IMD 1.18: 26/12/2016 11:42:59 multiplan 1AYGPPFCS Floppy Format #1  9!     R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQYWRUVWXYZ[\]^_`abcdefW7 /fJJJA!W6WW$ FWS]lmnopqrstuvWRY]mkWM]$%&'()*+,-.WLVVA#WTVVAP"WZƶs^WWWW~VA0WBVV W?V})WTV|WWW$W2VV VV΁$|WA1^ A0WAƶy^ A@WBVV\WZ’^A0WZƶt^WY]A0WYƶk^...fusr\m__xxzzyyX__vol1__.installpUmp.mnt01f...ebin`help^libe.f..dmpcmp68bmasteramp.menuVmpinit.oldmpKo9*HA\diTl2/7Af`.l'v'VfMU ,J[ t$inƻ-+!qՀf*8֙ ,v}ti"R 7P N}6`rC2JNDj5w7wWl`'5& ^C%P.,F(Go t҈sk:k|-}mwx(  j%/G=<l;aƩOKEq( XA$fp=źV k 3ax G2tfRM@1fnu}^y{N?m, \b j ](_AOu fA5"Kf-diy/"dDP[; $3|y6fv6[Jl/PHqس3twP^ݞf ֶ,0" CP-1m b7GaϷ-PJ)J-RY*odźf|*W a3ꩺm'w&v|GRtzUӓ$V( Izq2< XfX_ gAf6MЋ l1AOAvf`l(R;s4iVEe$IG}%T*F^-%Tl~agv1WblQ7(^yQNl^O;eddŰrnQo |m%Ap)$pQ[Fz$rff3^027!0#T7bjt߰AsL%6T' cVR`6%),(1 TI<+r X[P69H4\"Ȗ߶$CA<'6wc2EZͯ>wm:'TJO蘧E旘yot0" o|r &[V#)Am*'@" cYSrNr&vk}$Ygut;#95!Det5XToW<.B@VGebIA{:hլF/vud*Dtf@k-]+QA( m GEh`+[UBDvկU3-?@lu[(:E;(a._~)`;o5j 8q4N˄TbkX.S<."GW-SH"Q ~6n?֌mt)Run*RŚb9N#7#` )cG&HcQQ{~Cޣ@ѻ [Sw_,_!,6:*%@X)qMS*<&/N( .]#UA}kOkv&xW56M|R:l|}8{nNfGL.UNF 1_k#k6ibs-!Tqf|8FoVbD!aB7QPtRCRQu@dŸB@ K?7c!F]7J Bp)OP[FZ2$vf(rRbu)V6$oA@;el2u t337*nu[Y3b O`L 65ݸ$\:2SA}L` E.I^]%\+rK "ٵ?2a|R:l|aP+ 2\;Rb1/eI& %riBBT^aQ.*dA־8cCa\YQm}=pCA.~pC;eIedźm|#W@ 3a4?m'&tբRlNsd.Yk] +Sa19ߖYρ3FQe{1S49;?ckzjV ( "2yjTi<+u|r[87od_P-mL*cYAR| IՀ Nt^qPgg k KbJ`tFՔ(8)rS0Dq+l:x;}en|&mԿ\]rR^*= ?"±;};dCth${R[f4hBe^E{n\ӓ3"td[Ooʉd5˯7s1 b-4oH)&MVt n6b{[KbX<  &sfPtP7 TZNe5d rY_u:&guEI ep|հj^oMb-qo3Uc(b[eœ>R3JD/f)ud*Dtf@k-]+Qc)\%L1TC蝃6vyF҇pM[TD{d+Fa QI%GPk'@ OXj$qfdLs~c ͪ*(DSWO4R)w~ Sfwjjiy>npI <0uRB;@i~O1v*nE@`R,t'VX>?Guh(Esdq}${L%'5 y|\: !Lj!Fit MV q-c b7cA>zi4_bxCy7,T(Ͻ+)gHO\J2LnB37fyL/ (5m%fKQ0u޴]%Nz[\5)F"7;TUb% xJL pyGDž43 ЍJ$v2SD5=x iUsJN6١NB] 9WB,{12Dm_Sͯ$*vR $Lw1 Uy!BV gJ{( Ra]Ue}"7NDFl.Uiܗf@R dHJieڈI >z?1t8f#^LFnh ^"@A lH1sNLj!N<83RQ fE%.1|zMKO YRӵjۊfBq`'$/7LRf18Z( f_Q y$d{3!652S>H1f_`wTi/@6=rP&2f! tol.MM2f@%.rAj` (*E!