()  Z j      (( LL LL  () ,    hh  & & , ,  h n z   , , , , ,        z          ,   |and #$ff,       (), , , , , ,   >  V V V \ \ \    hhhhh   >>>> H H H H V jj  x   ,  ,()       - +,  ,  () (),  , ,()         &  ()   x x ~ ~and #$ff,      ,  !%).38=AEIMQTX\`eimqv|rN0B(Dlj0@ ,lDB`        &'(    ((  *! #"%$)%$ #!"#"! "# !addincsubdecmulsmuludivsdivuasrlsrasllslandoreornegnotmoveclrcmptstlmul_ldivlremalmulaldivalrembeqbnebgtbgebltbleblsblobccbhijmp*nopbtstmovemove.ljsrclrclr.lext.wext.llea(sp)INVALID<>@BDFILNPRTWY]aeiknqtwz~ "-47:=@BDFKQX\`elux}+-*/%>><<&|^!U-~--p++pp--p++=+=-=*=/=%=>>=<<=&=|=^=jsr==!=>>=<<=int->longlong->intbtstloadlong*long/long%long*=long/=long%==addr=not=negdocastst=long->floatfloat->longint->floatfloat->inttocharU&U*&&||?:,cintclongsymbol++aa--callcall()bitfieldifinitloadR0divlong======D=D=D=D=D=D=D=D=D=D=D=D=D===============X=X=X=X???AA>>?R?`?l?~> >>\>4>>B?????==d===X=zBCCC.CtCtCtCtCtCtCtC<CtCBCBCtBCCC.CtCtCtCtCtCtCtCfCfCfCfCfCfCtCtCtCtCtCtCtCtCtCtCtCtC<CtCtCXCJCXCJ()*CCCCCCCELETE\EdE\FFFFFFFFFFFF(sp)+(sp)-(sp)%scode skeleton error: %d swap R%d swap R%d clr R%d swap R%d ext.l R%d _fpadd_fpsub_fpmult_fpdiv_fpneg_fpftol_fpltof_fpcmpinvalid floating point op %d lmulldivlremopcall bad op %dmatch cookie=%d skelmatch type: %xHHHHHHHHHHHHHHHHHHHHHRHHHHHHGGHpHhHhHHHHHHHhHhOOPPP N NKJJ$ $ """""".....LLMMMM@@@@@@@"@"  $IH G GE@@@@@R@@"Q@RR RCDEFGNOKKKlKlJJJKKJJKMMjMjM|MjMjMMMMMMN"MNN6NLNNNMM:M\LLNNNNNNM:M:(R%d)+(R%d)-(R%d)(R%d)%d%ld+%ldinvalid register expressionR%d(R%d)_%.8s_%.8s(R%d)L%dL%d(R%d)%ld(R%d,R%d%ldinvalid storage class %d invalid operator %s .l.b.lswap R%d clr R%d swap R%d ext.l R%d %s R%d,R%d movecmpm (R%d)+,(R%d)+ move (R%d),R0 cmp (R%d),R0 addq #4,R%d addq #4,R%d addq #1,R%d addq #1,R%d addq #2,R%d addq #2,R%d expression too complexR%dcmp #0,R%d tst R%d move R%d,%s -(sp)(sp)dbra R%d,L%d addq.l #%d,sp adda.l #%d,sp Write error on output file : unmatched quoteCannot open Cannot append Cannot create Stack Overflow $rfloating pointC RTL - program not linked for Program terminating $Raw I/O   jiVjjk kDkDkDkDkDkDkDjkDkDkDjkDikDkDjTkDkDkDkDkDkDkDkDkDkDjiZjjk kDkDkDkDkDkDkDjkDkDkDjkDikDkDjX||"1001 "0"||||||||<>.,=:|[]* "yLBCCbNC NNVH..,. Jf#K <`Hc #KB`:fzB`(xe 〼b`BJge`#K JLN^NuJg .NuStack Overflow$C runtimeCON:LST:eFDFERd>xr-w-@x- r-w-x-r-w-x-EEEEEFFFFar68.tmpusage: ar68 drtwx[abiv][f d:] [opmod] archive obmod1 [obmod2] ... [>filespec] invalid option flag: %c one and only one of drtwx flags required only one of abi flags allowed cannot create %s temp file write error seek error on %s Unable to re-create %s -- archive is in %s Read error on %s Write error on %s Cannot Create %s not archive format: %s %d/%d %6ld %.14s cannot open %s %s not in library cannot open %s not object file: %s cannot reopen %s cannot create %s std outputseek error on library write error on %s read error on %s %s not in archive file Hfloating pointC RTL - program not linked for Program terminating $Raw I/O: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $    $#H$$%%6%6%6%6%6%6%6#%6%6%6$%6#%6%6$F%6%6%6%6%6%6%6%6%6%6$#L$$%%6%6%6%6%6%6%6#%6%6%6$%6#%6%6$JJJ"1001 "0"66666666KZ<>.,=:|[]* !!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321!!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321`r --@ -g-gF>"/</ 4/-/ N4|g3KR3LFKTp`U -"- S¼nB>!/</ 4/./ N4|g3KR3LFKTp`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ N4|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ N4|g3KR3LFKTp` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// N4|g3KR3LFKTp`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4N=PnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// N4|g3KR3LFKTp`xU+|Rn neB@0.H=@>"B0.//. B0.// N4ng3KR3LFKTp`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// N4|g3KR3LFKTp``>/. / 4N=PU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N:=@=|`.?<NT n!n 0 oB@09K|`f noR9Kg op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(9Kg09LFr `=@` 09LF@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?N;TJng.?<,NT .N^NuNVB?< NT3LFKB@09K`tydK`~B?<NT09LF`$yKy@K`,yKyK`|"gް|1gа| g|1g`a*`$yK```H |KrW hNN^NuNVB?<DNT yLFgJyLFgyKB@``pN^NuNVh=|rBnp n(g -|8t` n(g-|8t n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.мLZ-@(nBG./ N;>XJg3KR3LFKTp`J,g nl nf,>?/ RNXJ@g3KR3LFKTp` n(H>N:< nf.?<NT nf n(g,.?.NT>> n(H?N;T ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHмKh @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9KVNXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHмKh @fJg.HHмKh @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH?BCB..,. f#LV <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#LV D`#LV JLN^Nu _B0Zg|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>N/d*@ fp`^0|gB`P-g +m `0-H>N:<.?<#NT>-H?N;T <0.-0S-gJmʾg-gF>"/</ 4/-/ N4|g3KR3LFKTp`U>!/</ 4// N4|g3KR3LFKTp`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N&6\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <,D` <,#LR.LR?<?< // N+ Jngp`pH`RnJng <,D` <,#LR.LRBg?< // N+ Jngp`pH`zRnJng <,D` <,#LR.LRBg?<// N+ Jngp`pH`&RnJng <,D` <,#LR.LRBg?<// N+ Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// N X|`XH>?// N X|`4.H?N&TRn``|C|5b@0@J& PN.N>:ElJFm:0.E=@JnfX .0f* n -f SE. nH?N&TRRn`..H?N&TRn0.SnJ@n.?/.N&6\n`..H?N&TRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?N-\Gg lp`*B@`&`.H?N&T|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?N&TJL N^NuNVH. *n BF:-fp`$JfV-fN>N(+@+@fm`2m>N(:J@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N-\<Bm `n-g>< g -мb" -:>/-?N-\<+mBm `( -:>/-?N-\<;| +mFg mp`H|JL N^NuNVH>N/d*@ fB@`-fB@`pJL N^NuNVH>N/d*@ fB@`0|JL N^NuNV>aJ@g <@`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (yK*T`ZB@0-BA2-@F@J@g>N+B`:B@0-ne `*Kf>a*@ f>N+B`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#K PJL0N^NuNVH >.|?GG0@>N-h*@fB`* R*@(M9GB@0,F@9@.Pa 9KJL0N^NuNVH *nQB@0-BA2-@F@J@g>N+p`(yKeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #KB@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#KB@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|K*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*yLB(GLB.N|f3 KR3LFKTp`>Bg/ N\ JL0N^NuNVH>N/d*@ fp`vJnfB@`j-g3 KR3LFKTp`L0|g>/. / N7FP`0-g>/. / N/P``>/. / N1PJL N^NuNVH|BG` K f K 0`RG|m3KR3LFKTpJLN^NuNVp2.`F@HK B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@LZ0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 KR3LFKTB`0B@0*@LZ-f3 KR3LFKTB` JL N^NuNVH*n(n >.B0-@B/8N>NX.8?< NT>NN^NuNV. /./<ITN!PN^NuNV./. /.N!PN^NuNVH>N/d*@ fp`-gB@`t-g3 KR3LFKTp`T-g>/. / NP`8-gB0../. / NP``B0../. / NNPJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ N4|g3KR3LFKTp`U>!/</ 4/./ N4|gU .`+n&M -|H4`FS .fU  - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ N4|g3KR3LFKTp`U>!/</ 4/./ N4|g3KR3LFKTp`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ N4H,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ N4|g3KR3LFKTp`fU>!/</ 4/./ N4|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .HN ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN.n>lp`&>N.>/.?N9\<>N.0JLN^NuNVH BWN-h#LJ#LNByLH.@a*n`N`RJgHHмKh @fJg2 "g 'fFH>/ RNX(@ f.H/ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHмKh @gJ5pg M2GBRGH`BWNVBW/ RN.XJ@g.R/<HaX`l>NV ->f@>/ TN.X|f>B?<N`\|f.R/<I a|X`$BW/ RNX|g.R/<IaVX`>?/ NXJf>*/ NXJg-|Nv.4?<NT>/ ?<N9\<f.I'/ aX`^.H?/.aZ\.N>>RWN?(@./ N>xX.a>/ ?<N9\<f`.a`|g`JfBaSyLH.LNN|f.IA/<I2a*XB/9LJ?9LHN\>NJL0N^NuNV|./N>xX. /N>NX.IB/N>NX.?< NT>NN^NuNVH*n yLN XLNRyLHJL N^NuNVH*n. (nBBnG4H@HJ-g4-HS@=@ n m10.H H@|0:=|J-gJngS-H|`:=|`T K2n  gB0n3H|HмKh @g0n3H|| `0n3H|Rn n m.=| `T K2n  gB0n3H|HмKh @g0n3H|| `0n3H|Rn n mBJL8N^NuNVHN.n>|fp`>N.0*@LZJnfU.@/.N>XJ@f U0`R`.@/.N>XJ@fU0`2>/.?N9\J@g3#KR3LFKTp`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN>NN^NuNVHBG`0мIF.NRG|mJLN^NuNVH*n0-|g*.N-g .N*DB@H+@+@Bm m>NVJL N^NuNVH>.>N/d*@ f3 KR3LFKTp`BF0|f-g6-f. - l>B?N`\>/<@?N-\-g,>"/</ 4/-/ N4|g|-H>N::.?<NT||f|>-H?N;T>N.>N.JFf0``3KR3LFKTpJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?N-\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N`\Bm +mB@JL N^NuNVHN.n>|fp`>N.0*@LZJn fUJnfU.@/.N>XJ@f U0``.@/.N>XJ@fU0`d>/.?N9\J@g>N.3KR3LFKTp`0U>B-H?N`\BWB-H?N`\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N/d*@ f3 KR3LFKTp`v0.`F+n `P . ѭ`F>N &+@ - Ю +@`*3KR3LFKTp`*`J@g|`@ \BN@`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#L>"h#LBE?/ NN o AdpNu#LBBNuNV0/"/ NBLBd0< A@"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVH nl.FNa .a&n X*[>.WG`H`RyB#zCl`RyC#C SG`RyB# Cl`xRyB# BCl`dRyB#Cl`RRyB# Cl`@RyB`8#Cd`0%H>/<Fa Xa`|a|b@0@Cp PNJfD09ByB3B09ByByByB|g.Fa a09CyC3C yCo.Fa a.Cd/<CN>NX.Ch/<CN>NX#C>B/9Ca8X3CJGfJyBgaNa?</<CN\3Cl.C/<Fa \Xa>/<B?9CN-\|g.Ga .a`.aJSGJGfBa>JyBf>B?9CN`\*BWB?9CN`\,Jl.C/<G(NX>N>CNV.CN>?</9CN\3CJyCl$.C/9C/<G:NP>N~`o <` >>/<@?9CNX\>JGl .C/<GfNX>N`/<@?9CN-\Gg.C/<GxNX>N0HJGoJnfB>/Y?9CN-\>CNV.CNa,JL8N^NuNVH>?</.N\>lD3B>?</.N\>l .C/<GNX>N`0`6>/U?NX\|f neg./<GaXa0JLN^NuNVH*n g -:fT gVJyC fN`<.B/ a.XJ@f:JyCg.B/9C aXJ@g`>BazJyBfa4J@f/. yClNXJL N^NuNVH JfaJyBg2>Ba.B9BH?9BH?/<GNPaBWaJL0N^NuNV.B/<GNXN^NuNVHJf.JyCgJyBf|>/?9CN`\a&`B>Bg/.N\=@l./<GarXaJyBgJyCg.C /<GaLXa09CyCgJyC fJyCg>a$RyC n (:f .T` .*@>/<B/ aHP09ByCg >aa` JyCg >ia`>raBWa*|@BBB9BB9B3B./Ua>X#B.C/.?<?9C?.a >NVJL N^NuNVH n>NV>/<C/. N PJ@l. /<GaXKBF`.CN4:RF|m>CNV n`g. /<GaX..ޮJnfއޮ>Bg/. N\? n0l. /<HaX޼/</VN?:P. JL N^NuNVn n n n .N^NuNVn nN^NuNVJfa`>da2BWaN^NuNVH.aJ@fX>/.NX>l./<H#aXat>xa./9C?<??9CaZ >NVJLN^NuNV.a\J@f$.H5/9C?<?<?9Ca N^NuNVNN^NuNV`>aaJ@fN^NuNV>/<B?9CNX\|fJ9Bf RyBB@`pN^NuNVHJyBfj.9BgRJng0>ca.C/9C?<?9C?9Ca^ `&>/?9CN`\Jl.H@aa(JLN^NuNVH *n(n `Jfp` HgB@JL0N^NuNVH*|F ` >/aXFDeJL N^NuNVH*n<. >`TSGm0]g.IT?N&TJL N^NuNVJyBg,.IT. H?N&T.IT?< N&TaN^NuNVH *n(n >.`gSGJGf`BSGnJL0N^NuNV`>anJyBfa(J@fN^NuNVH8. g0>/<B?. N-\|g./<HWaXa*9B`V>/<@?.NX\>|g./<HjaXa~>/<@?. N-\|g`nJoN>>/<@?.NX\<Gfgg 0G@BRG>/<@?. N-\Gf6gg>/<@?.NX\JLN^NuNVJfaJyBg./<H|a Xp`B@N^NuNV>?.?.?. ?. ?.N JyCg>CNV.CNNN^NuNVH*n BmJnfB@`p=@>Bg/.N\:JL N^NuNVH*nJmnA+H>/-?NX\;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.N"\N^NuNV>?. /.N\N^NuNVN^NuNV.HNN^NuNV.HNN^NuNV.HNN^NuNV.HNN^NuNVHN.BW/<@NX>/<@NX>/<@NX n2n B*n`&HHмKh @g H| `HRJf> /.NXJL N^NuNV4.H/8N>xX./8N>NX.H  !!""##$$?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHм< @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH..,. Jf#=& <`Hc #=&B`:fzB`(xe 〼b`BJge`#=& JLN^NuJg .NuStack Overflow$C runtimeCON:LST:Usage: nm68 objectfile %8lx equ global reg external data text bss absunable to open %s read error on file: %s file format error: %s 7Write error on output file : unmatched quoteCannot open Cannot append Cannot create Stack Overflow $:6floating pointC RTL - program not linked for Program terminating $Raw I/O   ,RvV,RvZ<@<@"1001 "0"++++++++<<>.,=:|[]* !!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321%% `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#.|?GG0@>N#*@fB`* R*@(M9GB@0,F@9@.Pa 9N".p`(y. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|=&*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*y=(G=.N|f3 <3=Bg/ N\ JL0N^NuNVH>N0*@ fp`vJnfB@`j-g3 <3=/. / N,RP`0-g>/. / N$P``>/. / N&PJL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ N)|g3<3=!/</ 4/./ N)|g3<3="/</ 4/./ N)|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ N)|g3<3=Bg/ 4N\`F>!/</ 4B0.// N)|g3<3=<nnc>.`|fBGJGc>/. B2.Ё/4N2PnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// N)|g3<3="B0.//. B0.// N)ng3<3=.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// N)|g3<3=/. / 4N2PU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N/=@=|`.?<NT n!n 0 oB@09 n(H?N0TJng.?<,NT .N^NuNVB?< NT3=0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м=-@(nBG./ N0JXJg3<3=?/ RNXJ@g3<3=N/< nf.?<NT nf n(g,.?.NT>> n(H?N0T ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.&&SJn - o+m .JL8N^NuNVH *n n(g .:N  ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN:>|fp`>N0*@=JnfU.4/.N3XJ@f U0`R`.4/.N3XJ@fU0`2>/.?N.\J@g3#<3=?. /.a\N^NuNVN0>NN^NuNVHBG`0м:.NbRG|mJLN^NuNVH*n0-|g*.N-g .N B@H+@+@Bm m>NJL N^NuNVH>.>N0*@ f3 <3=B?N\>/<4?N$6\-g,>"/</ 4/-/ N)|g|-H>N/:.?<NT||f|>-H?N0T>N>NJFf0``3<3=/-?N$6\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N\Bm +mB@JL N^NuNVHN:>|fp`>N0*@=Jn fUJnfU.4/.N3XJ@f U0``.4/.N3XJ@fU0`d>/.?N.\J@g>N3<3=B-H?N\BWB-H?N\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N0*@ f3 <3=N+@ - Ю +@`*3<3=B?.aB\N^NuNVH>N0*@ fp`^0|gB`P-g +m `0-H>N/<.?<#NT>-H?N0T <0.-0S-gJmʾg-gF>"/</ 4/-/ N)|g3<3=!/</ 4// N)|g3<3=?// N 4 X|`~H>?// N H X|`XH>?// N \ X|`4.H?N TRn``|C|5b@0@;h PN.N3:ElJFm:0.E=@JnfX .0f* n -f SE. nH?N TRRn`..H?N TRn0.SnJ@n.?/.N\n`..H?N TRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?N$6\Gg lp`*B@`&`.H?N T|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NPTJL N^NuNVH. *n BF:-fp`$JfV-fN>N+@+@fm`2m>NJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N$6\<Bm `n-g>< g -мb" -:>/-?N$6\<+mBm `( -:>/-?N$6\<;| +mFg mp`H|JL N^NuNVH>N0*@ fB@`-fB@`pJL N^NuNVH>N0*@ fB@`0|JL N^NuNV>aJ@g <4`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (yN".B`:B@0-ne `*a*@ f>N".B`(M*U`JL0N^NuNVH n*PB@0. X@me n''`4BN4`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#=|"h#=E?/ N N o AdpNu#=BNuNV0/"/ NB=d0< A4"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVH nl.7&N N37>N37~ n 2G.a097Hй4й4-@BW/.?95N\By5-y5By7$`Ry7$BG`,.5N,:|| lz .:?N TRG|m.:p H?N T.5N<.5N=@.5N=@./<7>N X>aJf^JLN^NuNVH>.g .7CN  g .7HN  g .7PN  g .7UN  g.7_N `4 g.7eN ` g.7kN ` .7pN .:p H?N TJLN^NuNVH*n>/<5/ NP35l./<7uN XN#7>/<4?95N \|g.7/<7N XNBy5BWB?95N\a JL N^NuNVH*|4BG`.5N:RG|m y`4g, y`4fPy7`.7/<7N XNJL N^NuNV y7n*>/ ?<N$6\|gp`b. H`ZJy7n6#77>/97?97N$6\|gN 37 y7 R7Sy7. HN^NuNVH><y737#77>/97?97N$6\GgN B@JLN^NuNVH*n BmJnfB@`p=@>Bg/.N\:JL N^NuNVH*nJmnA+H>/-?N \;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.N\N^NuNVH>.0JLN^NuNV.9/<:N X>NN^NuNVN^NuNVH|BG` 9f 90`RG|m3<3=aRG|mJLN^NuNVH 0.*@=0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 <3=*n`v`RJgHHм< @fJgZ "g 'fFH>/ RNX(@ f.9/ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHм< @gJ5pg M2GBRGH`BWNBW/ RNXJ@g.R/<9aX`>N ->f@>/ TNX|f>B?<N\|f.R/<9aX`$BW/ RNX|g.R/<:a~X`.a`|gr`JfBaSy=.=N|f.:,/<:a*XB/9=?9=N\>NJL0N^NuNV|./N3X. /N3ZX.:-/N3ZX.?< NT>NN^NuNVH*n y= X=Ry=JL N^NuNVN^NuNVN^NuNV.:2N N^NuNV.:2N N^NuNV.:2N N^NuNV.:2N N^NuNVHNBW/<4NzX>/<4NzX>/<4NzX n2n B*n`&HHм< @g H| `HRJf> /.NXJL N^NuNV4.:F/8N3X./8N3ZX.:f/8N3ZX.8?< NT>NN^NuNV. /./<:NPN^NuNV./. /.NPN^NuNVH>N0*@ fp`-gB@`t-g3 <3=/. / N P`8-gB0../. / N lP``B0../. / N PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ N)|g3<3=!/</ 4/./ N)|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ N)|g3<3=!/</ 4/./ N)|g3<3=!/./ /./ N)H,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ N)|g3<3=!/</ 4/./ N)|g U .`,+n߭G4`(`G&BN`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#|"h#ҀE?/ NN o AdpNu#ҀBNuNV0/"/ NBҀd0< A"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVHBy(>QNKJ@f <## =|Jy^gp`p=@>/Q/Y/Ua > n fBWNk0`$ n f 9+@+@JGf0-|0| g.NP2`&f, ng$0-|0| g. /<NRX0-|0| g"f.N) nfBWNk0`vBWNC 36|Yg4BWNC 36|Rg BWNC 36|Ef8 y~g,f ng. /<NRX.a `NB>BNKJ@g .Bg?.?.a\*y fBWNC |Qg .NP2JL N^NuNVHJnfJygBB@=@=@=@=@BBn n<ByBWNC >|Ef4 y~g(Bn3JnfJyg #~`|Yf309`jBy`xJy(g .NORy(`\JFg|g|g .NO|`:JFg|g .NO|`JFg|g .&NOJyخfp`p<`JFg|g| g|g .| g#`jJng .[NO=|`PJng .tNO=|`6Jng .NO=| ``S@|b@0@ PN`Rn`>NLJnf=|JFf|Jng, nf=|` n f=| ` .NOJng ng .NOJngT nf=|.NO`8 nf=|. NO` nf=|` .;NOJnfJy^g nf=| n0 n 0 n 0.JLN^NuNVH<9(By(B>9Ry>ENKJ@f$x.QNQ>/QNi X#~`BD 9~-@"n " nJ(f@ nJyRf n n|  n1| BNRd? n1_`$ n ( g. /<XNOXBy>RNKJ@g40yNT ֚J֚g y֚!|RyN0yN 0yNT :9By| f>`> a / n 3>SNKJ@f.lNP2`NJgH n0h"|XJg. /<NOX n0h()X"n 0yN 0yNT SyNfB֚`JDg.NO` n ( g. /<NOX` n0h"|XJf0yN"|TJgR0yN"|T p h f60yNT ֚J֚g y֚pH!@"y֚#@~ Ry$09$|m .NO0y$L ` n"n2iX 3( nJPg .NO|fp `0"n20JLN^NuNVHBWNC 36|QgBWNC 36|WfB`JyNgR>ANKJ@gDN!-@f> ?<NT  .??. NShXH-@`2BWaҁn Jn m Jg*y0. |0| fBm Jg>.\?-?. /9a @P=@ 0. || f y (+@+@`Z0. || f6+yJg.NRd;@`. /<NOX`0. || f;y$-H`` n g nf` ng n fz`0-|0| g`b0-n fX-Hng ng ng0-|0| f ngt nf0. |0| f=|`TJyخf. /<'NOX`. /<;NOX .`v`|b@0@H PN;n >. |00. |=@ Jy(gJyNg>ANKJ@gN=| N!-@09@H;@> .??. NShX<0F-HJFg .;@`0> ?-NT?-?-NVDX2HЁ-@n ;n | f> ng$ ng ng ng .ONO ng=|` ng nfJGfJ |2n g0yL"|J0f=|`0yL"|0H;@RyL`<0y"|J0g|g=|`0y"|0H;@Ry nf0>?-?-NVDXRyذ09ذD@;@` nf;yRy0.@JyRfJyRgF yخf< ng ng ng nf>/  ?.?. N$P .JL N^NuNVH RyR# *n>?-?--H??-NRT?NXP## .lNR. /. /<tNRP>9> a@3.Ry>RNKJ@f.NP2`XByذ|3خ3:(|h`*T: mfRE -f 9E|`Bl;E|0-|0|0f">?-NRT?NRT;@Rm>?-?-NVDXR@ -g -f >/  -H??-N$P\JfLJyJg>/<?<?<N$PTF.NRBWaBWNk0a`.BWNKJ@g.NO`"3NYBy>SNKJ@g>./<NRX>?9L?9ذN#DX>Nj3SyRJL0N^NuNVH (|h`N*TJlgDBWBg?,?<?-NXP.BgBg?--H??-NX /Ng X\JfJL0N^NuNVHBGB=n=|>///a J@gf3.??.?.a\, n g @چ`o* nf Jg yf .N)B>NKJ@gBy y~ hm y~ h o$ y~0(|0|g.NP2`36Ry4NN-@.NYJ@g.NP2`(>N-@g .NBNKJ@f>QNKJ@f.NP2By(` By(`f >?<NTa=@m >NS(`0.N^NuNVHBG>VNKJ@g>a>>WNKJ@gJ>NKJ@g>?.aT?NRT`0:9>ENKJ@g 9~#*@BG;E`>VNKJ@gJyRfB@33L3خRy-|h`n&y~g. /<,NOX`< <Rb.@NP2`>` 7| | 7| n \>BNKJ@g>ENKJ@fSy n >WNKJ@gJyRf <hfByخ> ?NRT>`>TNKJ@g>UNKJ@g.NRd`(yN!-@g9y#-n<`./.0F"|X/0N*P/0FX RFym.NRd>UNKJ@g>>0?NRT>`(JnfJgJyRf JngByخ0```.TNP2pJL8N^NuNVHBD n<(`0|0|0fRD`>NR<0|0fBG<. :.`h>?NRT>JDgL0|0|0f@ n0h"|X/00E"|X/0N*P/0EX RE>NR<0|0f n<( n:(`.0|0|0f0E"|X.NRdRE>NR<0|0f n<(`>?NRT<>NR>0|0f>|| f n"n0`| f n0$0JLN^NuNVHJnfa`.Ua8`R nQg nSf >NL.NO#*0#3PB`d`B`` J@g|g`0n2(g@JyPf ng ng nPfn ng ng n]gByP0n2<|?Jy4g nBgJyH)*g nAf|` yhn yhfz0n2gfX 9e .NO ng nf|` nVg nTg nHf| y0 y1F` y>Y0`>NLJyfBWNmHJ@gRNY\*@ gD#*0#3P ` nWf`>INmHJ@f.NOB``x nUg`>NmHJ@g~=`@>?<NXT.NY*>NmHJ@g`.`H |hr W h$Nо|Vg>NmHJ@gz``^BWNC =@fZ.*NOBJL N^NuNV#0*By#3PJgJ0f#8#0`X y0d y1|# ByPN^NuNVH n0`>?<NXT.NYJ@gB@`p`.?< NXtT.NYJ@gB@`^p`X.?<NX>T.NYJ@gB@`4p`.a4*@.NYJ@gB@`p`>N(JBWBg?9?<?<1NXP.NYJ@gB@`p` yf n0\` yf n0_`B@`JyPgB@``ByP`JyPf n0]3P`jJyPfB@`^`XJyPg n0`DJyPg n0`0JyPfBWNC 36|Cf09D@3p`BWNC 36|Df 9D#p`BWNC 36|OfTJyf&9g <` <` 9g ` p`p n0 `bJyPf n0<`NJyPf n0=`:JyPfB@=@=@BW/Q/U/YN J@g n f .NRd`09=@>?.Bg?<?.NXP*@>Nցm>WNKJ@fB@`Jg.\?-?-/9NP;@.NY* n0P y P\f RyPp`^`>WNKJ@g?<]`?<H n0`:Ry0yN"y~ ``H |rW hLNpJL N^NuNVH*y~fPBWNC 36|Vf|;|#Bm `&Jy4g|`. /<9NOX -g0-|0| fJJyشg -gBWNC 36|Vf.NW*@;|`>?<CNXT*@`">?-?--H??-NXP*@ JL N^NuNVHBn n PCf n0(H,` n PDf n,(Rn`B@` n PCf n 0(H.` n PDfn n (gT nfL n JhgB n > n ?( n ?(NRT?NVDX=@0.H//N*P, n .(Rn`B@`L0.`ކ`Ꞇ`//N*P.`//NP.`//N~P.`Ά`` `" .`" .`gB@`pH.`pfB@`pH.`^nB@`pH.`NmB@`pH.`>lB@`pH.`.oB@`pH.`B@`n`S@|"b@0@X PNJnfJo4Jo0o( n 0D n !G n hf n 1|` "n 3@. NY*pJLN^NuNVH n PCf n 0(H.` n PDf n .(`B@`j0.`$ F.`0 D.`(JgB@`p.`B@`@`| g| gذ| g` n PCf "n 3@` n !G. NY*pJLN^NuNVH (y# Ry4BWa*@>|Cg|Dg .PNOSy4#|Df -`0-HJL0N^NuNVJybf> aN.?9|/<NR\3|N^NuNV3d.NRN^NuNV3d.NRN^NuNV3d.NRN^NuNV nfa`a> /<NRXN^NuNV3d.NRN^NuNV3d.NRN^NuNV3 d.NRN^NuNVJyJg>|/<NRXJn fJn g^.NRJn g&>0. W/<NRXJn g>/aJn g>0. W/< NRX> a.NR-yD#ظD=yb3bJn f Jn fXn0.D@>/<#NRXJn fJn gD>0. W/<1NRXJn g>0. W/<@NRX` .PNR>%a #D3bN^NuNV0. `X0.|0| g>/. /<XNRP`H>/. /<dNRP`0>/. /<pNRP``S@|b@0@d PNN^NuNVH? n <(0nSH :(>F nn`*n `8Jmf.{NR`>/<NRX>/<NRXXSnlJn o> /<NRX`JGo0.@nJFg>/<NRX69Ry> ?/<NR\>/<NRX.NRa>/< NRX*n `.mf>/<NRXX`> /<NRXRFEo.(NR`69Ry>?/<0NR\89Ry>/<XNRX0.@>?/<^NR\aB>/<NRX*n 8.`0m-H./<NRXXSDlB/<NRX*n 8.`>/<NRXXSDl> /<NRX.NRJL N^NuNV.ظNP.NP.NPN^NuNVH>NvBW/</.N|PJ@l./<NOX`.?N{T.N|>n.NPJLN^Nu*+NVJyg>,aRy>/<NRXN^NuNVa./<NRXaN^NuNVBy> aTN^NuNV-yD#D=yb3b>/<NRX0yb.0yb/aX#D3bN^NuNVHa . n . ` ..*|`*H>Wa yfoa>azSJna0 . o . ./<NRX`Jg . o .NO . m . ` .JL N^NuNV n f>/ ?<NJ\` . H>aN^NuNV . fJybg.D?<(N{T`* . gB@`p3b.D. H?N{TN^NuNVH n>( n> n?(?NVDX-@BWNC 36|BgBWNC 36|Qf .R-@ n (f./. /<NRP`X n (f n|`@. NR n>/<NRX./<NRX.#NR`>NKJ@f .+NO|g 0|0|fN# `| g| fN#(`N" n (f. /<FNRX` n>/<ONRX n> n?( n?(/.aP-@ .l ../<UNRX-n .Rg .aNR .o n0(|0|0f` n>(` >NR>0|0|0g n> n?(?NVDX//.NP/ n0hX ` .iNO n (f .NRJLN^NuNVH>RNKH-@>. ` >NR>0|0|0gB>?.?. NVDX-@B0. |0|0f > NR`0. : n1 g n3 g n4 f> /.aX-@`κ|1g|3g|4f>?.?NVDX-@>?.RW?NVDX-@Jf .NO>RNKH-@>/.avXѮJg>SNKJ@f .NO>BNKBWNC 36|SgBWNC 36|Qf .-@ f|g0|g* f|g f|g .fBJl.NOB`0. || f0. |0|g0|0|fzp-@-@Jf .NOBB/.//.?<a-@>BNKBWNC 36|SgBWNC 36|Qf`0. |0|0g 0. || f0. |0|g>?.?. NRT?NVDX-@-@Jf0. || f .NOB n/(/.//.?a-@>BNKBWNC 36|SgBWNC 36|Qf`$By n(H>?.?apXH-@Jyg>a <0HѮ0HѮJg$ .찮g./<NRX .ѮJg$>BNK>SNKJ@f .NO .JLN^NuNVH.. n,:.B-@=@0.|| f$Jf nJg n-h n:(BWNC 36|QgBWNC 36gBWNC 36|SgzJg| f>RNK=@-F n-h n> n?(RW?NVDX-@B/././Q/.?aJng>SNKJ@f .9NO`Jy6f3B6`$`>RNKJ@grRnJyg>a T80H܀0HހJgJg l./<QNRX܇BJfJg . o .]NOB`r`FBWNC 36|Sf"Jng>SNKSn```$`|1g |3g|4f2 n> n?(?NVDX-@>/.apX-@`& n1g n3g n4f6 n> n?(?.NVDX-@>/.a"X-@`0|0|0frB-F n> n?(?NVDX-@>NR: n> n?(RW?NVDX-@ n-h0|H-@ m nB`jBWNC 36|SgBWNC 36|Qf./<wNRX`8 n(H> n?(?aX>BNK .Ѯ .fJy6f3B6`dB`TB/././Q/.?aP-@Jg$ .".Ү쐁./<NRX` .Ѯ .f`Xg|gSR.NRJfBWBg?aXH-@`" n(H> n?(?aXH-@ܮJf nm n o.. l .NOnB` .0.|| fX nJfDJyg >a`B@80H܇Jg./<NRXB0.|0|0f` n-h>BNKJ@f0.|| f.Jyg >a`B@8܇Jg./<NRXB n `$>BNK>SNKJ@f .NO0.SnJ@f>BNK JLN^NuNVHB f0. ||g> f0. ||g&0. ||g f0. ||f B.<`..>XNKJ@g>Jf0yb.0yb/N(X`0yb. /N(X܀ `BWBg?. WW0aXH܀nl .NO `X>BNKJ@g*BWNC 36|QgBWNC 36|SfLJg ./<NRX ` JLN^NuNVHRy4BWN*@ f.NOSy4B@`Sy4>|Cf 0m#`|Df#(9: n f.?. ?.aX`Jyg >a:`+,B@<0.|?`R|Cg|Df:>W?<N"T0|g0||g .#NO0R@`:|W?<N"T.9NO0R@``|Cg|Df2>W?<N"T|n|l .cNO0R@`ľ|W?<N"T.yNO0R@``t|Cg|DfT yl4>W?<N"T|n|l .NO0R@`D`>?<N"T0T@`,`|?<N"T g g .NO`>d/ N;X0T@`ľ|?<N"T`>d/ N;X0T@``|Cg|Dg>d/ N;X0X@`>.N(0X@`0`S@|6b@0@ PN>W?/<NOX0JL N^NuNVH0.||fp`p:0. @HH@:Jyg"0.|yfyl >aL>`BG30.|3|0. |fSF0H 2㠁yضRy0JLN^NuNVBy yf:>ض?<N"TByض0.|?|g.NR`p``>ض?<N"TByضpN^NuNV.BgBg?. ?<LNXP.aN^NuNV.BgBg n?(?<MNXP.aN^NuNV.Bg?.?. ?<KNXP.atN^NuNVH09|ygN"8.JNR> N)*|`H>N)  f > N)RJf> N)JL N^NuNVJg N"8.aN^NuNVJgx n> n?/<MNR\ n0`< n>/<SNRX`8 n=h n=h >?./<XNR\` n=h n=h >?./<`NR\` n>/<hNRX n hf./<lNRX` n> /<sNRX`> N)`x n>/<xNRX n.a`R> N) n.a n0P2(g n. a``H | rW hNN^NuNVHB` ހH|Hހa X|0m<9oH>a JLN^NuNVHBBn/.N~(X-@-|Jn f a |.fR`>/<D/.N@P-@/.H|H/N~(X/N}P-@Ra |0m<9o<eg<Efx>-a lJ@gp`>+a \J@gB@`B@=@`a pJng/.N`X-@/N~(X//.N|P/N~X,/./a6X/N@P-@Jyg .a` `.ajJLN^NuNVJl,-|A`/<D/.N~P-@RJm`*-|A`/<D/.N@P-@SJn .N^NuNVH/</.N}PfB`/</.N}Plz/.N`X-@`BEB`R/<B/.N~P-@/<A/.N}Pl`S/<B/.N@P-@/<@/.N}Pm/<Y/.N@P-@/.N~X,JEg޼@  JLN^NuNVH/</.N}PfB`/</.N}Plz/.N`X-@`BEB`R/<B/.N~P-@/<B/.N}Pl`S/<B/.N@P-@/<A/.N}Pm/<A/.N|P-@/<X/.N@P-@/.N~X,JEg޼p  JLN^NuNVHB`Da(|0m <9n<0`"H||Am<Fn<`` HHހ`H>a0 JLN^NuNVHBEB`Jng RE0|n H|Hހa|0m<7oH>a JLN^NuNVH?Jy6g:96By60`(` |~0pH`.NO`ByBy |~0pH`a>>ab0G~ of>BaX#pO`p[`ByJyRgRyخpR`0yخ"|8Jpg& yخg >خNj0yخ8BPJyخgSyخpS`H`8>=aFJ@gp`p `.