/UPi!K#T,ʄtVq,BD] y})?)8d:RQuSeO 5/oah#P&|@KY7 zp^$VV$KR^7>.aUjt9kFۈ{;BV1(o3S ˋj)tf|].]MU"^+u|]l[87d4'<EuK\P8Obf@v~UGiG78ee$mZ%T\b{cx-BWGѧ58&lOON<VaaP eHT:RIudBLGB`B,E3 8mJ2t>?pR2:T`` ~VM<^3wހ|Ýb8f:6[ڄNoCNG`"Z[N)P=VgţTI<6r[R>c88#~feD\.8OqIHH;rGr$AX| kǴiBsC{n(hYk+wLDB[Q/ y~~.)nO 4fdŚf<9k7Ef]G4ed0t'RBx$vfBH^pCyL]jt i7ztJ5nc<=%(/pLOHQ())ZxS< 0!3Cf(R=<'uKH|gqP$z wq7AX|ukYx aV ^),*MbE Al{FQ=/I.2Pq!f@?l(U;rwq;_+G %t 'ۡG//T^Մ(`Y9Lh!aYQ~~F$sTU *Y:B.9[Hs NLTp!?Yیa,Mp5U)n<, b^۳]OJ9cX$M6hTW-{Ee1( CX!A=6]rtK*8M|B&.TRPYAr(UzĎFP^'Mfuʊinz-!D85q8Fo dl bka7u`7vJ 4nW4*v}Q|*I,1ź \۪1O7)A[p"5[LWۉdWf낡%/P(*4a)65#Z$F7 zckz\Bi &V[ATH\5 r "VN/krɕ|:2Yav. {rF1QU I5tdu.TV0Fh,2"$#  JcsR^*a5M^Zvz B60 !CY iJ[p*p3 l( I^dq3o\>"ȞD\ $JtLJ%I5]+5J"%ˍS>7`/J%;!nt {YV/jAQ49U't\͔~I_Cv].~2hC '~6d$R2Ium ' Tn5E^ /S`l1/$y dn^5^&u6gt2,A_2fNC법*ŷ,e@ڈYp-Tmʄd8ew-A~ay!~*"܌] _Pa8;EkStA`dk%O)8A\G^$q/dE_C3w/ed-9 :>]fS#Q+Ufw1%c,9SS ǯgZ !kFg/`=;p/ W[w(E6=p'6l>WpC]fBOUwy\YJycZ#Yt^Si^,k8 PV8b#ѡrD\X R1CTźԬhݮiE6hoiRCElጵ}oQi\5p/k}fiҲjx 6IWQEI]?:;WlXSi;;F^JuށiEhM om)r~խ1}_Cf`OTZrјGVEe[t7{?t\If _VF. $/ubCsN1`n:2QugOg%@A+r .ٴe9Vޫ&J4}_:fx ,fp|F2Y_d=JA0g/UO$U,'T:^=nV `V k<2v3"m06GI@ʵ.9rҕF HqQ%uJ1UX/I+vo,0l1/$y d.\4Ru*U"jB`D)]q$1֭5JL>\t  Bd ~q|U5,*65۵iO6{ebrc@NbJR()=p {I>2r tV\LSuH~e21}_Fn#6z2wqW/l2u e -/TRf!8iSW,4B_~yQ}AJ4.tORQ;e@d,8[H s+%F&_)kɞUfO,d^q=9Q7aLiQho:6DO 58M$${d7+\:)2SSuLjNb+Y4=T6=*1J$fukCrM3ڡI̟$pӞC5 M|#~$r?'r0vV˛iԽF+SDEmU{3(M7kGbZk]ptFdUޣ|*w. "]{Jy ;WH[z:>BO3(Nں6{YcXUScwmT _g6ykH4$;~t=[Vp.jSXQ=`t`2x?mAzF.d.