>"?<,/<a\3RypX`>=aJ@gp`p`>=aJ@gp`>&aJ@gp>`p`>'?<,/<ab\ ybo.NO3b09bS@3By*|`09@3H|ySybnpC`P>=aRJ@gp`p`:>=a+a,J@gp`p`>=aJ@gp`">-aJ@gp`>>aJ@gpZ`p`>*aJ@g8`|*f >/aJ@f a>JGfJGf.NOB@``>/aJ@ga>JGg| f`n>=a|J@gp`p`dBEBy|0g^>aa&nJmB@`p8ad>|.g |eg|Ef>aBW/aX#pO`>a`j>xaJ@f >XaJ@ga&nJmB@`p8`4>.aJ@g >.a6`^BWa &nJmB@`p8>laJ@f>LaJ@fJDg #pD`h3pC`\>=a^J@gp#`">=aBJ@gp`p`p"`&>>aJ@g4>>aJ@g.8NOp`.UNOp``ra>>/<kNPX:mP|l"a<| g>/<u,-NOX>a |0PH:|g .ÁNO0`>`>ap`0>=a2J@gp!`">>a"J@g>=aJ@gp`p`p `Kz`JEoa>SE0G~ sg0G~ ogJEoB>aB>0.W/QNi X#~ y~g. y~3 yf3BypY`dBypE`X>=a\J@gp`p `D>=aHJ@gp`>|a:J@gp?`p `$`H |rW hXNa<>JGfB@JL N^NuNVHa>nfp`>abB@JLN^NuNVHJy&g>9&By&0`.֦N|>| f:09̰y|gJygN"8.âNR3زRy|`Jyزg|#f.֦N|a3|*|.֦N|>|"g0|`0|.֦N|>|"g| f޾| g.֦N|>B3ز`JGlBG`Byز0JL N^NuNVHa>0G~ egnfp`>a B@JLN^NuNVJy&g.åNO`3&N^NuNVH3b*n>. `JFg| f.NO`|\ffaF<0|0m,|7n&>a>a\<m|o.NO`J`*>/<NPX:m |0PH<`| gJGo Ryb`JGf .NOSGa<.H@fJJGnSBJL N^NuNVHBWa>nfp`36B@JLN^NuNVJy6g .NO36N^NuNVH n &PX &| nl.a.?<NT|g.N?<NT.?<NT|g.N?<NT.?<NT|g.N?<NT.N?<NT*| n (PX fBW/<֦/<N|PJ@l./<aZX.aHм @|cBW/< n /N{@PX J@mBW/<ظ n /N{@PX J@l .a n #X BW/</9N{@PJ@l .a#DRy|3$3ز[n`p n *P -g.a`PH`2Ry`BRy`:RyJ`2Ry`*Ry``"`.a`H |rW hN``X SnJnfNg``NBWNC 36fN'BJyfN"` .;ap.N'na JL8N^NuNV.?<NT.N>ظNvJyfBW`>NN^NuNV./<CazXN^NuNV>|/</<y/<τN >?.?.?.?.?. /./<τN.Ɔ/<τNXRyN^NuNV>?.?.?.?.?. /.aj3aN^NuNVJy`ff>|/</<ƈ/<τN >?.?.?.?.?. /./<τN.Ɵ/<τNXN^NuNVH>?.?.?.?.?. /.aBWNC >|QgJGg |Rg|Sf>NLJLN^NuNVH>< n0(@ n1| .P"n#@> n/( n?NJ\Ggp`B@JLN^NuNVH*nBG`H. f0`RGJfpJL N^NuNVH n R>9`0H H@|0"nRHǏ JGf nBRyJLN^NuNVH*nN>`RJf|`0||0GQ90R90 9Z0oa0 9z0fB` .JL N^NuNVHBG`RG nHRJf0JLN^NuNVH>?.?.?.?.?.?. /./NK`H>N)RJfJL N^NuNVH>90|@RyDm .ƢNO0GX 0JLN^NuNVH>.|n0.|g.ƻNO` 0.@=@02. |0AnJLN^NuNVH>.|n02.AAJLN^NuNVH>.|`>?ajT>>a=@0.|0f0JLN^NuNVHJn n.NOBn 0.`t n o .NO0. y|o~`>. |`\ n o .NO0. y|nB@`p>`..NOB@`4`|g|g|g|gv`JGgBy0. y0JLN^NuNVH>. Jyg09^@H@By` >a=@0.|0|0g ngRG|0n JLN^NuNV0.|0f .9NO>a>N^NuNV n0(|0|f n Pg& n> n?( n?(aDX=@` n-h n-h ` n-h n-h n Pg n=h0.| | g0.| | fF n0hSH"|X/0 n?( n?( n?(a\/N*P=@`B0.|0@"|0H|?H/ n0hSH"|X/0N*P=@Jn g 30.N^NuNV n0(|0fp`$ n> n?( n?(aT?aXN^NuNVH~0.|0|0f*>a=@0.|0|0g0n X.0.|0| fB`b0.|0|fp`2 n f0n "|X 0`0n"|0H|?H,Jf .INO//N*PJLN^NuNVH n>(|g,|g&|g |g0|0fn g .[NOJLN^NuNVH*y 2.HЁe .rNO 2.HЁ# JL N^NuNVH>a*@:E n(H;@ n;h n;h n;h n;h .- 5l4555555555545555Z54^55555555555555l4 555555555545555Z54b555 YZYZ"1001 "0"GGGBGBGNGGGY<>.,=:|[]* !!!!"CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321./. NmX JL N^NuNVH> a:*@:C;nBmBm;n  JL N^NuNVH> a*@:D;nBmBm+n  JL N^NuNVH> a*@:O;nBmBm+n  JL N^NuNVH>a*@:;n ;n ;n+n+n JL N^NuNVH>aX*@:E;n ;n;n;n;n JL N^NuNV <0b .ljNO y0 X0N^NuNVH <԰0eB`Y0 y0*P JL N^NuNV.aJyPgp`RyPB@N^NuNVH`BWNC >0`f0yخ80BWN`>SNKJ@fpaBWNKJ@g.DNO`R>NL`F>:NJJ@gaf`,>NLBWN.N/<WNRX`a`a<JFo>/<aNRX`a`a`~a`a <JFo>/<kNRX`Xa`a`Ja`|a `ta``l.uNP2`^.ȉNP2`P`U@|b@0@Ǡ PN`H | rW hN>QNKJ@f .șNP2``XJLN^NuNVH>VNKJ@g*3شBWN*@Byش>WNKJ@g `.ȫNP2BJL N^NuNVH>ENKJ@f.NP2`*y~J-f";| ;| Jmf;yRy`H m g@>/  Ni X#~*y~;| ;| Jmf;yRyJ-g -f m f0-`.NP2B@JL N^NuNVH*y~J-g@ m f. /<NOX`\>/  Ni X#~*y~|;| ;| Jmf;yRy>/<NRXJL N^NuNVJy֘f .NO09֘N^NuNVJy֢f . NO09֢N^NuNVHRyHN!-@SyH>ANKJ@f .;NP2Jyl.INO`l ym.hNO`T>9> .??909W09@HмҘ/a$PJ@gRy>/<ɁNRXRyJLN^NuNV>ANKJ@f .ɇNOJyl.ɕNO`$3֤Ry>֤/<ɷNRXN^NuNVH<9֘3֘Ry:9֢3֢Ry>9RyN"8.ɽNR>/<NRXa>֢/<NRX>aJ@f".NOJGo>/<NRX`>?<a*/N;\>֘/<NRX3֘3֢JLN^NuNVH:9֘3֘Ry89֢3֢Ry>VNKJ@f.NP2`>QNKJ@fBWN.NQNKJ@g&y>QNKJ@fL>9RyJGo>/<NRX=|BWN(@# >QNKJ@gh`Bn<9Ry>/< NRX=y|>WNKJ@g*a>֢/<NRX=y|3|`TBWN*@# >WNKJ@ga>֢/<NRX=y|3|.N/<NRX>?</ N;\`JFo>/<"NRX#3|>֘/<,NRX3֘3֢JL8N^NuNVHN"8.2NRa*@BF> aJJ@ga<`^>a6J@gal<`J>a"J@gaz<`6>aJ@g*>;NJJ@g<9.>;NJ` >YNLJFg>>?</ N;\>QNKJ@f .5NP2> aJ@ga^`>9Ry>Bg/ N;\a<> axJ@gF<9RyJFo>/<GNRX>/<QNRXa>/<WNRX`>/<]NRXJL N^NuNVH>;NJJ@f.BWN*@ g./9?<^a\` >;NJ` >;NJJy.o>./<cNRXJL N^NuNVN"8.mNR>VNKJ@g$>XNKJ@g>WNKJ@gN;` .pNP2N^NuNVH?>9֘3֘Rya*@>/ NWX.BgBgBg?<?<NX /?<a\89JDlRy693<9RyJFo>/<ʃNRX:9֤By֤aZJy֘o>֘/<ʍNRX>/<ʗNRXJy֤f 3֤֘09@HмҘ.?9֤?909WN% X>֘/<ʝNRX333֘3֤JL N^NuNVH <9֘3֘Ry>9֢3֢Ry:9֢3֢Ry*yN"8.ʣNRa(@ gJy֢o>֢/<ʦNRX# >/<ʰNRXa>֢/<ʶNRX>?</ N;\>֘/<ʼNRX#3֘3֢JL0N^NuNVHBWNC >|Yf 09ng >NLB@`pJLN^NuNVH 0. @H*@;n:(MY`<0,mf.NOB@`*0,ml>,9m;G>8:YYSn lpJL0N^NuNVH#8#0. NY*.NY*>NmHNY\*@ g . N;BB0JL N^NuNV#8#0.NY*. NY*>NmHNY\.N?< /a\\JfJL N^NuNVH`L>N*@f .NO~`$ b .NO+y #$SGl.ZgJyZgyYjB@``pN^NuNVh=|rBnp n(g -|It` n(g-|Ipt n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.мt -@(nBG./ NKXJg3Y3ZYp`J,g nl nf,>?/ RNXJ@g3Y3ZYp` n(H>NK< nf.?<NT nf n(g,.?.NT>> n(H?NKT ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHмY @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9YNXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHмY @fJg.HHмY @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVH *n(M`RJf HJL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH?BCB..,. f#Z <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#Z D`#Z JLN^Nu _B0Z"yZCCbNC NNVH..,. Jf#ZD <`Hc #ZDB`:fzB`(xe 〼b`BJge`#ZD JLN^NuJg .NuStack Overflow$C runtimeCON:LST:lib6.aT8T>TG_etext_edata_end0@p08@ ( (((( ((((((((((  (( ( ((((((( ( ((( ((((((    (( ( $F|X|Xc.outloXXXXXA: Invalid lo68 argument list .o: Illegal option %s .o: unable to open %s : read error on file: %s : file format error: %s : File format error: no relocation bits in %s : File Format error: Invalid symbol flags = %o : %s duplicate definition in %s : symbol table overflow : Unable to open temporary file: %s : asgnext botch : Undefined symbol(s) : Unable to create %s : seek error on file %s : relative address overflow at %lx in %s : short address overflow in %s library offset = %x : File format error: invalid relocation flag in %s : finalwr: text size error : output file write error : unable to reopen %s : external name: Write error on output file Vfloating pointC RTL - program not linked for Program terminating $Raw I/O: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $  /*y c<9N# 0. ;nB@;@;@;@@B@H+@+@+@JFg0F+P0FT#֚JyRgp`B@;@ 0F"|TJg0F"|T p!M`0F"| p!M0FT `;yخ . /.aRX>09΁W/.aDX>0G+P 0G JL N^NuNVH&nBnBW/ aX0@*P`(H|g. / aXJ@g `"*m fԙ09΀yNfrBW/ aX0@*P`D. / aXJ@g,0- yخf ``Jn f0- nm(M=m *m f g ``Bn>N09΁W/ a&X0@*P`<. / aJXJ@g$.U/ / aPJ@g `B` fJnf(M*m f gJyfJyNgJyg ` BWBg/ a\JL8N^NuNVH-|><` n*P`t&m nf f. /<NOXH|g(M`6f0- nl(M`" g)m ` n +y #*K fXSGlvJL8N^NuNVH *|><`(U`,HJFgTJlmN0,|| f@0l"|L p)h0l"|L p9h0,|| 9@| g|fL. /<NOX| fp`p@Jng >/  ,H??,N$P(l fBXSGl4JL0N^NuNVHJn g0<`B@>*n|`H@SFJgJFn0HH@JL N^NuNVH JyخfJyf JyNfp`p>*n(n ` JgSGfp` HgB@JL0N^NuNV0yN"| 0"n")fp`8J g0 n0("n 2)Af n0("n 2)Ag n0B@N^NuNVH *n(n ~`JgH`B@SGlJL0N^NuNVH?0n2(g$NY\(@ fB@`.a .a p(@:,NY\*@ fB@`\ n_fp`N n\f*>/ NTX>?<NXT.NY*p` n<g".a h*@ nHg nIg.a *@`( Uf" m PEf m PCf.NY*p`./ ?.a\J@gp`<-0n2g>/ NWX0n2g>/ NWX0n2(g UEg U=g UJg .NO0n2(f>.?.N!$TJ@f&B/ ?-?-??.NX .NY*p`| g| f nf| g;l;l;l| `| g9m9m9mz BW/ NTX=@BW/ NTX=@3f0.nl.:NO3f.NY*>2a3p`"z<.oNO>JEfz9EBC8`>a 8>a 60n2f(Cl$0n2g.|f(|f" TDf0C2"|0H6BD`0D2"|0H6x>0n2gh ng n^f" TCg|g|fv.͋NO`0 ng nPf 0`BC``Y@|b@0@ PN`p nAf0|0gEfBC`V0n2g|g | g|fBC`.0n2(g UCg UDf TCg TDfBCBn0n2g0|?|f|g| fBC n^f| fBC|fBBC nf~Rn`0 n^g(0|?2|?Af 0|?|g .ͥNO mf TEf lg lo lfB@`p=@JCg^|f.NO`JJDg$>/ NVX/??/ at *@`">/ NVX/??/ aP (@ nPfJng B/ BgBg?<?<7NX (@`Vg,|f&>/ NVX/?<?/ a (@`$ lgJCf9m9m TJg9m.NY*0n2g~ nPgZ./ ?.N\J@fF0|| g 0|| g&M`&L./ ?+?+??.NX &@.NY* nf ggJDfJCf .NOJngD|g>NY\*@ fB@`0>/-NVX/?<?</ a .NY*pJL8N^NuNVH n >(0.``B@`>/. NWX n 1|. NY*>=aNY\-@ n PEf$ n hg$ n h g n h g .NO n>(0|0|0f>NT> n0("nRi n> n?(?/. aP. NY*> BgNXT.NY*>a< n0(|0|0g>=a"NY\-@ n h f,B/. n?( n?(??<JNX -@ `@ n PAg .!NO n PCfJ n h PCf< n h PCf. n Jhg n h0(` n h 0("n 3@`(./. BgBg n?(?.NX -@ `./. BgBg?<?.NX -@ ` n PN8J@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N>\<Bm `n-g>< g -мb" -:>/-?N>\<+mBm `( -:>/-?N>\<;| +mFg mp`H|JL N^NuNVH>N@$*@ fB@`-fB@`pJL N^NuNVH>N@$*@ fB@`0|JL N^NuNV>aJ@g <Qk`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (yYb*T`ZB@0-BA2-@F@J@g>Na*@ f>N.|?GG0@>N>(*@fB`* R*@(M9GB@0,F@9@.Pa 9YbJL0N^NuNVH *nQB@0-BA2-@F@J@g>N. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-|ZD*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*yZ(GZ.N|f3 Y3ZYp`>Bg/ N\ JL0N^NuNVH>N@$*@ fp`vJnfB@`j-g3 Y3ZYp`L0|g>/. / NHP`0-g>/. / N@P``>/. / NBNPJL N^NuNVH|BG` Yff Yf0`RG|m3Y3ZYpJLN^NuNVp2.`F@HYfB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@t 0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 Y3ZYB`0B@0*@t -f3 Y3ZYB` JL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ NE|g3Y3ZYp`U -"- S¼nB>!/</ 4/./ NE|g3Y3ZYp`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ NE|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ NE|g3Y3ZYp` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// NE|g3Y3ZYp`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4NNPnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// NE|g3Y3ZYp`xU+|Rn neB@0.H=@>"B0.//. B0.// NEng3Y3ZYp`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// NE|g3Y3ZYp``>/. / 4NNPU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>NK=@=|`.?<NT n!n 0 oB@09Yj|`f noR9Ykg op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(9Ykg09Zr `=@` 09Z@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?NKTJng.?<,NT .N^NuNVB?< NT3ZYlB@09Yl`tydYj`~B?<NT09Z`$yYjy@Yj`,yYjyYj`|"gް|1gа| g|1g`a*`$yYj```H |YnrW hNN^NuNVB?<DNT y0f nPg n^f ~$`:`z nPg n^fh~$ gX .>?<NXT*@./.?<N\J@g NY\-@`"./.BgBg?. ?<NX -@` f .` nfp`p> .>?<NXT*@./.?N\J@g NY\``f n PCf n0(H.?. NX>T`^~$`>~5`:~3`6~4`2~6`.~%`*.ΐNO .`4`U@|b@0@̲ PN./.BgBg?. ?NX JL N^NuNVH n1n Jnm n1n n1n n>| NT=@ `(|=f>?. NRT=@ ` |g|f>?.?. n/(azPJLN^NuNV n0(|0| f@B/. n?( n?(?< n?(NRX??<(.NY*BW?< n?(NTT?/.aP>?</.N}\:JL N^NuNVH*n Jmn,A+H>/-?NJ\|gN};| m RSm. HJL N^NuNVH*n .0.@?WaT.?.WaxT0.JL N^NuNV. n?aTN^NuNVH*n><m;|A+H>/-?NJ\GgN}B@JL N^NuNVH*n BmJnfB@`p=@>Bg/.N}l\:JL N^NuNVH*nJmnA+H>/-?N:\;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.NB\N^NuNV>?. /.N\N^NuNV.Τ/<τNX>NN^NuNVH..,. N LN^NuNVH..,. NLN^NuNVH..,. N LN^NuNVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@޼@ JFg .JLN^NuNVH .м<JgJFlB`V .:|oJEg <` <`0..μ|`RFJFm`SFJFnJEg D. JLN^NuNVH..,. N2 LN^NuNVH..N LN^NuNVH..,. N LN^Nu<NuJg NugR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNugRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj ޼gNuSiex@ބއdRgNu~NujJ<Numc68343 floating point firmware (c) copyright 1981 by motorola inc.NVH BWN#҈#ҌBy҆.a>*n`v`RJgHHмъ @fJgZ "g 'fFH>/ RNX(@ f./ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHмъ @gJ5pg M2GBRGH`BWNvBW/ RNNXJ@g.R/<aX`>Nv ->f@>/ TNNX|f>B?<N\|f.R/<aX`$BW/ RNX|g.R/<a~X`.a`|gr`JfBaSy҆.ҌN|f. /<a*XB/9҈?9҆NL6\>NJL0N^NuNV|./NX. /NX. /NX.?< NT>NN^NuNVH*n yҌ XҌRy҆JL N^NuNVN^NuNVN^NuNV.NN^NuNV.NN^NuNV.NN^NuNV.NN^NuNVHNLBW/<N6X>/<N6X>/<N6X n2n B*n`&HHмъ @g H| `HRJf> /.NXJL N^NuNV0<N^NuNV4.&/8NX./8NX.F/8NX.8?< NT>NN^NuNV. /./<vN"PN^NuNV./. /.N"PN^NuNVH>N*@ fp`-gB@`t-g3 t3҄vp`T-g>/. / NP`8-gB0../. / NP``B0../. / N0PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ NP|g3t3҄vp`U>!/</ 4/./ NP|gU .`+n&M -|H4`FS .fU - o+m .`H` . 0/X|f>B?<N0 \|f.R/<Wea|X`$BW/ RN,BX|g.R/<WtaVX`>?/ NXJf>*/ NXJg-|v&.4?<NT>/ ?<NJV\<f.W/ aX`^.H?/.aZ\.NOZ>RWNP(@./ NO8X.a>/ ?<NJV\<f`.a`|g`JfBaSyZ.ZN|f.W/<Wa*XB/9Z?9ZN\>N,tJL0N^NuNV|./NO8X. /NOX.W/NOX.?< NT>N,tN^NuNVH*n yZ XZRyZJL N^NuNVH*n. (nBBnG4H@HJ-g4-HS@=@ n m10.H H@|0:=|J-gJngS-H|`:=|`T K2n  gB0n3H|HмY @g0n3H|| `0n3H|Rn n m.=| `T K2n  gB0n3H|HмY @g0n3H|| `0n3H|Rn n mBJL8N^NuNVHN?.>|fp`>N?0*@t JnfU.Qk/.NOXJ@f U0`R`.Qp/.NOXJ@fU0`2>/.?NJV\J@g3#Y3ZYp`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN,>NN^NuNVHBG`0мW.N,RG|mJLN^NuNVH*n0-|g*.N.H-g .N;B@H+@+@Bm m>N-JL N^NuNVH>.>N@$*@ f3 Y3ZYp`BF0|f-g6-f. - l>B?N0 \>/<Qu?N>\-g,>"/</ 4/-/ NE|g|-H>NK:.?<NT||f|>-H?NKT>N?>N?xJFf0``3Y3ZYpJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?N>\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N0 \Bm +mB@JL N^NuNVHN?.>|fp`>N?0*@t Jn fUJnfU.Qk/.NOXJ@f U0``.Qp/.NOXJ@fU0`d>/.?NJV\J@g>N?x3Y3ZYp`0U>B-H?N0 \BWB-H?N0 \0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N@$*@ f3 Y3ZYp`v0.`F+n `P . ѭ`F>N0+@ - Ю +@`*3Y3ZYp`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>N@$*@ fp`^0|gB`P-g +m `0-H>NK<.?<#NT>-H?NKT <0.-0S-gJmʾg-gF>"/</ 4/-/ NE|g3Y3ZYp`U>!/</ 4// NE|g3Y3ZYp`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N6\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <=` <=#Z.Z?<?< // N< Jngp`pH`RnJng <=` <=#Z.ZBg?< // N< Jngp`pH`zRnJng <=` <=#Z.ZBg?<// N< Jngp`pH`&RnJng <=` <=#Z.ZBg?<// N< Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// N X|`XH>?// N X|`4.H?N7fTRn``|C|5b@0@X PN.NOZ:ElJFm:0.E=@JnfX .0f* n -f SE. nH?N7fTRRn`..H?N7fTRn0.SnJ@n.?/.N6\n`..H?N7fTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?N>\Gg lp`*B@`&`.H?N7fT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?N7TJL N^NuNVH. *n BF:-fp`$JfV-fN>N1fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ NP|g3t3҄vp`U>!/</ 4/./ NP|g3t3҄vp`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ NPH,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ NP|g3t3҄vp`fU>!/</ 4/./ NP|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .`N ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN>lp`&>Nn>/.?N\<>N00JLN^NuNVHN>|fp`>Nn0*@ JnfU./.NXJ@f U0`R`./.NXJ@fU0`2>/.?N\J@g3#t3҄vp`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^NuNVN>NN^NuNVHBG`0мh.NRG|mJLN^NuNVH*n0-|g*.N-g .NB@H+@+@Bm m>NvJL N^NuNVH>.>N*@ f3 t3҄vp`BF0|f-g6-f. - l>B?N\>/<?NJ\-g,>"/</ 4/-/ NP|g|-H>N8:.?<NT||f|>-H?NT>Nn>N0JFf0``3t3҄vpJL N^NuNVN^NuNVH*n0-| |f, -<o >/-?NJ\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N\Bm +mB@JL N^NuNVHN>|fp`>Nn0*@ Jn fUJnfU./.NXJ@f U0``./.NXJ@fU0`d>/.?N\J@g>N03t3҄vp`0U>B-H?N\BWB-H?N\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^NuNVH>N*@ f3 t3҄vp`v0.`F+n `P . ѭ`F>NF+@ - Ю +@`*3t3҄vp`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^NuNVH>N*@ fp`^0|gB`P-g +m `0-H>N8<.?<#NT>-H?NT <0.-0S-gJmʾg-gF>"/</ 4/-/ NP|g3t3҄vp`U>!/</ 4// NP|g3t3҄vp`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^NuNVHK;| .+@+@;|:./. / N"P>.BgNT0JL N^NuNVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <` <r#Ґ.Ґ?<?< // NJ Jngp`pH`RnJng <` <r#Ґ.ҐBg?< // NJ Jngp`pH`zRnJng <` <r#Ґ.ҐBg?<// NJ Jngp`pH`&RnJng <` <r#Ґ.ҐBg?<// NJ Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// N X|`XH>?// N X|`4.H?NTRn``|C|5b@0@H PN.NQ:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NTRRn`..H?NTRn0.SnJ@n.?/.N\n`..H?NTRn0.SnJ@n`0.JL N^NuNVH *n>. (n,g$Bl >/ ?NJ\Gg l1NT``|b@0@S PNJyRfnJnfh .g\JngV.N/<V N XJng 0@>aFRyR Jng" ym-h>/<V*N XBBnJng.?.NT.?.NT`<0G-H`.N/<V?N X>a`|b@0@T PNUlF_f*|g$(|m(9Q|`$JL0N^NuNV 9tйmk:g.VsN RyR .c9k>H?/<g$a\a0Jya g6.t9LH?/<Za\.c9mH?/<maf\._NBW/<?9_N0 \Jm>/<^?9_N>\|g.VN RyR >R aN^NuNVH*n.N>N-0. "yQ>/ /<QN8PJ@l.Q/<VN X>a$`.N>._?NTUJnJL N^NuNVHB^Jymf8*y^`(-f-f Lg Jyi0g.ag eJL N^NuNVH *n(M^(MBG`._?NTRG|m._?-NT# T4._?9T4NT._?9T6NTJL0N^NuNVH*n n f~` n f~` n f~`B`^B`TH|0m |9n|0`&|am |fn|`|Am |Fn|``JFmn l 00Hڀ``` JL N^NuNVH*n./<QaPXJ@g #mp`6./<Ra6XJ@g #\p`./<RaXJ@g #mp`B@JL N^NuNVH *n(n BG` gB@` RG|mpJL0N^NuNVH 0.*@a.VN (M`Jg.WH?N7fTR Pe.W?< N7fTJL0N^NuNVH*n ;|A+HJnfB@`p=@>?</.N>\:JL N^NuNVH*n Jmn,A+H>/-?N>\|gNZ;| m RSm. HJL N^NuNVH*n .0.@?WaT.?.WaxT0.JL N^NuNV. n?aTN^NuNVH*n><m;|A+H>/-?N>\GgNZB@JL N^NuNVH*n BmJnfB@`p=@>Bg/.N"\:JL N^NuNVH*nJmnA+H>/-?N!\;@Jmnp`Sm mH|RJL N^NuNVH*n.a>|fp`.<|F.a>|fp`0|@0|g|0JL N^NuNV>?. /.N.\N^NuNV>?. /.N+t\N^NuNV.V/<WN X>N,tN^NuNVN^NuNV.VN pN^NuNV.VN pN^NuNV.VN pN^NuNV.VN pN^NuNVHN?BW/<QkN/X>/<QkN/X>/<QkN/X n2n B*n`&HHмY @g H| `HRJf> /.N&XJL N^NuNV4.W/8NO8X./8NOX.W$/8NOX.8?< NT>NN^NuNV. /./<WN2jPN^NuNV./. /.N2jPN^NuNVH>N@$*@ fp`-gB@`t-g3 Y3ZYp`T-g>/. / N%^P`8-gB0../. / N!P``B0../. / N#PJL N^NuNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ NE|g3Y3ZYp`U>!/</ 4/./ NE|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ NE|g3Y3ZYp`U>!/</ 4/./ NE|g3Y3ZYp`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ NEH,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ NE|g3Y3ZYp`fU>!/</ 4/./ NE|g U .`,+n߭G4`SJn - o+m .JL8N^NuNVH *n n(g .W>N p ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuNVHN?.>lp`&>N?>/.?NJV\<>N?x0JLN^NuNVH BWN>(#Z#ZByZ.Qaa*n`N`RJgHHмY @fJg2 "g 'fFH>/ RNX(@ f.WF/ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHмY @gJ5pg M2GBRGH`BWN-BW/ RN/XJ@g.R/<WXaX`l>N- ->f@>/ TN2p`*B@`&`.H?NT|fp` 0SGJ@fB@JL0N^NuNVH. *n Sm mH"m|R``.H?NdTJL N^NuNVH. *n BF:-fp`$JfV-fN>N.+@+@fm`2m>NJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?NJ\<Bm `n-g>< g -мb" -:>/-?NJ\<+mBm `( -:>/-?NJ\<;| +mFg mp`H|JL N^NuNVH>N*@ fB@`-fB@`pJL N^NuNVH>N*@ fB@`0|JL N^NuNV>aJ@g <`BN^NuNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y(*T`ZB@0-BA2-@F@J@g>NBB`:B@0-ne `*(f>a*@ f>NBB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@#( PJL0N^NuNVH >.|?GG0@>N*@fB`* R*@(M9GB@0,F@9@.Pa 9(JL0N^NuNVH *nQB@0-BA2-@F@J@g>NBp`(y(eeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #(B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#(B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^NuNVN^NuNVN^NuNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^NuNVH-| *n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^NuNVH >.HμgR*yҀ(GҀ.N|f3 t3҄vp`>Bg/ N\ JL0N^NuNVH>N*@ fp`vJnfB@`j-g3 t3҄vp`L0|g>/. / NP`0-g>/. / N>P``>/. / NPJL N^NuNVH|BG` ,f ,0`RG|m3t3҄vpJLN^NuNVp2.`F@H,B@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@ 0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 t3҄vB`0B@0*@ -f3 t3҄vB` JL N^NuNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ NP|g3t3҄vp`U -"- S¼nB>!/</ 4/./ NP|g3t3҄vp`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ NP|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^NuNVH*nBn -=@B0.g-gB>"/</ 4/-/ NP|g3t3҄vp` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// NP|g3t3҄vp`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4N^PnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// NP|g3t3҄vp`xU+|Rn neB@0.H=@>"B0.//. B0.// NPng3t3҄vp`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// NP|g3t3҄vp``>/. / 4N^PU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^NuNVBBn n(H>N8=@=|`.?<NT n!n 0 oB@090|`f noR91g op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(91g09҄r `=@` 09҄@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?NTJng.?<,NT .N^NuNVB?< NT2 yg (f~ yg (g.9k:`Z yg (g.9m`D yg (g.9\`. yg (f, yg >/<TN X>a  "yg ѩ JLN^NuNVH yg (g.i2aN*@a` yg (gvJng.i2a$*@g gRyk4.j4a *@g fa`8JngRyl@#lB`$ yg 0(mf yg ( g.a$` yg Lg Jyi0ga\JL N^NuNV.N/./<U)N PRyR N^NuNVH >N>(#^9^gR^ 9^м#_#^g 3,g*|i2(|j4BG` *B(BRG| mJL0N^NuNVHa@HЮ#mF ymF*h f*yg ` ymF P!yg .a JL N^NuNVH*n(M&yg BG` Lg*m`RG|m JL8N^NuNV ymF g ymFJf ymF!yg aN^NuNVg 9g _e<>N>(f.UJN >N,t`_ydgN^NuNVHBG*yg BF`H@RF|m0|>JL N^NuNVH *n(n BG`8RG|mJL0N^NuNVH yQH"yQR>?</<QN>\<m0`.Q/<UcN X>aJLN^NuNV 9Qxѹk: 9Q|ѹm 9Qѹ\N^NuNVH #g k6(|i2*|k@BG`*RG|@m(|j4*|lFBG`*RG|@mJL0N^NuNVH #k6g *|i2(|k@BG`*RG|@m*|j4(|lFBG`*RG|@mJL0N^NuNVH 9k:m#t#mc#\mPJyJg #Zm` 9k:R#m#mZJytg #mL\`$ 9mйcR#\#\mL#mk:a a\JmgD.g /<QaX.i2a*@+yt mm.a*@g fJ\gL.g /<RaX.i2aT*@ 9tйc+@ mm.a|*@g fJmgR.g /<RaNX.i2a*@ 9tйcйmP+@ mm.a"*@g fJL N^NuNVH*y^`4-f&-g 9mѭ `-g 9\ѭ g eJL N^NuNVH(|i2`.G KJg"&S`J g.a(`.a*Kg&k`Pj.eJL8N^NuNVH *n.g / aDX.j4a(@g g n!l ``B.i2aԾ l.- B .a *@g f;| 9\йmP+@ n!m ߹mP.j4aaJL0N^NuNVH *n.g / aX.j4aR(@g f.i2a<(@g f.UN >a`J g .a`J.aR*@g f.a J@f,JymJf.UN RymJRyR .a`+l JL0N^NuNVH*nBG`Jg.WH?N7fT``RG|m.W?< N7fTJL N^NuNV.a ymQvf3Ra@`: yeQvf3Ra(`" y\N->aN-N^NuNV>?</9QN>\3_l.Q/<UN X>a@3_#_ _09Jytg._?<`NT`._?<`NT._?9tNT._?9tNT._?9cNT._?9cNT._?9mPNT._?9mRNT 9g ^-@._?.NT._?.NT._?9i,NT._?9i.NT._?9mNT._?9mNTJya g._BgNT`._?Jya g(.Za$ yQL.ma yQmN^NuNVH*na:;|A+HJL N^NuNVJ9k>g yQk>.QN&lJya g0 yQL.QN&l yQm.QN&l>N,tN^NuNVH y^>T^JGgJ`@ ym*Xm.\/a:X.a/a.XaaZ#S>aat0SGJ@fJLN^NuNVH/</.NOP.p BW/ n ?N0 \Jl.N/<UN Xa n Bh . P"n #@` . NvRmJLN^NuNVH 0.*@a-f - `2.g / a(X.j4a(@g f .i2a(@ , JL0N^NuNVH 0.*@a-f(M`..g / aX.j4az(@g f .i2af(@>, gp`` gp`` gp`B@JL0N^NuNVH B*|_(|Z=| yo#aXo(9QxعQ|عQؼJng 9Sм؀.a/a4X(9Qx`Bn.\N>.aN<TBn0|`t.?NTJya g .?NT`d=GJya g .?NT.\N=@.aN<TRnU0|`0Jya g .?NT`.` 9k:ѮJya g .?NT` 9mѮJya g .?NT` 9\ѮJya g .?NT`Rn0@>a~ѮJya g.0@?aT?NT`0@>aLЮk:T-@ .m o&.N//<UN P0@>aRyR BnJya g .Bg33҄2B@092`tyd0`~B?<NT09҄`$y0y@0`,y0y0`|"gް|1gа| g|1g`a*`$y0```H |4rW hNN^NuNVB?<DNT y҄gJy҄gy0B@``pN^NuNVh=|rBnp n(g -|lt` n(g-|(t n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^NuNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^NuNVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^NuNVH*n 0.м -@(nBG./ NXJg3t3҄vp`J,g nl nf,>?/ RNXJ@g3t3҄vp` n(H>N8< nf.?<NT nf n(g,.?.NT>> n(H?NT ng nf0` |nB@`pJL8N^NuNVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^NuNVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHмъ @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9xNXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHмъ @fJg.HHмъ @g H|`H|"nRJf n (n n op`B@JL N^NuNV . d"` n"n R R0.SnJ@f`40.HѮ0.HѮ `SS n"n 0.SnJ@fN^NuNVH *n (n`RJff .JL0N^NuNVH *n (nf .JL0N^NuNVN^NuNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^NuNVH?BCB..,. f#֞ <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD#֞ D`#֞ JLN^NuNVBBJlDRBJ lD RB0. -@0.2. An=@ .gDN^NuNV/. /.N 9֞N^NuNVH..,. Jf# <`Hc # B`:fzB`(xe 〼b`BJge`# JLN^NuNVH>.*n |lJGlp`0G 0`.X?<aT.X?<aT.X?< aT.X?< aT`.h?< aT`~.t?< a|T|#`.t?ajTRF|0m`P.?<aPT.?<aBT`2|`.?a0TRF|m``Y@|b@0@ PNBJL N^NuNV=n-n B.?<=NTN^Nu#ҔT`0#Ҕ`$#Ҕ`#Ҕ` #ҔH yҔNLNwJg .NuStack Overflow$C runtimeCON:LST:HP`hX  external definition syntax .globl _%.8s .globl _%.8s external definition syntaxinvalid typedef statementinvalid storage classinvalid storage classinvalid storage classinvalid register specificationinvalid type declarationinvalid type declarationinvalid type declarationinvalid long declarationinvalid short declarationunsigned long unimplemented, signed long assumedunsigned char unimplemented, signed char assumedinvalid unsigned declarationredeclaration: %.8sstructure declaration syntaxredeclaration: %.8sno structure nameinvalid structure prototype: %.8sstructure table overflowinvalid type declarationinvalid structure declaration: %.8sredeclaration: %.7sredeclaration: %.8sillegal function declaration .text _%.8s: ~~%.8s: function body syntax_EnD__%% { not matched by } L%d:illegal autoinitialization data type3`$ LBN`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#"h#E?