[XFm!Bfa.Ԩyg4OZu<^Y+QzL 6ztC.SK fRRt;sG<Ӟe..ukͦG%oΟf+^FewI"NJU'Q#b1>QF?ꦡKO(&q 5-EEo+%nޤ|_Y7qVUl%(1 $2y[Ty;r,&[{Vx}<6Q2t+RnwI1JN%z[p'V bE%u$l--^>8k9B@3 nYQx@N1RZIٛ ŹB@ jW4 m|x_ nqԋ-wggݶ0H7}R[]5>;hL'wrY$OxtOcZ: |3MՋjffm Pyg~'\IJ;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkU5 T35n6M2[C;PmgAs(/UO?Gh'L%t.il[dWQ1f%ioV,0"Ll9,/[Ӟz:QNe ^O%S"(&q 5#RL 3`Uo oJd0">\$~[FgYdf33̯7@Rny,:6jx[AO.:Su%]2quKJTo'>O &#ΚdN]k{CCIɯ*8 fz|y"m|;G(҃fXUl'&CK,2` %tG|T\U]1" &{7D W?A_*raT)Tbf@Hb;df*HBS0 sY g&rsY7b(R/r,6e2'vu 2}YnN'^.U\wq)h> tg}yr{eTl~"#8Y"Jy+B7QPXbHCRQuJdŸB@ k=; hփK.;p ?tnXȞkU IeO~q5?yjV1uwJ9[jbL8ꔏTc=E6 |;MS)~|&f& ygoR<3=V3xGZτ[yUu˸EO'0Jfwtkn[!]5f*w B@,/[ӧ~ ~aJ+Z^5Hud>jaŚo<4C}A4?iI& (zY _f^!67,XQ4wLp[jbOT'1g0[5-{ p_CFra([VpJ)O^ffhq k/t[^aV?w$)F՟ v bpDFefx5O)W~9:I۳>-Jlc<2ERͯCCwZe1( CX!56(V;r:}4wTE8Da640tl i=)A|j..5K|vPI-[&+ǂic;}Xء+pG5yj1Nyq24n)nn}Eu&&dB k4 3iQÃBdE%ыw8|Y7]el7.3^0/7!0#7b_rc$OxCymc{7P(#A+=j)JƘgA{M"VstK*NVa!m052t1}YnNe!.UNB'VDb-`%td1GP^(hYa9 x{Ta b7G|1lU BCuf.g}ꆻEE+{Lp Y7H^e$Vf(r%х!5FbOwiΞ:[jwO' Xx / |3M%b~|f5yG/B;QtX 3wodA\lic2W5$1p1AEf``6|e{ocM;Guk͖l[]e͟FI܈²iB{cۄE4EwDL@k5Ryޮ BJb^PQ/?OMU"6B`jmS=/m: #&v:?x=Du$-jFXqn5DOw7B2\<$o\ONsL 1`]4ARb-7V<;RE #5eIHސ&*J[)!]%f * e,!C7 +[jzz&eEy^9v*h6B`ND 3smF>@p 4rR2RZDʌ$vfE Rbx:7,cݝ3:6tAuO6T' r |3M;oL"15Mzyg{u\%ir "K*FGX-f.p 4f[[ff''U`o~"q<72 ή_x]Zjw`+ʐ $8[@5wL HN()=z^=~oK*X~U:m1tlPlf@#d28+FUg$>dsgBL '*{qb9!KVbzD3P>N b7G|z VP$&(*ź B==BA?ng&VsS$rQh[fLY dafR^){?TL;g_4ʨj:-JJUc<_-1)cgAؚ(C~C={I(Rlɑ2P`1]F&Pe8sV;R )iG7"{e%fZ fRib}ơ)H(^Fohbf8m|a B36M주9N-S-IKź \(4/}U#JՍ3X2ȓj>aRL^35?yj^}, _th[ja[6_gǥ`=r |;M")1x<~] ZWR2tzZQ:L$v,6D35u7!0c׳7Bjt:YOJs2;L \Q2S)BuLj`( "2lTi$OxChb̚{7L =2sckz\5F( C29lTI+u|v[VXzB<Qvh+2}YxdUu˸%z0Je%t9K'^ՄIR,"D /Njd3~Q1 qTWYkp*,e4~$FL$/]熊mGh n]R@$vfI3t#+7DnQdQ:6[ sJ65ݸ}t_9 |Le]0Pf>yg\b{[rt3wV4dA\li(T!>ul|a1AWADf@#9>RFm~H" 2gu H6iU_-Tl~x^ Wb xa BVJKJT8ZRQuIdB` kWCGgQV#+{f.Zp)8^vOU`t( =q3 8LUyA$]n]/DT c<[H]:`,:-2 7޼G);]<4۩kr\SuQaP IeHTR];d,\drB`|jQHkU#JՍ3X2ȓj>aRL^35?yj^}, _th$O^j̸nt2;*s #^A61H^#τ6diE5 -ыpRK5n2GEEjf>Q(rU-2_m'JF{%Vj,T][f)>EQrw'Ge.b7"/_Jf[SS Sc'.v?΅}M s ܟE?v.xhf7 J bBBZi#tLqHح+ 0O J6_+ E$}&)O xf+Sy?i=;d[+H씬hBOD*%y$އxED7P~Yr Lģ1/tϑ7ttl|aNIKzcC9R05da%t?! [![qf+A۸ y NB|N3 l ^}ud6jz] kW `TE65ݸ}t_9 |Le]EL7()"|!TI=@#e/(ShPbOFlTM|>rJ~hҎ"o;f;bb&ً.UnrKv,n)@68a0DYvk LV?q\>'֛}gI%iI,U_gn9G8-#B~`L{SlL2 H7^E]{V@q.nkJB}uچc$ T#fu8W SGZ˒%fg' r345Nu4":G>k@v qnCOjR 7h}W:NH܁e=U&S*vt3g|w qeȹTT;f]mSmndy@ s0{*֤-Ős'z./2H!ZR?]CIٺB@I;F;6 w:#d׷<AKX):SukP8-e -KOiy9QFp^N_($@z}d~xPȩ_g*}R, ^ ?_&@eP#(F*7p ~<M_Zv_>g hH;7{i(F[ iz1f&K@JKa38th`Ovw%f}0oG-_;J~>5E=hFi6lfm"@i}K9|Hx[nO%ղ!*$)YƏ/VR0n3+pUmmgFJQ-C8REi! ؙgz]D8*D(to¶C$IA*`44]KVb`RYyf)6FNmAX,pL▎ARMsKkD 21@`?#<@q `A"5%ܘ8{PWc[k6:np ꙂL5B*pAP{2}?kR1Q鯃K|FY"hfY&< oOYX'tK"!;.U5puCk)9Ry?3 iB<<@|a.oNݐj SXf$yZ]5aUnP8݈ȾEaPcn>Na3\BB2^JKӡ" y‰p[DP6'2a/ϸv71Ef L4&Qv>9JKc50']AUf!qpFIS} YcH#NsX6-=W<8a:Ë7B{47"BM ߒY<)7j#YNagj4| 3١үqjv+$l5m[f",q~;($PrK;&Yyho?h|%OtōY޴JD]b2 6Mډ/vJMuh4hiS$k'\w}q9P:.^"R=S&?#n<=>yB'(0?vl%${Eg& a* %XEɠ3TxTML! Ld ](TM[I&Ɛ"3R"˳'G,qg?Ѝjng6r5whɭuѶ"ܻa$ItP(M~z6_&O}c2`$DB{ _sGɫ} G|4qZ_f2?Z6p9h}3Q/ߋ\%F&U'h]X ZDUdX &IBD)ܪ4ײKsu?^oCx7Wʗ 聇{N ^d5t3e픚e&Jn"pOjzT*qܢڝ_MH7İLsYp' 6F8O*s5ZQL?! &18\1RBIP5W~7,:i5C3QPyH*k2-gMda"g" F_SxA=.H!%sK+.p::H!z{ i3[i9-~A0"Kfn[vAgyێ/JFk4.¥ /g:h+4[H-eb(eF{Gxɂ y~e^6a7 \wEb61i1`tK"IBQ?