/ NN o AdpNu#BNuNV0/"/ NBd0< A"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuStack Overflow$C runtimeCON:LST:_sw___mainltpahtpalcodecodelen ldatadatalenlbssbsslenfreelen resvd$fcb28fcb1\commandprtstr exit__exit__break__start___cpmrv__base__sovfstartPserial?xclearb_brkbrkok___BDOSnoovfovf_blkfillfilldonefillit_index_strchrxindexnotend___pname___tname___lname___xeof# `QR H$BNQB`FCLEAR68K V02.00, Copyright(c) 1984, Digital Research XXXX-0000-654321 o#Z"h#ZE?/ NN o AdpNu#ZBNuNV0/"/ NBZd0< AQR"NB0<NBN^Nu o2/0/ HSoQBNu o0/JfBNuf SNuNVHa4a\#co#^^#pm nn.THN >a(*n X~`F(].Tf/ NOXJ@g, -fRH`S`J,g./<TiN X>N,t#QRG`Rym`Ryi0`Ryj2>R/ aX#m#mk:`RyJ>R/ aZX#Z`Ryt>R/ a\N-N^NuNV y^BP#S`aByk4Byl@#mTNa>a09k4yl@o8Jyl@g .lBaaXo y^RP ym SXm`ar9Sg.\NvRS09RHйSѹS.\/9SaVXaJ@fHT^N^NuNVH *|mTBG`.\NvRG|mBmb#mjSJ9mTfB@`pJL0N^NuNVH*n -f*R M lf R MJgQ`6Q*|Q`*n>/<\/ N8P3\l./<TN X>a #N.Qv?9\alTJ@g.N/<TN X>a pBy\ yeQvgBWB?9\N0 \aVJy^g>/<a/ N8PJL N^NuNV>/U?.N!\|gp` n 0B@N^NuNVH*|QvBG`.\N:RG|m y`Qvg.N/<TN X>a JyQg(.TN .N/<TN X>a xJL N^NuNVH yo g ,9QxܹQ|ܼJng 9Sм܀.\/a X.9Q`a a|>aJnJLN^NuNVH*yg BG`.\N:RG|m.\N:.\N:.\N;@JL N^NuNVHB4auto initilization syntaxauto initialization syntaxdeclaration syntaxredeclaration: %.8stoo many parametersinvalid declaratorHTV]d>>>>V CDEOTUVWXYZ[XXPzjt*  : .  & F X h x invalid expressionexpression too complexNull expression encounteredunexpected EOFundefined symbol: %.8sconstant required$$%$%%%%%$%%%%$.%x.%s .dc.b .dc.w .dc.l $%x .data .data .data ~_lE%d: tst.l (sp)+ movem.l (sp)+,R%d-R7R%d-R13 unlk R14 rts link R14,#%d movem.l R%d-R7/R%d-R13,-(sp) ,-(sp) ~%.8s=L%d ~%.8s=R%d ~%.8s=%d tst R0 cmp #%d,R0 beq L%d bra L%d sub #%d,R0 cmp #%d,R0 bhi L%d asl #2,R0 move R0,R8 add.l #L%d,R8 move.l (R8),R8 jmp (R8) L%d: .dc.l L%d .dc.l L%d .text ext.l R0 move.l #L%d,R8 move #%d,R1 L%d: cmp.l (R8)+,R0 dbeq R1,L%d move.l %d(R8),R8 jmp (R8) L%d: .dc.l %ld .dc.l %ld .dc.l L%d .dc.l L%d .text can't copy %s$%x$%lx L%d: .ds.b %ld String initalizer truncated8r:Z9L:799::4:4:Z:Z:Z:Z:Z:Z::Z::::Z::::::Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z:Z8:Z9L::Z:Z9 .comm _%.8s,%ld .bss L%d: .ds.b %ld .text old fashion initialization _%.8s: L%d: .ds.b %ld .even too many initializers .text missing { in initializationmissing } in initializationinitializer list too longmissing { in initializationmissing { in initialization .ds.b %ld missing } in initializationmismatched curly braces .ds.b %ld initializer list too long .ds.b %ld .ds.b %ld .even initializer alignment .ds.b %ld .ds.b %ld mismatched curly bracescharacter array initializer alignment .ds.b %ld invalid initializerinitializer truncatedstring used to initialize character valueinitializer truncatedstring used to initialize character valueinitializer truncatedinitializer truncatedinitializer truncatedinvalid initializer type=%d .even CDEJKO=<<=.====0 %x.%x.%x .%x.%x .%x.%x .%x.%.8s .%x .%x eeeeeeefghijVWklBm[nooooooooooAQpqr@ssssssssssssssssssssssssssTUtsssssssssssssssssssssssssssRuS  QRS[efghijklmnopqrstuCBCRCCCnDDD(DRDhDEEEBExEFG0H&H\HIC^invalid charactercharacter constant too longno */ before EOFold fashion assignment "=<<"illegal operator '=<'old fashion assignment "=>>"illegal operator '=>'-*&=+/|^%=%c assumedold fashion assignment statement0 too many chars pushed backstring cannot cross linebad character constantbnrtfstring too longtoo many tokens pushed back2JNSY^cltw~ Ń ň ŏ ŕ řŜŠťŮŵŻABBDABBDDD efgtwN(NNNNN N*A@(#)main.c 1.8 12/28/83asmautobreakcasecharcontinuedefaultdodoublegotoelseexternfloatforifintlongregisterreturnshortsizeofstaticstructswitchtypedefunionunsignedwhilec068can't open %stemp creation errorstring file temp creation error .text usage: %s source link icode strings [-e|-f] [-w] [-T]"%s", * %d: "%s", * %d: (warning) dimension table overflowarrays limited to five dimensionsinvalid field sizefield overflows wordfield overflows byteinvalid field type descriptionbad indirectioninvalid data typeintegral type expectedexpression too complexexpression too complexZ`Z~ZZZZZZ[ [ ZZZZZZZ4L2*L1rL38L4BL5jL7DL6VL9XL8jL10dsignal.o`@"NVH>.*n |lJGlp`0G 0`.?<aT.?<aT.?< aT.?< aT`.?< aT`~.?< a|T|#`.?ajTRF|0m`P.?<aPT.?<aBT`2|`.?a0TRF|m``Y@|b@0@ PNBJL N^NuNV=n-n B.?<=NTN^Nu4x___signa___BDOS__illins__trace__buserr__arith__trap__iob__fds_signal~~signal~sig~func ~iL10000L2 L1 L4L54__setvecL3L6xL7L10L11L9L8L12L13L16L17L15L14L18~~_setve~vector~func ~epbL19<44$$, xsignal.o4`Tp#T`0#`$#`#(` # H yNLNw___signa@__illins__trace__trap__buserr(__arith6epaprocess@blivot.o`R8Jg .NuCP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-654321_sw_ok___cpyrtserial@5[ [ [ ZZ[ Z[ ZZEQRSYZZ$ZYZZVZ:{ not matched by } bra L%d bra L%d bra L%d invalid declarationinvalid keywordmissing semicolonparenthesized expression syntaxexpected labelinvalid labellabel redeclaration: %.8s L%d:invalid break statementinvalid continue statementmissing coloncase not inside a switch blocktoo many cases in switch L%d:missing colondefault not inside a switch block L%d:0 L%d: L%d:missing while bra L%d  L%d:invalid for statement bra L%d L%d: L%d: L%d: L%d: bra L%d L%d:0 missing semicolon bra L%d L%d: L%d: L%d: bra L%d 0 illegal asm syntax bra L%d bra L%d L%d: L%d:0 bra L%d L%d: L%d: L%d:duplicate case valuesymbol table overflowbad symbol tableundefined label: %.8snot in parameter list: %.8sOOPPP N NKJJ$ $ """""".....LLMMMM@@@@@@@"@"ƀ  $IH G GE@@@@@R@"Q@RR R"Q    pppppppppppppppp2<=>?@BHIZ[tvwv,vvunvvvt tVtxxwy xxwyyxxzyyyyyxz{{ {{{{{{{{assignable operand requiredleft side of structure assignment smaller than rightillegal structure operationshort assigned to pointersuspect conversion operationillegal type conversionpointer subtraction yields a long resultinvalid structure member nameinvalid ?: operator syntaxindirection on function invalidillegal calladdress of register& operator illegalinvalid conversionWrite error on output file : unmatched quoteCannot open Cannot append Cannot create Stack Overflow $floating pointC RTL - program not linked for Program terminating $Raw I/O   $@fj$@fn "1001 "0"h^hhh|<>.,=:|[]* !!!!"L CP/M-68K(tm), Version 1.2, Copyright (c) 1983, Digital Research XXXX-0000-6543215strlen~str ~p L4L5L3L2L1ctype.od`8NVN^Nu!!!!"___atab____atab~~___ataL1xstrcmp.o`rNVH *n(n `$H>a0H>a&op`lp` JfJfB@JL0N^NuNVH>.|am |zn|0JLN^Nu__strcmp~~_strcm~s1 ~s2 ~a~bL46L3__touppeJL5.L1@L66L2>~~_touppJ~cL9fL8hyesfloat.oX`*NVN^Nu_nofloat~~nofloaL1yesstart.oX`*NVN^Nu_nostart~~nostarL1xatof.o`FNV.NN^Nu_atof__atof~~_atof~bufL1abort.oX`*0/J`illegalJ_abortaaldiv.o` bNV/. n/N"n"N^Nu_ldiv_aldivaldiv~~aldiv~l2 ~al1L1almul.ol`/ *o// /NPO**_Nulmulalmulalrem.o`&bNV/. n/N 9"n"N^Nu_ldivr_ldiv_alremalrem~~alrem~l2 ~al1 ldiv.o`4NVH?BCB..,. f# <`hlDRCJlDRCn8fzB`0l :HGH`xe`Jge`|fD# D`# JLN^Nu_ldivr_ldivldiv~~ldiv~b~q~l1~l2~al1~al2 ~signL2.L1L34L4.` JfB@`RRSGoHgHHAJL0N^Nu_strncmp~~strncm~s1 ~s2 ~numL4"L5L6L18L3L10000.L2.strncpy.o`HNVH *n (n`RR0.SnJ@ofRn`B0.SnJ@f .JL0N^Nu_strncpy~~strncp~s2 ~s1~num~cp L4L5L3L10000&L2&L8.L7,L6:L1>strcpy.o`"~NVH *n (nf .JL0N^Nu_strcpy~~strcpy~s2 ~s1~cp L4L3L2L1strlen.o`&~NVH *n(M`RJf HJL0N^Nu_strlen~~77S__fds__lstout~~_lstou~buffer ~count~xcountL4.L3L26L1:ttyout.o@`NVH*nH=@ M2n$BG-M`H M2G $f: n $g.?< NT.$?<NT 2HЁR-@RGnm 2HЁg.?< NT0.JL N^Nu___BDOS__fds__ttyout~~_ttyou~buf ~ii~count~cpL4pL5(L6nL7NL3nL2vL8L1xopen.o`*NVH*n 0.м-@(nBG./ NXJg33p`J,g nl nf,>?/ RNXJ@g33p` n(H>N< nf.?<NT nf n(g,.?.NT>> n(H?NT ng nf0` |nB@`pJL8N^Nu_errno__parsef__chkuse___cpmrv___BDOS__errcpm__uchkus_index__fds___open~~__open~filnam ~ch~bdosfun~fp~fcbp ~p ~rv~xuserL2RL1 L3bL4L5L6L7L10000L8L10001L10003 D ,<,$$4chkuser.o`~NVHJnfB@`4.?< NT>RGng0.S@H.?< NT0JLN^NuNVJng 0.n g0. S@H.?< NTN^Nu___BDOS__fds__chkuse~~_chkus~newu~prevuL2L1FL3D__uchkusP~~_uchkuP~newu~prevu L4zL5zerrno.oP`*__fds_errno__errcpmstrchr.o`RNVH*n. ` JfB`Rf JL N^NuNVH*n. H>/ aXJL N^Nu_strchr~~strchr~str ~chL4L5L6L1"L3L2 _index,~~index,~str ~chL7Hparsefn.o`:NVH*n> Bg/. N\> ?< /. RN\> // aP*@ :f6./. aX|fp`> /R/ aFP*@ *f>?<?/. RN\R>/. R/aP .fT> /R/ aP*@ *f>?<?/.  N\R>/.  /abP ;f2> /R/ aP*@>/. /a*PH`B``J@g| g| gpJL N^NuNVH *n(n >.`(HHм @g H|`HRSGJgJGfJL0N^NuNVH *n(n >.`SGJgH>/9NXJ@fJGfB JL0N^NuNVH*n BG` H@|0R@"n@HHм @fJg.HHм @g H|`H|"nRJf n (n n op`B@JL N^Nu<>.,=:|[]* ___atab_blkfill_strchr__fds__parsef~~_parse~filnam ~fcbp ~tokbuf_get_tokL2_stuff_dL3nL1lL4__strcpyvL5L6L7NL9ZL10TL11TL12TL8j~~_strcpv~s ~d ~c88,blkio.oP`0NVBBn n(H>N=@=|`.?<NT n!n 0 oB@09|`f noR9g op` .=@` o <` .=@Rn0n.?<,NT.?.NT=@Jng@ no(9g09r `=@` 09@=@`Bn0.HѮ`20.HѮ 0.H0.HѮ0.@HѮJn> n(H?NTJng.?<,NT .N^Nu_errno_os_abil__chkuse___cpmrv___BDOS__errcpm__uchkus_os_vers__fds__blkio~~_blkio~ccbp~sector ~buffer~count~bdosfun~nsecs~seccnt~xuser~retcode~Used_MuL4BL3,L10001^L10000fL5L6L10002~L10004L7L10005L10007L8L9L10L11L12 L2JL13zL1~$  $$ 4$osattr.oX`DNVB?< NT3B@09`tyd`~B?<NT09`$yy@`,yy`|"gް|1gа| g|1g`a*`$y```H |rW hNN^NuNVB?<DNT ygJygyB@``pN^Nu"1001 "0"((4_errno___cpmrv___BDOS__errcpm__fds_os_abil_os_vers_osattr~~osattrL3L4(L5(L2L64L8nL9JL10RL7L11\L12dL13d_net_cheL14L15L16L17L18L19L20L1~~net_chL22L21L23    wrtchr.o`jNVh=|rBnp n(g -|t` n(g-|t n(g .м-@l nl0(| =@pBnz=n`=|` n  f.=|zJnrg 0.R@|l N2n| |Rn`\ n  fRJnpgLp2.z|A=@x0.nx|l^0.xnz` N2n| |Rn0.xSnxJ@fR ` N2n"n Q|R RnSnRnz nlJnf>0.S@@|/| ntNXJnfB@0.N^Nu__lstout__ttyout__fds__wrtchr~~_wrtch~fp~buf ~bytes~nbs~ii~cp|~colz~nspx~fnoutt~DoAsciir~DoXTabsp~tyblL2$L38L48L5bL8XL9pL12.L13zL14L15L10>L16L17L20L19L18L11.L10000>L7XL6`L1f lstout.o@`DNVH*nH|=G`HH.?<NT0SGJ@n0.JL N^Nu___BDO99NL16L $ $ $writeasc.o`hNVH*n(n >.B0-@B`r --@ -g-gF>"/</ 4/-/ N|g33p`U -"- S¼nB>!/</ 4/./ N|g33p`+n&M -|H4B0-@`  f < g< `SGR мdJGb мe6>"/</ 4/./ N|g .`&`U@JGf - o+m .`JGbJL8N^NuNVH*n>. `B0SGJ@nJL N^Nu_errno___cpmrv__errcpm__blkio__fds__wrtasc~~_wrtas~fp ~buff ~bytes~p1 ~cc~xsector~nsector~written~xbytesL4L3"L5L6L7L1L8L9L12"L11L13L14L100002L102L15tL16rL17xL18L19L2__wrtcle~~_wrtcl~ptr ~bytesL24L23L22L21  writebin.o`JNVH*nBn -=@B0.g-gB>"/</ 4/-/ N|g33p` -"- S¼o>Bg/ 4N\`F>!/</ 4B0.// N|g33p`XUB0.+@ -=@><nnc>.`|fBGJGc>/. B2.Ё/4NPnB0ѭB@0H@B@H@Ѯ nB@0n|gU@B0.+@`V>"/</ 4B0.// N|g33p`xU+|Rn neB@0.H=@>"B0.//. B0.// Nng33p`B@0.n>.OnB0ѭB@0H@B@H@Ѯ nJnc -"- S¼o>Bg/ 4N\`D>!/</ 4B0.// N|g33p``>/. / 4NPU@B0.+@B@0.nB0.ѭB@0.H@B@H@Ѯ - o+m B@0.JL N^Nu_errno_blkfill___cpmrv__errcpm__blkio_blkmove__fds__wrtbin~~_wrtbi~fp ~buff ~bytes~nbs~xsector~nsector~written~BufPosL2L3rL4rL1@L5L6L7L8L9"L10"L11L12L13L14L15bL164L17*L18L19L20L21:$ $,$$ $::_errmaL2 prtint.o`rNVH /?.?./ /. nN*@ мfB(n `%H|0|9o^G мfB JL0N^Nu___prtin~~__prti~pobj~buf ~base~signed~f~digs~dp ~k~p L2@L5XL4FL6VL3dL1hprtld.oX`NVH-|*n<.H n. nfz` |SEJgJEf`h nf$z ` |SEJgJEfJEf-`*n<.JngJGlB@0D@> n P-"n R`B0H@B0>JGf JL N^Nu__fds___prtsh~~__prts~pobj~pbuf ~base~signed~digs~n~p ~b~lnL2JL3JL6^L5LL4bL1dsbrk.o`jNVH >.HμgR*y(G.N|f3 3p`>Bg/ N\ JL0N^Nu_errno_brk_blkfill__break___cpmrv__errcpm__fds_sbrk~~sbrk~incr~t1 ~t2 ~incL2L3NL1` $,write.o|`&NVH>N*@ fp`vJnfB@`j-g3 3p`L0|g>/. / NP`0-g>/. / NP``>/. / NPJL N^Nu_errno___cpmrv__errcpm__wrtasc__wrtbin__chkc__wrtchr__fds_write~~write~fd~buff ~bytes~fp L2L1L3(L4FL5bL6L7, 4$channels.o`X>NVH|BG` f 0`RG|m33pJLN^NuNVp2.