>&qoR'b&wcb3æk%ys+S&ًW*5jU+ e)DF8fnrQkM̑@bBC-j#8#Agy}D2Ҝ{ ah#:<;nW1'Dky- b\[L#-SZLUE pそEm}L8 Jo,r9S%3dqjg \fKn MC]<9 S)[_ /!MC4u3)x`sɿ70qi1ZdLM:0@-AⶴׄdQӻMFCEWQw+7J0oS.I'r-ij(h]ɉ%Q#&? n`tU"#Fp.?GerAXDHUg\2`q>/z/_8&ff}=qc2?3 HX1ci>*$0ڎGXf`i#3 YW[2?&cmjtyGح2HHj׈i1QL|2Vd=۝GZ\F=<ѽcd$\0EyT\fi8F9,K"Ca% yPOK_LZV}"nlͰJD K 3ԁiçE%sω|$ א5!̀]]18~זX'V1n4L̹γRBtC2a/@e)8## B|X+#9B?Qs|ٿzFeW,Es6]\a} gqYfWrtDj3h//tDԇGӲނ:T1C7b6{A{╏ Pvoͦvh7*ZLj`l}Kg\l:?WdzM6'(Ob}3525Lj6O;^%M+y6 ;Qj!v! +hg$PE, 4zSTA?63wn0sWh7gP{[p54ke!ɀvvA%gFiuS-9ԫ^fFx,St$wuW]>E LdF-Y pa>I l=Se5+&ZL.<3<9BHPsGu$W<06~jMEMerDX6OKp`3sbKa W֫lx7`8o,]VA{Bb m>LT~8|+}8>^z=)q`{MjB@|V8J-w? kCO>!Bo=%z5Y\*XS:T/M)Z; ~ʱHOBiEnޛ*7SE[^ՄLS5u, =zY}f=GγS2,Ђ5ABh2ATY:2Pَm*af3&۸ Ņ^ZAyUuCg|<]s˃&DY_{Y3:t iy=-\x`S~m=74-_ C?H o8\zqDQpU=. 0Gt˜ ץ9+'I&.CS-HkmP9IILDC҃ `31 IhYY2l6/wh,(Ϣ@AScU r,q" CԾ;0: P/vRU[#(V]@/'7&:=Ku[wEm2b͘{Q-=*ij{f#O&:ucSWv@g?da# H䂖^hGWGP fJ&kE)V| a. 2ϳBJ\%t"K]'zgZ27bJ4Q^h3DxwwFhfϬj폒lig3ȤH=Dj+"sN =dq7Nʃ?@cAn(r?|!L CDEI~4wdjXN7< #/9#M!-HPjoaoXz5Z;v<暋c] b7~*_0|qs^vV (O!hl5̉4)@l}vgoUH'Ed`PIU[qTe`.\={ >om%ʠt'OXQGO_.jmq}8;;pAޮ:l4$Z BA 4q&s /RB!|,)Qe(\C3+b KQ~(WA62q8+qf4fOIrvL $_1bL-!Mo2Oae-rcir'8^ZÎn%0LaD$;#B}S`F x"P-OkhK\7_HGR[t<)ddžBo ׍̃~m{$sWvX2W%gg'\xrz6 f7Ѐal܋Z'+2(B xR}4p{:ȫcM&d(UYEy){o?a1nnicj'w~dZ68;=F%,'-G`&x 2584ZC޶D/zGl(Sp>M̓M=XL3-c }C &B1_ҦFBͧǰ:vDEhXxoZ[]J4_,O@D z[Y}9j)A$p0!` 6a(q8]!AQd{q{tC? U dz%$T Sz=q_O$Dùc@ %k/aBb͠/P>;[G\j jdܢފj@qDp`/?X}<geJ4fP].X@#ShY2G60S; w l 6 |[ķc~͎}lf}8=اuTL88*O@{F94Fl-5)=] 9g>BFt\NWv_C ,Yw4ٻS {i/r. :чPZH7y0ٴLA4QEx~_/Z!:.BE]9o(5GNʸ}f& 4OzmpoE;RxkJ/)ajݲj& Tf84Q9pu,L+?f|O-Y+~9_T9=% 1˜ Cpzb>rBmeѼuu'%4S[NIt.l5{ddT&ꬎ,AhͪcTSY(M\nNS Fc&#eͲӺ@V}9q#mT^xaP !҃a&[6k$+Ia >zDY'Fp.5J)ftbT+ tL;An#z7("*FK8ShCs"qe4yxC5g(`of(-4Muo!I&p'T `YiSL,>L}>$. HSF[/gk*RCl{`vWSBa 2g1V)wQ;9)htȲrGƒ\@*zX"%ϊic`Ғatk4~r5I%0f &V+܋)6CL;٪8eKn~~'l,<@#"'zW%TE`6_zhEh?gE˪V,@5wIɝg$"( Qo|l K8k,MkE,*[zI¨a+XgQ/(`-io>M 銯I5#ux'to<_Q5CO"VW?n~9d1hes3X\&U<~t`eLO!O$cxx@8,/|IJ&dFC)Ɍ79Y <wP+g< dZ<PAIF2G'/=?z;="lɦt\Sɓ i.D<:fm#@T GY|@8 r9T~0c$,'Z Ygb7VfSaai`FBdpF7:IC$agyN2 - U2OXQ)&FlqٺKk/aV} G?04YDPktMw Q4=4SZV=Eh6Z'|J4}7k9d9)C "LpF;h.G=JjVB-sTV >4g2+vo0s_C`dHw- W9fE?"fIlc95aZo>w.A=)qAHO{d* TgI1⑭ $Wx JX}LM@IR(Ag yV4_UEJZEuYKvH~0/: +e7quڼsQk$^g}XP5t7 R)Ff:y[Tq:r<).["KJȄj~ /J+ %3TOB l@ĝ6&U? 6v$tQp@dQ")ak}v Q]o.W/!LWR u5~](~Q_R$)X>]Ux $ɻxwcns`0>QXxu5E br2 5}=8B X2^@֯']">`S<̘Jb\ƺ[h﯉:‹,[BVW"Gr@}bPt#UrbsiDnTirA* Mu)"*#h{X(_l/b(xĩV*sOx|]m+Ȏ.T7 H49DE1hĿ"KfmnRR1]EUnQ"JrڂQ7Ab7e`uNUPH"0!j9ۜk!oӀh.rӱq¯IPbōC6#&C\t00cnַ/n$"e6lϛE0 eeK.`&dZ|+E*[},cWFڤȅ>%#$UshwW@ nDgr&[8uN`m\orAlI+mY'->C$RnzdzSU,﮴$_`WpNVGcө-EY e"a!eBԲݡo|2ix'`gLbEO35vq>R`12,2)?g_ ߒ m _dE ; NKŐ+Ig̨[q$ɉv{9mhe Ah޺AR=ؙ7*$ff#L,eƨX^LYm|5_I2M ~CfC7|f3GJ蝈YJs_.loIn5YrY:,~|>ɡrVUO;ru@s@3iR5(o*">VUY+8xZ"(RJMh5qrAOcG꾗ƙ>>\>@z @vxf^$;0Y?dFxlT&0^~V nLޢoںB+(Q| 0\"/·783J; (Q3>ݟ4oA$Z0~fj;u)Vbw)aipָ s7x1`_ 65 Q|K2&3pH^P9bvr ŝR72,*O٦A5)3rnQUJ, :n|s^J Oi! _|H5Pgeoӯm (ABDru`kC矃UXhOr,Ny=C60p\,09,"@D_X.s"~vzI._P$ǃq#Ԑ7@<cب*6=|)k6cGZ7nqE ɎQeBA^6[`4 ]6Ե% V (R~6S/ Ґi޲e')r e0bzMAcMMqXRMPu*jkʯCBs qo?U"P*P66ݐnYTrx6s0'h4)Z5qvO6=.%~Jj6ЀJu΋^Hkzc/eEOu2+H \Ӥ>u?zN ٗn"iEb"LRoOmck_] @ 0syEW=FLbEQٱn9y#uFf`A𾄧ظLeh Ip0GܮdGlF^|޷Lx84K\f 1 3g>3 8Kh<>ONCRrjq̆&G=GIaUca]7;orA[TWo43<$pb9EOvhA *[8rI#8_a)Bf+sfwa/UW\͇e:E%/4!0@}!chzSMH?莺\Rw\)dgǚA }?>ihg>rth{h_vɔ h:G6X\50vi O+doK⣤`}Zf9aO( 3gT 2fW+- xvYf%ˇeF!_j\& ]{^ʏ(l3Fdb@V>N %: <[)L>kֱ#A9xD@,yB䞦U[֛[}׍Oq><3ZXa0O^-/\P>H^r\:%D ߒDLV^uhT{^4B65.ee.tctQ#TdjȨ_50)}.