`F@HB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 3B`0B@0*@-f3 3B` JL N^Nu__fds @_errno_blkfill___cpmrv__errcpm__chvec__allocc~~_alloc~i~jL4&L5L6"L1@L3$L2,__freecJ~~_freecJ~chL7b__chinitf~~_chinif~iL11xL12r___chiniL10vL9~L8~~~__chin~i~ch ~p L13__chkc~~_chkc~ch~xcb L15L14;;bu~c~sp ~csave~n~nsL2"L1DL3~L4LL5~L6fL7~L8L9L10.L11L10000L12L13.L14< isatty.oH`|4NVH>N*@ fB@`-fB@`pJL N^NuNVH>N*@ fB@`0|JL N^NuNV>aJ@g <`BN^Nu___tname__chkc__fds_isatty~~isatty~fd~fp L2L1*L10000(L10001*_isdev4~~isdev4~fd~fp L4PL3V_ttyname`~~ttynam`~fdL6vL5x  malloc.o ` DNVH>.^GORG>a*@ fB` >/ aXJL N^NuNVH (y*T`ZB@0-BA2-@F@J@g>NB`:B@0-ne `*f>a*@ f>NB`(M*U`JL0N^NuNVH n*PB@0. X@me n `F(MB@0. HH@B@H@B@0-n 9@B@0,F@9@( n ;n B@0-F@;@# PJL0N^NuNVH >.|?GG0@>N*@fB`* R*@(M9GB@0,F@9@.Pa 9JL0N^NuNVH *nQB@0-BA2-@F@J@g>Np`(yeeecd(T`e2 BA2-IHABAHAЁ" BB4,JHBBBHB҂b #B@`n BA2-IHABAHAЁf T0(mB@0-F@;@ T*`* BA2,IHABAHAЁfB@0-lB@0,F@9@(`(#B@JL0N^NuNVH *n.a>. ^GORG>a-@fB`J n(PPg2d`Sn Jn f`B0. B0. `%Sn Jn f>/.aXJL0N^Nu_sbrk__errmal__afreeb__aflist_malloc~~malloc~nbytes~nmults~pp _findblo4L2 L1*_cutup~~findbl4~units~cp ~pp L7L6FL8hL4L9xL10_getmemo,L11L5~~cutup~pp~units ~cp ~np L14L15L13"~~getmem,~numu~mmp ~fbp ~utgL18ZL17_free~~free~fmp~cp ~pp L20L19L23L10000L21L10001L22L24L25FL26HL27xL28z_realloc~~reallo~ptr ~siz ~np ~nmults~ppL30L29L31L32L35L36L34L33L37L40L41L39L38   mallocnd.o`TNVN^NuNVN^Nu_malloc_~~mallocL1__errmal~~<<0009L27L31L32L10010L10012 L10013>L10015@L33HL34LL10016ZL10018`L10019L10021L35L36L10022L10024L10025L10027L37L38L39L40L41L42L43DL44DL45hL46hL47L48L49L50>L51L542L53L52>L57nL56VL55zL1 $$$$,4<D doprtfp.o4`NVJnlp`0.=@ n -@>/. /.NPN^NuNVJnlp`0.=@ n -@>/. /.NPN^NuNV>/. /.a~P-@. N2.^AAo>/. /.aP-@ .N^Nu_ftoa_etoa_strlen__fds__pftoa~~_pftoa~addr~buf ~prec~fpL10000L10002L14__petoa8~~_petoa8~addr~buf ~prec~fpL10003FL10005JL2l__pgtoap~~_pgtoap~addr~buf ~prec~spL4L3 fputn.o`pNVH *n>. (n,g$Bl >/ ?N\Gg lp`*B@`&`.H?NT|fp` 0SGJ@fB@JL0N^Nu_fputc_write__iob_fputn~~fputn~buf ~num~sp L2@L3N+@+@fm`2m>NJ@gm@`;| H"mR`-gA+H +@ mR-gz>/-?N\<Bm `n-g>< g -мb" -:>/-?N\<+mBm `( -:>/-?N\<;| +mFg mp`H|JL N^Nu_write_malloc__iob_isatty__flsbuf~~_fls==filesz.o`NVH>N*@ fp`^0|gB`P-g +m `0-H>N<.?<#NT>-H?NT <0.-0S-gJmʾg-gF>"/</ 4/-/ N|g33p`U>!/</ 4// N|g33p`R+G +@I4G`Rd f " Ҽ4ѭ`B` R+@+m U -JL8N^Nu_errno__chkuse___cpmrv___BDOS__errcpm__blkio__uchkus__chkc__fds__filesz~~_files~fd~fp ~p1 ~p2 ~xsector~xuserL2L1zL3,L4>L5lL6bL7\L8(L9L10L11(L14@L13>L10000JL12JL15`L16l< 4,$,$sprintf.ot`XNVHK;| .+@+@;|:./. / NP>.BgNT0JL N^Nu_fputc__doprt__iob_sprintf~~sprint~str~fmt ~args~stream~sp ~rvL1N doprt.o`NVH*nBnJ gh``BE-n `RRE nJg n %fJEo.?/. N\-n n n %@R DfBn n H|-@R Df n R Rn| <0fG n R =|<*f-M n=PT n R `8`*JnlBnH2. A|=@ n R <0m<9o|<.f BF n R <*f-M n<T n R `*`H2 A<| n R <0m<9oBn<lg<LfRn n R A-HH` RnJng <` <#.?<?< // N Jngp`pH`RnJng <` <#.Bg?< // N Jngp`pH`zRnJng <` <#.Bg?<// N Jngp`pH`&RnJng <` <#.Bg?<// N Jngp`pH`-M n-PX`-M n0|@B.T`H>?// N X|`~H>?// N X|`XH>?// N X|`4.H?NTRn``|C|5b@0@ PN.N:ElJFm:0.E=@JnfX .0f* n -f SE. nH?NTRRn`..H?NTRn0.SnJ@n.?/.N\n`..H?NTRn0.SnJ@n`0.JL N^NuDhHDhL_fputc_fputn___prtld___prtin___prtsh__petoa__pftoa__pgtoa_strlen__iob__fds__doprt~~_doprt~pb ~sp~fmt ~c~ppi~pw~padchar~s~buf~width~prec~len~n~nchrs~left~longf~fnL2~dblptrL3~L6zL5L9,L10&L8&L10000>L7>L11^L4~L12L13L14L15L18L17L19L10001L16L20(L21FL22pL25dL24HL10002pL23pL10003L26L28L29L30L10004L10006L10007L1>>/ 4/-/ N|g|-H>N:.?<NT||f|>-H?NT>N>NJFf0``33pJL N^Nu_errno_write___chini__chkuse__freec___cpmrv___BDOS__errcpm___xeof__blkio__uchkus__chkc_lseek__fds_close~~close~fd~fp ~rv~xuserL22L1 L3L4|L5hL6L7L8L9 L10 \,<dD L4T$,<fdecls.o$`8NVN^Nu   __iob___fdecl~~__fdecL1fflush.o0`NVH*n0-| |f, -<o >/-?N\>Gg mp`J-gJg-g;| `;| `>0- D@H/?N\Bm +mB@JL N^Nu_write_lseek__iob_fflush~~fflush~sp ~n~nsL2FL3FL1L4lL5jL6dL7jL8 open.o`>LNVHN>|fp`>N0*@Jn fUJnfU./.NXJ@f U0``./.NXJ@fU0`d>/.?N\J@g>N33p`0U>B-H?N\BWB-H?N\0JL N^NuNVBW?. /.a\N^NuNVBW?. /.a\N^NuNV>?. /.a\N^Nu_errno___chini___lname__allocc___tname__freec___cpmrv__errcpm___open__strcmp_lseek__fds__open~~_open~fname~mode ~xtype~ich~ch L2L1L3N*@ f3 3p`v0.`F+n `P . ѭ`F>N+@ - Ю +@`*33p`*`J@g|g|g`UJl+| -JL N^NuNV>B?.aB\N^Nu_errno___cpmrv__errcpm__filesz__chkc__fds_lseek~~lseek~fd~offs ~sense~fp L20L1L4|L56L3L6>L7HL8dL9_tell~~tell~fdL10$  ??9ZL38__toascjL37`L40hL6~L41L43WL42HL4~~_err~s1~s2 ~bufL46XL45<~~addarg@~ptr L48`~~_toascj~p ~c~buf ~f ~iL51L52L53L54L57FL58L59BL100052L10007@L56BL55NL62L63ZL64L10008L10010L61L60L50,4t4|d|dlLttDT<T$ \\D44creat.o@`"NVHN>|fp`>N0*@JnfU./.NXJ@f U0`R`./.NXJ@fU0`2>/.?N\J@g3#3p`U0JL N^NuNVBW?. /.a:\N^NuNVBW?. /.a"\N^NuNV>?. /.a\N^Nu_errno___chini___lname__allocc___tname___cpmrv__errcpm___open__strcmp__fds__creat~~_creat~fname~prot ~type~ich~ch L2L1L3NN^Nu__cleanu__exit_exit~~exit~codeL1 cleanup.o `2NVHBG`0м.NRG|mJLN^Nu_fclose__iob__cleanu~~_clean~iiL4"L5 L3 L2(L1( fclose.oX`XNVH*n0-|g*.N-g .NB@H+@+@Bm m>NJL N^Nu_free_fflush_close__iob_fclose~~fclose~sp L2@L30L1N close.o`*NVH>.>N*@ f3 3p`BF0|f-g6-f. - l>B?N\>/<?N\-g,>"/<@@|g`N^Nu_errno_os_abil___cpmrv___BDOS__errcpm_os_vers__fdsL1__ttyinr~~_ttyin~DoWait~icL52L4 L3LL62L2N_ttyinraX~~ttyinrX~chktype~chL9L10bL11pL7L12pL13vL14L15L8 ungetc.o0`RpNVH>.*n |fp`.-g$Jg -cS0"mRm 0`pJL N^Nu__iob_ungetc~~ungetc~ch~sp L2L1HL3Funlink.oP`FNVHN>lp`&>N>/.?N\<>N0JLN^Nu___chini__allocc__freec___open__fds_unlink~~unlink~filenam~ch~retL2L1< writel.o`fNVH*n -n`: .l .H` <>>/ ?.N\GfB0Jf .JL N^Nu_write_writel~~writel~buf ~fd~lnum~R~tmpL4NL3L10000(L10002.L2TL1\xmain.o`\ .NVH BWN##By.a*n`N`RJgHHм @fJg2 "g 'fFH>/ RNX(@ f./ aVX H> M2GBRG.Ra`BG`RG M2GJg5pHHм @gJ5pg M2GBRGH`BWNBW/ RNXJ@g.R/<aX`l>N ->f@>/ TNX|f>B?<N\|f.R/<a|X`$BW/ RNX|g.R/<.aVX`>?/ NXJf>*/ NXJg-|.4?<NT>/ ?<N\<f.=/ aX`^.H?/.aZ\.N>RWN(@./ NX.a>/ ?<N\<f`.a`|g`JfBaSy.N|f.W/<Ha*XB/9?9N\>NJL0N^NuNV|./NX. /NX.X/NX.?< NT>NN^NuNVH*n y XRyJL N^NuNVH*n. (nBBnG4H@HJ-g4-HS@=@ n m10.H H@|0:=|J-gJngS-H|`:=|`T K2n  gB0n3H|Hм @g0n3H|| `0n3H|Rn n m.=| `T K2n  gB0n3H|Hм @g0n3H|| `0n3H|Rn n mBJL8N^Nu: unmatched quoteCannot open Cannot append Cannot create : No matchStack Overflow $_strcpy_main_sbrk_exit_brk___pname___atab__salloc___BDOS_creata___open_strcat_opena_lseek_strchr_close_strlen__fdsL1L2L3___main~~__main~com~len ~i~s ~p ~c~pfd~tmpbuf_addargv@L7L84L118L106L10000PL9PL5L10001bL12L13L14__errL15~L18L19L17L10002L16L20L22jL23L24L25L21~L26L27fL10003TL28dL29L30L31L32.L33L10004L34bL35L36=L3AA_errno___cpmrv__errcpm__blkio__fds__rdasc~~_rdasc~fp ~buff ~bytes~p1 ~c~xsector~xbytesL4*L3L5L6L7|L1DL8L11L10L12L13L14L15L16L10000*L9*L20L17@ readbin.o`PNVH*n(n ..-G --@ -g -g-gF>"/</ 4/-/ N|g33p`U>!/</ 4/./ N|g33p`|+n&M -|H4`SR мdJnJf - o+m .`,RB -@Jo >!/./ /./ NH,ݮ ѭ   - o+m gU .`Jf .`-gD>"/</ 4/-/ N|g33p`fU>!/</ 4/./ N|g U .`,+n߭G4`SJn - o+m .JL8N^Nu_errno___cpmrv__errcpm__blkio__fds__rdbin~~_rdbin~fp ~buff ~bytes~p ~xsector~nsector~xbytes~iL2 L3L4L5L1FL6L9L8L10000L7L10L11L12PL13xL14L15L16L17L18L21.L20*L192L22B   swab.o$`6NVH *n(n >.`FUGTTJGnB@JL0N^Nu_swab~~swab~fr ~to ~num~tL4&L5L3 L2*L1,ttyin.o`NVH *n n(g .N ndB@0.`0<=@B@0.@ nf&B?<NT@| . fB.`.?< NT.H|=@B@0.nd. ?<NTI`& f nP "Ҽ`.SnSnJncJnbJnc R "ҼJL0N^NuRaw I/O___BDOS__optoff__fds__ttyin~~_ttyin~buff ~fp~bytes~p ~ttybuf~xbytes~nbs~tybL2$L3L100004L100028L4tL5rL6L7L10L9L11L1L10003L8L12 ttyinraw.o `NVH`(JngJGg0JLN^NuNV0.`09gB@`:BWa`4B?< NT`$>at``J@gڰ|g|gBBL105L106L107~~_ismem~c ~set ~invert~rvL10010L10011L10012L10014L109 $$,fgetc.o`8pNVH*nSm m mH|R` `.NJL N^Nu__filbuf__iob_fgetc~~fgetc~sp L2&L1.L3.filbuf.oL`BNVH*n-fp`-g m p`Jf&-f>N+@fm`m-g0Hм+@f9g .N-g>`>/-?N\;@ Jm n m fm0`m p`Sm +m mH|RJL N^Nu_malloc_fflush__iob_read__filbuf~~_filbu~sp ~onebufL2L3L1L4.L5ZL10000LL6TL7ZL8pL9L10001L10003L10L11L12 read.o`&NVH>N*@ fp`-gB@`t-g3 3p`T-g>/. / NP`8-gB0../. / NP``B0../. / NPJL N^Nu_errno___cpmrv__errcpm__rdasc__rdbin__chkc__ttyin__fds_read~~read~fd~buff ~bytes~fp L2L1L3,L4JL5fL6L7, 4$readasc.ox`NNVH*n(n ..-G` --@ -g-gF>"/</ 4/-/ N|g33p`U>!/</ 4/./ N|gU .`+n&M -|H4`FS .fU - o+m .`H` . fRR` SRR мdJnJn - o+m .JL8N^NuClo68 -r -u_nofloat -o $1.68k 0:s.o $1.o $2.o $3.o $4.o $5.o $6.o $7.o $8.o $9.o 0:clib lo68 -r -o $1.68k 0:s.o $1.o $2.o $3.o $4.o $5.o $6.o $7.o $8.o $9.o 0:clib 0:libf.a CR@;@ ./NXA+H +@./. / NPJL N^Nu_strcpy__doscan_strlen__iob_sscanf~~sscanf~str~fmt ~ptrs~sp ~spbuf~locbufL1^ doscan.o`~NV`H*nBn`HHм @gT n R HHм @f.N<|fp`r0Ff.?NTJgN<%g8.N<|fp`6H@g.?NT0.``` n R Bn<*fRn n R :<`$|fBEH2 A:| n R <0m<9oBnBn<lfRn n R `<hfRn n R H`T=| `=|`=|HHм @gRn.N<|fp`>0FfJng A-H` n-PXBn|+g|-f"|-fRnSE.N<|fp`BBn`0Fg0|`0<=F n0m nFnv n9o nAmdn0 n o 0._@=@0.nlBRn/.0n/NP2.HЁ-@.N<|fp`:0SEJ@n\.?NTJnf0.`Jng .D-@Jng n `Jng ."n2` ."n2JnfRn`.N<|fp`<sf<-|x``.N<|fp`BW/.`?a\J@f=|`<cf-||`|fz=|`bBn n H|^@R Df=| n R Ad-H`` n`R` n R Jg<]f n`BAd-H`Jng A-H` n-PX`"0"nR.N<|fp`0SEJ@o>/.`?a\J@f.?NT<cg nBJnfRn`ZHHм @gRn.N<|fp`D0FfJng A-H` n-PXAd-H``L0"n`R`|0m|9o|.g|eg|Eg |-g|+f.N<|fp`0SEJ@n.?NTS` n`BJng/./dNX _ `/./dNX _ JnfRn`H.N<|fp`LH@g.?NT0.`2``H |rW h8N n HR J@fN0.JL N^NuNVH. H>/. NX>Jng JGgB@`p`0JLN^Nu%DEFOX[cdefosxlL\\T\L\\T\l ___atablmul_ungetc_fgetc__atof_strchr__iob__doscan~~_dosca~sp ~fmt ~aps~c~ni~noassig~invert~numfoun~longf~shortf~width~tval~base~nitems~val~locval~locbuf~db~setbufd~sb`L4L3L5|L8(L72L6FL11FL12\L1L10\L9jL2L13L14L15L16L17L20L19L21L10000L18L220L23DL24DL26L27LL28LL29bL30TL31TL32\L33\L34zL37zL38L36L35L39L40L10001L41L42L43L46L45L10002L10004L44L10005:L47RL48L49L50L51L52L53L54L55L25L56L57L58L59L60ZL61xL64>L63(L65>__ismemL62PL66L67xL68|L69pL70L71L74L75L73L10006L72L76L77L80L79L81L100076L786L82NL83XL84\L85\L86\L87\L88tL91tL92L90L89L93L94L97 L96L10009L10008L95L98 L99HL100`L101jL102lL103lL104Dcp68 -i 0: $1.c $1.i c068 $1.i $1.1 $1.2 $1.3 -f era $1.i c168 $1.1 $1.2 $1.s era $1.1 era $1.2 as68 -l -u -s 0: $1.s era $1.s lo68 -r -o $1.68k 0:s.o $1.o $2.o $3.o $4.o $5.o $6.o $7.o $8.o $9.o 0:clib 0:libe.a Drand.o`&NVHBGBF`B@0HH@B@H@м @0@RF|eRy09|mBy0y0B@0HJLN^NuNVH3>.|?`a~SGJGfatJLN^Nu^09_} L1L2_rand~~rand~tot~iiL6(L7L5&L4.L8FL3\_srandf~~srandf~seed1~ncsL12L13L11L10L9readl.o`fNVH*n -n`: .l .H` <>>/ ?.N\GfB0Jf .JL N^Nu_read_readl~~readl~buf ~fd~lnum~R~tmpL4NL3L10000(L10002.L2TL1\rename.oH`BNVHK./.NX|f33p`-HK./. NX|f33p`~J-g*JGg -H@g33p`R-H>N<.?