~ LoJ^KY`P\(O6`Z;/WUJnim;1~Uh{ax9Q LL=4 G$1=9sg,|$h<'}jBĪk[ê.b.i7I# 6-'eQ8$ f04ӅsC<,\<5C-IP]v(`lot ݪF+SdEUCs/Ie~^Q>$tfhA){ςS Ym!rV)`Uq/9x('H ]vrb+)CB3߂K/P JJeԱ#j?~"E_$&I}E1~<O2*{ QVd#i|T#(dfً?DNUQGdv$Ru~ x3"p&a+ۡ2DgFLT* Ϳ)dh)g֖=ţWbjXڠ(p"Rd A.B(x'Uc:CTJ7_nx'TU;r?J@rJd*"^wDck}_"d?h.vl?#xN*5t{yKbeH\ l|y7tMn.=PH\$ՙ\FzlbmyqXJ=;dlgԡ3鲔Q?=O,5&hq^n<ڊǿq w.|F;3>`CYUH[_h4HV.֪b\'1H3'(@w"D3d I=|ɸ &4où/&o(EBGI;G$pL%vx=+Lj@b̦-hՆ0@sN̹0w!U)QX u9{WAͳ4*kQ[y6>\_cB'z2[u!ؘĪm2هND9"Wfx%^E 8mc|ț^s677LI7;D&[%9LلxJ1`6=f!!z.+ 33#[S=4} THY=CA39z1o|n0qB4e~Y-W86E%,fdH@1%b*jY"FvvHoF$eܶ"XRc_gkvPo,k-nj^ uĪf8 虚SM$Vҋjv#u6UF^#vC«oC2 pL+i7l JIs4!ݝk1%f% V#եc#Ǚò[k.8|P 8"欚q p:D>&fmbTؚyiaHrڴ ] l( ~JA w `rZ.1ъyRW C.N&{c)1}cˢz[lZoEW^ڷMbtDChq@yƃKFO7hK)ճbD6|ZSռK]1\)#85e'q`@>025w:1UZN.R1nʺ^r`S>0lmS-IU^zt #/s`M*~naұҪEqTU;A@c waFFP8=nReṠEtRC^24=s:9t+fwXխh4X ["׹F)575p>?Z"JeL|Ă}44AYeW*&"K/h!ٯM(K/CtBq51\,BGk;%DiQ&:fDYDF/6WPſ$(Md$IĊ w/X 0\v4|Y3tC9b1.[7I+FkVtRR*dEBF@  Bm2\&$op3 [U]$fN"16&5Z0ѯDXkZ> L`xUr*M\OaFpb\ (& {Tm1T?u_-qOBfwsS"jBv`5Sixo"N@Ddo4Xg)tB݌;<0NBJezB'T$J7I[?pC^~Z~:uFH?&odmd=A/ sy{FQF_fݗ C'vw0=1Hmo4WAw2ְC#s=5o57>\@X(@3—ۀhH=:w#}Nc'hHlJ* e~-/2;cUrA˂4{+`Rǂ;%y gSđyKGIgg(~.LT-cJEl-Sѓ#`A%f1IWeUĚ@4Sv#1)a(xr_P:pKZ [ },ѓGj12qo&T]| 6,?dL*d8),f8~@aW 5#sܠ>Gh[B?.`c \qFj+},=E@R*AGEPg4{ƿQA[ȁeQ̣[2M[/M$_L*7nQ Qu~wu@R4q`kcvcB <R46\}J&׿0ɉ1fܺ4bR$Ƹ iV6M8ҡXhmZDgi£ӏ0邧sD2ʦX -V m̈)y\nBrF01+ni6p؍lfI`Q)k= YbHTbͥl!h os@]߆Vr$,En\nYyore̯3a<憳2,=wԌHK*<7O̍s^C"=XeZ}Kp? 9S^8BA/84w)ww1JCMcDV|3n D"ΒiY-!$*PCG9$dP(vPd^inKϢ32]K[1T$׊ͥA:ZѪF.~&)sh̚p8&g fo^s7? O[4<.9ve'OvOF2{ca&ǽ}(Ay{VW$8p\X=H(PC+)%Bв`Hw2;d);@e+yo%`TM:=w7cBn)xW&bMd+{cn>qw)5y+vaa+:Ub]B+RҜy$* .)'yRx!,Puh48 ß-km9!nL[kA61tf=&Q%Rpg0lƑS:JR8V{~h.*<}G[9 Hۖ)T| ߒkm |QsXdͯ%%^j4⿴W)txq,541-w!JؘOy|5ٙ?