<NT=@>?NTJng3$3p`B@JL N^Nu_errno__parsef__chkuse___cpmrv___BDOS__errcpm__uchkus__fds_rename~~rename~from~to ~fcbbuf~fcbp ~nuser~xuser~rvL28L1L3nL4L5L6 , ,,$4,strrchr.o`\NVH *n. (M`RJf` fB`Sf JL0N^NuNVH*n. H>/ aXJL N^Nu_strrchr~~strrch~str ~ch~t L4L5L3L2L8&L9L10$L1,L7$L6*_rindex6~~rindex6~str ~chL11Rscanf.oX`BNV. /./<NPN^NuNV./. /.NPN^Nu__doscan__iob_scanf~~scanf~fmt~ptrs L1_fscanf"~~fscanf"~sp~fmt ~ptrsL2> setbuf.o `B~NVH *n(n Jgp` +@+@ fm`mB@JL0N^Nu__iob_setbuf~~setbuf~sp ~buf L2L18L30L46sgtty.oH` NVH>N*@ g-fp`>/ /. NPB@JL N^NuNVH>N*@ g-fp`>/. / NPB@JL N^Nu_blkmove__chkc__fds_stty~~stty~fd~argp ~fp L10000 L2$L1>_gttyH~~gttyH~fd~argp ~fp L10001hL4lL3  sscanf.o`hNVHK:;|.NEcp68 -i 0: $1.c $1.i c068 $1.i $1.1 $1.2 $1.3 -e era $1.i c168 $1.1 $1.2 $1.s era $1.1 era $1.2 as68 -l -u -s 0: $1.s era $1.s /****************************************************************************/ /* */ /* L o n g j u m p H e a d e r F i l e */ /* --------------------------------------- */ /* */ /* Copyright 1982,83 by Digital Research. All rights reserved. */ /* */ /* Long jumps are implemented as follows: */ /* */ /* 1). Routine "setjmp" is called to setup a special */ /* buffer for return. The return address, stack  */ /* pointer and frame pointer are saved. This allows */ /* the calling program to do the proper number of */ /* "pops". */ /* */ /* 2). At some later time, the procedure "longjmp" is */ /* called. The programmer sees a return from the */ /* previous "setjmp" as the result. */ /* */ /* Calling sequence: */ /* */ /* #include (definitions) */ /* jmp_buf env; (define a buffer for saved stuff) */ /* */ /* setjmp(env); */ /* a: */ /* */ /* longjmp(env,val); */ /* */ /* Setjmp returns a WORD of 0 on first call, and "val" on the */ /* subsequent "longjmp" call. The longjmp call causes execution to */ /* resume at "a:" above. */ /* */ /****************************************************************************/ typedef long jmp_buf[13]; ****************************************************/ typedef long jmp_buf[13]; E_sys_ner_perror~~perror~str~err ~lbuf~bufL10000L4&L58_sys_errL6L7__itoa(L8L3~~_itoa(~bp ~nmL11L14LL13JL12PL10RL15L16L17L18L19L20L21/L22GL23bL24}L25L26L27L28L29,  ,  , $printf.oX`BNV. /./<NPN^NuNV./. /.NPN^Nu__doprt__iob_printf~~printf~fmt~args L1_fprintf"~~fprint"~sp~fmt ~argsL2> putl.od`BNVHKBG`. H?NT|fp` RG|m .JL N^Nu_fputc__iob_putl~~putl~lnum~sp ~i~p L4.L5L6,L18L3,L24puts.o@`LNVH*n`.H?NT|fp`Jf.?< NTJL N^Nu_fputc__iob_puts~~puts~str L4,L3L5,L1BL20  putw.od`BNVHKBG`. H?NT|fp` RG|m0.JL N^Nu_fputc__iob_putw~~putw~wrd~sp ~i~p L4.L5L6,L18L3,L24qsort.o$`NVH n o.BG<. SF0H*@`RGFl/ 0HЮ/ nNPJ@o`SFGo/ 0HЮ/ nNPJ@l޾Fl&>0HЮ/0HЮ/aPFm>/ 0HЮ/aP0. S@G@l>.?.?/.a,P.?.?. SW0W0R@HЮ/aP`<.?.?. SW0W0R@HЮ/aP.?.?/.aPB@JL N^NuNVH *n(n >.g` RR0SGJ@nJL0N^Nu_qsort~~qsort~bas~num ~siz~cmp~i~j~pivline L2>L5(L8,L7*L10000LL6LL11PL10NL10001pL9pL12__swapJL4L3L13L14>L1@~~_swapJ~a ~b ~wid~tmpL17vL20nL21dL19jL18vL16vF /* * errno.h - error codes */ #define EPERM 1 #define ENOENT 2 #define ESRCH 3 #define EINTR 4 #define EIO 5 #define ENXIO 6 #define E2BIG 7 #define ENOEXEC 8 #define EBADF 9 #define ECHILD 10 #define EAGAIN 11 #define ENOMEM 12 #define EACCES 13 #define EFAULT 14 #define ENOTBLK 15 #define EBUSY 16 #define EEXIST 17 #define EXDEV 18 #define ENODEV 19 #define ENOTDIR 20 #define EISDIR 21 #define EINVAL 22 #define ENFILE 23 #define EMFILE 24 #define ENOTTY 25 #define ETXTBSY 26 #define EFBIG 27 #define ENOSPC 28 #define ESPIPE 29 #define EROFS 30 #define EMLINK 31 #define EPIPE 32 /* math software */ #define EDOM 33 #define ERANGE 34 /* hereafter is available to CP/M specials */ #define ENODSPC 35 #define ERENAME 36 /****** end of errno.h ******/ ME 36 /****** end of errno.h ******/ /**************************************************************************** * * C P / M C R U N T I M E L I B H E A D E R F I L E * ------------------------------------------------------------- * Copyright 1982 by Digital Research Inc. All rights reserved. * * This is an include file for assisting the user to write portable * programs for C. All processor dependencies should be located here. * ****************************************************************************/ /* * Standard type definitions */ #define BYTE char /* Signed byte */ #define UBYTE char /* Unsigned byte */ #define BOOLEAN int /* 2 valued (true/false) */ #define WORD int /* Signed word (16 bits) */ #define UWORD unsigned int /* unsigned word */ #define LONG long /* signed long (32 bits) */ #define ULONG unsigned long /* Unsigned long */ #define REG register /* register variable */ #define LOCAL auto /* Local var on 68000 */ #define EXTERN extern /* External variable */ #define MLOCAL static /* Local to module */ #define GLOBAL /**/ /* Global variable */ #define VOID /**/ /* Void function return */ #define DEFAULT int /* Default size */ #define FLOAT float /* Floating Point */ #define DOUBLE double /* Double precision */ /****************************************************************************/ /* Miscellaneous Definitions: */ /****************************************************************************/ #define FAILURE (-1) /* Function failure return val */ #define SUCCESS (0) /* Function success return val */ #define YES 1 /* "TRUE" */ #define NO 0 /* "FALSE" */ #define FOREVER for(;;) /* Infinite loop declaration */ #define NULL 0 /* Null character value */ #define NULLPTR (char *) 0 /* Null pointer value */ #define EOF (-1) /* EOF Value */ #define TRUE (1) /* Function TRUE value */ #define FALSE (0) /* Function FALSFbL14hL15hL4L16lL17vL18L19L20L6L5~~_conou~buffer ~count~os_func~xcountL25L24L23L22 gets.od`HNVH*n-M`.N>|g| fB|fB` .JL N^Nu_fgetc__iob_gets~~gets~str ~c~savL4L3L10000.L2.L5:L1> getw.o`2pNVH *nI.N.N0.JL0N^Nu_fgetc__iob_getw~~getw~sp ~w~p L1(main.oH`NVHNBW/<NX>/<NX>/<NX n2n B*n`&HHм @g H| `HRJf> /.NXJL N^Nu_open___tname___atab__chinit___main__fds__main~~_main~com~len ~s L4zL5TL10000rL10002vL3xL2~L1   $mktemp.o`z NVH *n(M` Jf `XR xg Xf 9Am 9ZoA9H>N?/</ N R9 JL0N^NuAX%04.4d%c_getpid_sprintfL1_mktemp~~mktemp~templat ~ss L5L6L7L2pL4L10000&L3&L10001:L8BL9 getpid.o`` *NV0<N^Nu_getpid~~getpidL1optoff.o`f:NV4./8NX./8NX. /8NX.8?< NT>NN^NuC RTL - program not linked for Program terminating $_strcpy___BDOS_strcat__exit__fds__optoff~~_optof~msg~buf8L2L3 L1b perror.o `\NVHJym09ym*|`0y*P.N>/.?<N\>/<?<N\.N>/ ?<N\>/<?<N\.?9aT-@Jyg n.R.?9aXT-@ n)R n R nB.N>/?<N\09JL N^NuNVH*n >/</ NP`RJf JL N^NuError undefined%/Gb}: (%dENOENT No such fileEIO I/O errorE2BIG Arg list too longEBADF Bad file numberENOMEM Not enough coreEACCES Permission deniedEINVAL Invalid argumentENFILE File table overflowEMFILE Too many open filesENOTTY Not a typewriterEFBIG File too bigENOSPC No space left on deviceEROFS Read-only file systemENODSPC No directory spaceERENAME Can't rename file_errno_write___cpmrv__errcpm_sprintf_strlen__fdsL1GE value */ /****************************************************************************/ /****************************************************************************/ ************************************************/ /***************************************************************************** * * C P / M C H E A D E R F I L E * ----------------------------------- * Copyright 1982,83 by Digital Research Inc. All rights reserved. * * This is the standard include file for the CP/M C Run Time Library. * *****************************************************************************/ /* */ #include /* Portability Definitions */ /* */ /**************************************************************************** * Stream I/O File Definitions *****************************************************************************/ #define BUFSIZ 512 /* Standard (ascii) buf size */ #define MAXFILES 16 /* Max # open files ( < 32 ) */ struct _iobuf { /* */ WORD _fd; /* file descriptor for low level io */ WORD _flag; /* stream info flags */ BYTE *_base; /* base of buffer */ BYTE *_ptr; /* current r/w pointer */ WORD _cnt; /* # chars to be read/have been wrt */ }; /* */ #ifndef FILE /* conditionally include: */ extern struct _iobuf _iob[MAXFILES]; /* an array of this info */ #define FILE struct _iobuf /* stream definition */ #endif /************************************/ #define NULLFILE ((FILE *)0) /* Null return values */ /* flag byte definition */ #define _IOREAD 0x01 /* readable file */ #define _IOWRT 0x02 /* writeable file */ #define _IOABUF 0x04  /* alloc'd buffer */ #define _IONBUF 0x08 /* no buffer */ #define _IOERR 0x10 /* error has occurred */ #define _IOEOF 0x20 /* EOF has occurred */ #define _IOLBUF 0x40 /* handle as line buffer */ #define _IOSTRI 0x80 /* this stream is really a string */ #define _IOASCI 0x100 /* this was opened as an ascii file */ /************************************/ #define stdin (&_iob[0]) /* standard input stream */ #define stdout (&_iob[1]) /* " output G6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/./. /.a N^NuNVBW/./. /.a N^NuNV>/./. /.a N^Nu__creat_fclose__open_lseek__iob__freope~~_freop~name ~mode ~sp ~ascii~fdL2(L1L100004L3JL4L10001VL5L6L7L8L10002L9L10L11L10003L12L13L14_freopen~~freope~name~mode ~spL15_freopa ~~freopa ~name~mode ~spL16<_freopb@~~freopb@~name~mode ~spL17^ fseek.o`hNVH*n.N|fp`,>/. ?N\-@m fp`B@JL N^NuNVBWB/.aPN^Nu_fflush_lseek__iob_fseek~~fseek~sp ~offs ~sense~pL2L1JL10000HL10002J_rewindT~~rewindT~spL3d ftell.op`NVH *n>NJ@gB`~0-|g>B?N\.fp`Jf `x --@ޮ-gJo 0- HЮ-gD-g(m`  fRRe`$Jo (m0- HS`  fSSd JL0N^Nu_lseek__iob_isatty_ftell~~ftell~sp ~filepos~bp ~nreadL2L1L3L4LL5XL6L7L8L9L12L13L14L11L10L15L16L19L20L21L18L17fwrite.o`PNVH *n(nBG`(BF`.H?NT|fB@`RFn mRGnm0.JL0N^Nu_fputc__iob_fwrite~~fwrite~buff ~sp ~siz ~num~jj~kkL4/.NX?/.a\> /<a X <N^NuNVH*nBGBWN|=@`6JGoSGS`BBG`N0.RG0R@n mB``H |rW hN`JL N^NuNVH*n>. <.`HH.?NT0SGJ@nJL N^Nu lXhhbXv_exit___BDOS_ttyinra_strlen__fds_getpass~~getpas~prompt~ibufL2__conout__noecho8L14~~_noech8~bf ~ln ~cur~chL7FL9L10XL11XL12`L8L13H " */ #define stderr (&_iob[2]) /* " error " */ /************************************/ #define clearerr(p) ((p)->_flag &= ~_IOERR) /* clear error flag */ #define feof(p) ((p)->_flag & _IOEOF) /* EOF encountered on stream */ #define ferror(p) ((p)->_flag & _IOERR) /* error encountered on stream */ #define fileno(p) ((p)->_fd) /* get stream's file descriptor */ #define getchar() getc(stdin) /* get char from stdin */ #define putchar(c) putc(c,stdout) /* put char to stdout */ #define putc fputc #define getc fgetc /****************************************************************************/ /* */ /* M A C R O S */ /* ----------- */ /* */ /* Define some stuff as macros .... */ /* */ /****************************************************************************/ #define abs(x) ((x) < 0 ? -(x) : (x)) /* Absolute value function */ #define MAX(x,y) (((x) > (y)) ? (x) :  (y)) /* Max function */ #define MIN(x,y) (((x) < (y)) ? (x) : (y)) /* Min function */ #define max(x,y) (((x) > (y)) ? (x) : (y)) /* Max function */ #define min(x,y) (((x) < (y)) ? (x) : (y)) /* Min function */ /*************************** end of stdio.h *********************************/ ***************** end of stdio.h *********************************/ exdoprtfp.o`pNVJnlp`0.=@ n -@>/. /.NPN^NuNVJnlp`0.=@ n -@>/. /.NPN^Nu_ftoa_etoa_pftoa~~pftoa~addr~buf ~prec~fpL10000L10002L14_petoa8~~petoa8~addr~buf ~prec~fpL10003FL10005JL2l ftoa.o`NVH-n Jnnp` nop`0.R@8BG/.B@H/NX/NPo n -R /.NX-@/</.NPo.`/<D/.NP-@SG/<A/.NPm`/<D/.NP-@RG/<D/.NPlG|0H/NX-@`/<D/.NP-@RFDm/<B/.NP//.NP-@/<D/.NPm -|ARGJGl4 n 0R n .R JDlD|` n 0R SFGnBF`j/.NX:0|0"n R Gf n .R 0H/NX-@//.NP-@/<D/.NP-@RFDm n BR .JLN^Nu_fpadd_fpltof_fpftol_fpneg_fpcmp_fpmult_fpdiv_fpsub_ftoa~~ftoa~x~str ~prec~ie~i~k~ndig~savstr~yL10000L10002*L10003$L10005*L2hL3L6L5~L4L9L8L7L12L13L11L10 L14NL15L16pL19L20tL18L17L23L24L25L22L21L1 $$,$4$HL4dL54L10000VL10002\L3dL2hL8L7pL9L6L1 D<<D,,$4fdopen.o`NVH >.*n JGm>B?N\|fB`xBF`|lRF0(@0,|f|mB`H rg* Rg$l ag Af>B?N\`lBl 8B)@)@ JL0N^Nu_lseek__iob_fdopen~~fdopen~fd~mode ~sp ~iiL10000*L20L1L5. (n&M`Ƽ| gSGo.N<|fB|fB` JL8N^Nu_fgetc__iob_fgets~~fgets~str ~maxc~sp ~c~sav L4 L3L24L100004L5@L1Bfopen.o`fNVH*n(n BG`|lRG0&@0+|f|mB` wg Wf>?</ N\<`p ag Af>>?</ N\<l>?</ N\<`>B?N\`$ rg Rf>Bg/ N\<`B`@JFlB`8Bk 6B'@'@ rg Rf7|`7|Jnfk JL8N^NuNVBW/. /.aPN^NuNVBW/. /.aPN^NuNV>/. /.aPN^Nu__creat__open_lseek__iob__fopen~~_fopen~name ~mode ~ascii~sp ~ii~fdL4L5L24L3L6@L1L10000LL7dL8L10001pL9L10L11L12L10002L13L14L15L10003L16L17L18_fopen~~fopen~name~mode L190_fopena4~~fopena4~name~mode L20H_fopenbL~~fopenbL~name~mode L21b  fputs.oD`@NVH *n(n BG`.H?NT>|fp`Jf0JL0N^Nu_fputc__iob_fputs~~fputs~str ~sp ~rvL40L3L50L16L24fread.o`N4NVH *n(nBG`&BF`.N:|f0``RFn mRGnm0.JL0N^Nu_fgetc__iob_fread~~fread~buff ~sp ~siz ~num~jj~kk~chL4:L5L82L9L10.L1DL110L70L68L38L2@freopen.o`bNVH*n(n &n.N|fB` wg Wf>Bg/ N\>`n ag Af<>?</ N\>l>Bg/ N\>`>B?N\`$ rg Rf>Bg/ N\>`B`@JGlB`8Bk I 44$ <,etoa.o`&ZNVH-n Jnnp` nop`0.R@8BG/.B@H/NX/NPo n -R /.NX-@/</.NPo.`/<D/.NP-@SG/<A/.NPm`/<D/.NP-@RG/<D/.NPl|0H/NX-@`/<D/.NP-@RFDm/<B/.NP//.NP-@/<D/.NPm -|ARGBF`j/.NX:0|0"n R JFf n .R 0H/NX-@//.NP-@/<D/.NP-@RFDm n ER JGl0D@> n -R 0H |0"n R 0H H@|0"n R n BR .JLN^Nu_fpadd_fpltof_fpftol_fpneg_fpcmp_fpmult_fpdiv_fpsub_etoa~~etoa~x~str ~prec~ie~i~k~ndig~savstr~yL10000L10002*L10003$L10005*L2hL3L6L5~L4L9L8L7L12L13L11L10 L14LL17L18PL19~L16L15L20L1 $$,$4$ 44$ <,atof.o`VNVH KIBnBn`R n  g n  g n -gB@`p=@ n -g n +fR`$ n .fRn` nJngRnR nJg n eg n EfB n eg n EfDR n -gB@`p=@ n -g n +fR` nR nJfB.a-@.N=@Jng 0.D@n`0.ܐn=@/.?.a:T/NP-@.N-@Jng .JL0N^NuNVJnl,-|A`/<D/.NP-@RnJnm`*-|A`/<D/.NP-@SnJnn .N^NuNV-|`D/<D/.NP-@/. nH|H/NX/NP-@R n 0m n 9o .N^Nu_atoi_fptoffp_fpadd_fpltof_fpmult_fpdiv_atof~~atof~buf~ibuf~ebuf~ip ~ep ~ffp~dp~esign~isign~ebin~places~ibin~fpL4L3L22L10000@L10001BL10002ZL5^L8L7`L9pL10L11L10003L6L10004L12L10005L10006L10007L13L16L15L14_strbinL100080L100108_power10L17rL1v~~power1~pwr~fL19L22L23L21L20L24L27L28L26L25L18~~strbin~p~fL32:L33L316L10011NL30NL29R$ Inofilesz.o`TNVN^NuNV0<N^Nu_nofiles~~nofileL1__filesz~~_filesL2nofloat.o`XNVN^NuNV.NN^NuNV.NN^NuNV.NN^NuNV.NN^Nufloating point__optoff_nofloat~~nofloaL1___nofloL2__petoa~~_petoaL3__pftoa~~_pftoaL4,__pgtoa0~~_pgtoa0L5@__atofD~~_atofDL6Tnolong.o`~NVN^NuNV.NN^Nulong int conversion__optoff_nolong~~nolongL1___nolonL2___prtld~~__prtlL3nottyin.o`~NVN^NuNV.NN^Nutty input__optoff_nottyin~~nottyiL1L2L3__ttyin~~_ttyinL4access.o@`jPNVHBW/.NX>m >NB@`33pJLN^NuNV> /.aXN^NuNVBW/.aXN^Nu_errno_open___cpmrv__errcpm_close__fds_access~~access~fname~mode ~rvalL2&L1:_chmodD~~chmodD~name~mode L3T_chownX~~chownX~name~owner ~groupL4f $atoi.o`nNVH*nBGBF`RHHм @f +fR` -fRRF` H@| 0m 9oJFg0D@>0JL N^Nu___atab_atoi~~atoi~str ~val~isnegL4L3L2(L52L6L10000XL8XL11bL1datol.o$`~ NVH*nBBF`RHHм @f +fR` -fRRF`/< /NP.H|Hހ 0m 9oJFg D. JL N^Nu___atablmul_atol~~atol~str ~val~isnegL4L3L2(L52L6L10000hL8hL11rL1t calloc.o`pNVH>N*@ fB`>Bg/ N\ JL N^NuNVHB>. B@0.H@B@H@//NP. >aJLN^Nulmul_blkfill_malloc__fds_zalloc~~zalloc~nbytes~rp L2L1._calloc8~~calloc8~nelem~sizelem ~sizeL3f exec.o`NVHN./NX.N>`06pHHм @g 6pH|`6pH2G@SGlK X`(./NX./NXJf.N@.?<NTB?</NT33pJL N^Nu _errno_strcpy___atab__cleanu___cpmrv___BDOS__errcpm_strcat_strlen__fds_execl~~execl~name~arg0 ~args ~cmdline~iJ,$$ffptof.o`NVHJfp` .: .м> .-@/.NX-@/<Y/.NP-@`/<B/.NP-@RGJGm`/<B/.NP-@SGJGnJEg/.NX-@ .JLN^Nu_fpltof_fpneg_fpmult_fpdiv_ffptof~~ffptof~lf~exp~count~fsign~fL2L1L5L4jL3L8L7L6L9 ftoffp.o`^NVH/</.NPfB`/</.NPl/.NX-@z`BEBG`RG/<B/.NP-@/<A/.NPl`SG/<B/.NP-@/<@/.NPm/<Y/.NP-@/.NX-@ .-@|@0|HJEg .JLN^Nu_fpftol_fpneg_fpcmp_fpmult_fpdiv_fptoffp~~fptoff~f~exp~count~sign~lL2"L1L3JL4LL7hL8PL6RL5|L11L12~L10L9L13 $fabs.o`8NV .-@ .N^Nu_fabs~~fabs~fL1floor.o`fNVH/.B@H/NX/NPo/<@/.NP-@/.NX./NX-@ .JLN^Nu_fpltof_fpftol_fpcmp_fpsub_floor~~floor~x~i~retvalL2N``|gΰ|gְ|g>NN^NuNVH*y`,B@0-BA2-@F@J@g >ap`*UfB@``JL N^Numalloc() error: corrupt arena malloc() error: out of memory free() error: pointer was not from malloc() _exit__afreeb__aflist_printf__errmal~~_errma~etypeL36L4 L5L2HL6L7L8&L9>L1R_malloc_V~~mallocV~cp L13L12fL14L10L15L11noascii.oT`0NVN^NuNV.NN^NuNV.NN^Nuascii disk i/o rtns__optoff_noascii~~noasciL1___noascL2__rdasc~~_rdascL3__wrtasc~~_wrtasL4,nobinary.oX`0NVN^NuNV.NN^NuNV.NN^Nubinary disk i/o rtns__optoff_nobinar~~nobinaL1___nobinL2__rdbin~~_rdbinL3__wrtbin~~_wrtbiL4,nodisk.o`XNVN^NuNV.NN^NuNV.NN^NuNV.NN^NuNV.NN^Nudisk i/o rtns__optoff_nodisk~~nodiskL1___nodisL2__rdasc~~_rdascL3__rdbin~~_rdbinL4,__wrtasc0~~_wrtas0L5@__wrtbinD~~_wrtbiDL6TK`8NVH..N LN^Nuffpcoscos_cos~~cosfppwr.o` 8NVH..,. N LN^Nuffppwrpow_pow~~powfpsin.o`8NVH..N LN^Nuffpsinsin_sin~~sinfpsqrt.o`8NVH..N LN^Nuffpsqrtsqrt_sqrt~~sqrtfpexp.o`8NVH..N LN^Nuffpexpexp_exp~~expfplog.o`8NVH..N LN^Nuffploglog_log~~logltof.o8`NVHJl| .D-@`BFJfB`^~` .-@R .f` .-@S. g .-@޼@ JFg .JLN^Nu_fpltof~~fpltof~l~exp~signL2L3L4(L1L78L8,L66L5DL11RL12FL10PL9ZL13ftol.oT`&NVH .м<JgJFlB`V .:|oJEg <` <`0..μ|`RFJFm`SFJFnJEg D. JLN^Nu_fpftol~~fpftol~f~l~exp~signL10000$L2(L1~L3NL10001FL10003LL6dL7`L5bL4hL10nL11jL9lL8rL12|fpmul.o` TNVH..,. N LN^Nuffpmul2fpmul_fpmulfpmult_fpmult~~fpmulfpneg.o`8NVH..N LN^Nuffpnegfpneg_fpneg~~fpnegfpsub.o` 8NVH..,. N LN^Nuffpsubfpsub_fpsub~~fpsubffppwr.o`*TJj <a<NuNHNL8Nffpexpffpmul2ffpcpyrtffplogffppwrfpppos ffpsin.o@`z0?<`$?<`?<`<bTJNuBgJk<8cH~$<cP<c <L~TNu,<>.N<<XDxB묈<΄,<CN,.N$(< .BJk<FD<c~䯾o$`<D<c~DDl`z,kinvt@nkfactb@fpscom*fpschl fpschmfpsrtifpsnlrfpsgprJfpsnmifpssh1fpspckfpsckmfpssh2fpsnckfpsap2fsinlpfsbmi fscomfssincos>fsdualPfsfloat\fstinf6fsinfrt.fssineBfsfnegldobranchtfsfzroh Kfsfrtn4fsfplsfsfcontfsfnrm2ffpcpyrt.o`Dmc68343 floating point firmware (c) copyright 1981 by motorola inc.ffpcpyrt@atoi.o`nNVH*nBGBF`RHHм @f +fR` -fRRF` H@| 0m 9oJFg0D@>0JL N^Nu___atab_atoi~~atoi~s ~val~isnegL4L3L2(L52L6L10000XL8XL11bL1dechannel5.oL``hNVN^NuNVH|BG` f 0`RG|m33pJLN^NuNVp2.`F@HB@N^NuNVHBG`>aRG|mJLN^NuNVH 0.*@0.@BUB-+|BB > Bg/ N\> ?< / N\JL0N^NuNVH>.|e3 3B`0B@0*@-f3 3B` JL N^Nu__fds_errno_blkfill___cpmrv__errcpm_maxfile~~maxfilL1__chvec__allocc~~_alloc~i~jL5.L6L7*L2HL4,L34__freecR~~_freecR~chL8j__chinitn~~_chinin~iL12L13z___chiniL11~L10L9~~__chin~i~ch ~p L14__chkc~~_chkc~ch~xcb L16&L15VL17T $ $ $xmainnw.o H`R RNVH BWN##By.a>*n`v`RJgHHм @fJgZ "g 'fFH>/ RNX(@ f./ a~X H> M2GBRG.Ra`BG`RG M2GJg5pHHм @gJ5pg M2GBRGH`BWNBW/ RNXJ@g.R/<aX`>N ->f@>/ TNX|f>B?<N\|f.R/<aX`$BW/ RNX|g.R/<.a~X`.a`|gr`JfBaSy.N|f.L/<=a*XB/9?9N\>NJL0N^NuNV|./NX. /NX.M/NX.?< NT>L ,ffpsqrt.o$`<a<NugPk dR< HC6<(*,A4.< ` (؄*[ZcR FHCNu@ @ ffpcpyrtffpsqrt fpsinvfpsrtn`fpsevenfpstblbfpsentLfpsone@fpszeroDfpsfinXffpabs.ot`8<NuJg Nuffpcpyrtffpabsffpnegffprtnffpadd.o` gR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNuffpcpyrtffpdiv$fpddzrfpdovffpdrtnfpdov2fpdovfsfpdouffpdund fpdnovJfpdqokrfpdisnffpexp.oP`4<Jj~`~<L~Nu.<AOJNuH~?g<$,<;ANi<`D<o< l",kinvt@nkfactb@fpscom*fpschl fpschmfpsrtifpsnlrfpsgprJfpsnmifpssh1fpspckfpsckmfpssh2fpsnckfpsap2fsinlpfsbmi fscomfssincos>fsdualPfsfloat\fstinf6fsinfrt.fssineBfsfnegldobranchtfsfzroh  ,ffpsqrt.o$`<a<NugPk dR< HC6<(*,A4.< ` (؄*[ZcR FHCNu@ @ ffpcpyrtffpsqrt fpsinvfpsrtn`fpsevenfpstblbfpsentLfpsone@fpszeroDfpsfinXffpabs.ot`8<NuJg Nuffpcpyrtffpabsffpnegffprtnffpadd.o` gR kjklf`>k^g>k^g2k8<d,&B<ރeNuRid~S<Nu.NuJNu:ڼ.gNuffpcpyrtffpdiv$fpddzrfpdovffpdrtnfpdov2fpdovfsfpdouffpdund fpdnovJfpdqokrfpdisnffpmul2.o`bgRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj ޼gNuSiex@ބއdRgNu~NujJ<Nuffpcpyrtffpmul2ffmrtnVffmrt0pffmouftffmnorXffmclnjffptheta.o`l!T3~SUU???ffpthetaffphthet.o``z,W}bGX@U @ @ ffphthetffptnorm.o`6FxBJg.jD<¼bHF<܆[Jj ܼdRNuffptnormM`bgRghEDvi^E]HE:BB8HD&HC؃HF&؃BDHDHGHFHEބj ޼gNuSiex@ބއdRgNu~NujJ<Nuffpcpyrtffpmul2ffmrtnVffmrt0pffmouftffmnorXffmclnjffptheta.o`l!T3~SUU???ffpthetaffptnorm.o`6FxBJg.jD<¼bHF<܆[Jj ܼdRNuffptnormfsfrtn4fsfplsfsfcontfsfnrm2ffphthet.o``z,W}bGX@U @ @ ffphthetffpcpyrt.o`Dmc68343 floating point firmware (c) copyright 1981 by motorola inc.ffpcpyrt@atoi.o`nNVH*nBGBF`RHHм @f +fR` -fRRF` H@| 0m 9oJFg0D@>0JL N^Nu___atab_atoi~~atoi~s ~val~isnegL4L3L2(L52L6L10000XL8XL11bL1dMieffront.oD`O//Ha.d@TDNuO//HadTGa d@XDGNu*HG i<iB JNud<|g<~f <Jf~Nu<fg.PLxX<NuO.<<Nuiefsopexpmskvbitcbitiefprse>iefargsiefdopiefarg2.iefnoti:iefovf\iefexhiefovlwxieffovjiefnotftiefcrtviefexhiiefback.o `L.μf .μf~<Nuiއg <HGJLxXNu.<N:./LxXއgNuL LxXއ~<NuLއ.<Nusignmskexpmskvbitzbitiefrtnaniefnoneiefnzroieftieee&iefvsetDieftrtn:iefrtd7Xiefrtszniefrtod7Tiefrtieiefrtszefiefwaszxffpieee.o`އg <HGNuHGzi <iJNud,<|g<~f <Jf` |JgJg~`~`о<ff~<`O~<`~`ffptieee@ffpfieee@done1@vbit@ffpovf,exphipdone2@*ffpovlwZffpovfls:ffptovfFexploRdenorVnan|inffffpexp.oP`4<Jj~`~<L~Nu.<AOJNuH~?g<$,<;ANi<`D<o< l",.N<<XDxB묈<΄,<CN,.N$(< .BJk<FD<c~䯾o$`<D<c~DDl`z,/. /.NPN^NuNVJnlp`0.=@ n -@>/. /.NPN^Nu_ftoa_etoa_pftoa~~pftoa~addr~buf ~prec~fpL10000L10002L14_petoa8~~petoa8~addr~buf ~prec~fpL10003FL10005JL2l ftoa.o$`,NVH-n Jnnp` nop`0.R@8BG/.B@H/NX/NPo n -R /.NX-@/<^/.NPo-|^/</.NPo.`/ n -R 0H |0"n R 0H H@|0"n R n BR .JLN^Nu_fpadd_fpltof_fpftol_fpneg_fpcmp_fpmult_fpdiv_fpsub_etoa~~etoa~x~str ~prec~ie~i~k~ndig~savstr~yL10000L10002*L10003$L10005*L2hL3L4L7L6L5L10L9L8L13"L14 L12 L11&L15hL18L19lL20L17L16L21L18 $$$,$4$ 44$ N`8NVH..N LN^Nuiefcoscos_cos~~cosfpsqrt.o`8NVH..N LN^Nuiefsqrtsqrt_sqrt~~sqrtfpexp.o`8NVH..N LN^Nuiefexpexp_exp~~expfplog.o`8NVH..N LN^Nuiefloglog_log~~logfppwr.o` 8NVH..,. N LN^Nuiefpwrpow_pow~~powiefabs.o`(FNNqNNNqoNiefsopiefrtod7ffpcpyrtiefabsiefneg  iefadd.o`RFa@FNwN```kN*N.NNfNFNLΆNiefrtsziefrtd7ieftieeeiefrtnanffpaddffpcpyrtiefdopiefaddiefsubiefnrm2iefinf2,iefinf1*GOTHERE$DOIT@NOPEF4 $iefcmp.o`v/a.<NuN`*``zNLJja.NLJj N@a./އg./<~LPNu,/܆g,/NuNNqNiefsopiefrtod7ffpcpyrtiefdopiefcmpccrcbitiefcall iefnrm>iefinf2$iefinf12iefdocmpLiefinf2p*ieffix1Ziefdarg2@ieffixrfieftsth iefdiv.o@`>N```NNNJf JfNJgNgNieftieeeiefrtnaniefrtieiefrtszeffpcpyrtiefdopffpdiviefdiviefnrmiefrtinfiefrtzroief2nz,,  4iefmul.oP`8N`` `NGJfNNfN2NNffpmul2ieftieeeiefrtnaniefrtieiefrtszeffpcpyrtiefdopiefmuliefnrmiefinf2iefinf1iefrtinf DOIT,NOPE24 $iefsin.o``N`NN`*N`NN`N`NNh*<Sf J<NNffpcosffpsiniefsopieftieeeiefrtnanffpcpyrtffptaniefsin,iefcosieftanvbitffpsignieftnrmiefcmn@iefcnrm$iefsnrm:dobranchZ$4$$ $iefsqrt.o`.N`kNk*/jڅf NNNffpsqrtiefsopiefrtod7ieftieeeiefrtnanffpcpyrtiefsqrtiefnrmdobranch(iefsdoit $iefpwr.o`FNNNiefexpiefmulffpcpyrtieflogiefpwr iefexp.o`pN` j~NNNiefsopffpexpiefrtd7ieftieeeffpcpyrtiefexpiefnrmiefdrtn  ieflog.o`"pN` kNkNNiefsopiefrtod7ieftieeeiefrtnanffpcpyrtffplogieflogiefnrm ,O<,atof.o `DNVH KIBnBn`R n  g n  g n -gB@`p=@ n -g n +fR`$ n .fRn` nJngRnR nJg n eg n EfB n eg n EfDR n -gB@`p=@ n -g n +fR` nR nJfB.a-@.N=@Jng 0.D@n`0.ܐn=@/.?.a:T/NP-@.a-@Jng < .JL0N^NuNVJnl,-|?`/L35hL39~~strbin~p~fL43(L44L42$L10011