=|tMskPsQ?b|?SVS c(\Z7%mXhugKjx{1a3Ea$0k $}b-@J0?g_KD)EG)"h6>`x&}EAdeY/cV8;E##tcfIwK&0k{bd.hWIJtf>Fd;G@(vLm躩ПE1j/S:)z0ǦjvYFG;E(sً9J2I"CKPuw3/p0ggRؘ@u# MoVQbjHF !'fq5 t׋ z:4-z2V*~n  ,)E zꄅif oH48 -hq*~8!,doQf(GFeJ U8n3Eu.5GAQ_wN΅TB6`prlF "kKأ YEXFAH->A54Z\qefB#gr{#j#E,!dGf[}q%4#6KM6;%LeRx`K7g-m" 'g`-^A.3b _N^=G@6&x"3e|"EEkbV'_1kA(,Hj2J tu$vj9.YUF_)+g;DG.*!@S3azzSNfHԏ]kQiu)dfŘBG6 ׍րmG%0!֙/?{QW4L,wL}r%Y N73B6Ľpݙ-l*Exg <7!a.*3j tMT|mG͍aV_* H#)DB3v9$!Y]a)b Zl{)GZ~90K '= L tl(Elq߈AAC4.{( yb7 V*G@ :2Йߤo>Kp2% +:nw--Y]~!x{bIbM q*W/[cPj{O0^d$|6[KRmE.XQ/WAuhс'8GVwGkq^Bɼ8T5ue$'Т.ư_{4vrofxzItNwDP×R Ϯ\os{UɈm}yK,OC`*XQ"V0wSE縂ە1>@!(5{Y`&eFt^-\x 2^6wR ~s\+@4 )`H{lR\ :cO nyD1z!6^b>_BGfȝmF n'-Wgmocw% B%LB2ty5G4!a .p`/Ҵ- y%T@{:7rYkU (FG),a:"fy= qJT{sE)V/uS$ 7CgJ{'n j/1WF\f;:Fo.:!C_}!b {RMI=\Pyq)Pfg JAAe16׀n !ctkȼBQup4bvyZҺe\^VȺnݦ>ul3ƀ}bnfw#f򗠛 7ub.Pڔ_LƝ&SkTZM_e2yw}.@S1{ Zב,Ov됵qCfLSXǗt~֠B);h6_2d%8C MecBӑc}nLLAqxP7^Z(JEoWw-T|9že)Š&[1j`GYV8"~CK0n+@4I.gp%𢰶Av F;qdx8ۛ*pXS@D9ٍovպdC n`U/ Bwoi&{܁`%*b*"hyX-,;(M0.AT,Y)vB zdSqO :P#xq\ A+wcA)Fޱr.zT/s5HA;I9#7H/CIp%"[irE4\B1K/]z@jL~%&cGd+ z.PP>>w _CG*@L+9f5&{{<|RO{e@/cV9h3D$xl}fKg&j&-.cV\ўf+rN:G9֓KX4cNX-UOe߉d]1,d::2~,Sz &L?m@%:(O.B{cq ;^МYUB_i>0LN햛G]Oj:<7x`XR ˶): JؒNjK+W וy$#b`f:T5֏GpȀR7w' u76* [9H3zjhgAn\ =<Lg,qqv}9/2ln#~55:&q=_~ :RF) 7yw&ދ:8 r־Z{gܒlP8<{ϭ,8*Log1DǯtJVvo>Sp\FJm.;VtPv.MnwCS*exR!uQ,땦A+[!}֑CWx%g7yi 7Qfm?]\qFlW2c*v*M#"x$۫Mt=0'vj1 G[#4f'=a#?e`3݂ġx{O/$cbaRW #YvSvpR TY"!/|Azf`߶G6@o?W6Q6C82Sfvg"uts4UKP>"?/6#t(.5ZCD8(bi },j/yf   ս tܑ~ m XqܠNL@(?K')Æ}:xO6!C$Z#UJ1!Pkx |YY6Uqx4j+3E&ƀbԕvjR+I5!MęUL7һ CFU@¬5|u8D*[y&! /L:sR*W=$LfyfT|p%46p .M'5=8J'NZ2|5vZ53`#֞z "{?.ڴa*HFK0hst)Scrj}r3Pȩ83 )`Xke.{:&|^k¢QOv'9EKsFzuE5ĺ;/(:`-f*N`⬦E57Jt"|z8kYgrb6d5[M,cAn2lRQ'XZ5uNs&f&ࡖ;@^溤d#QJ1eQd|xuіÔ"_Kn/3vTN^4Q9F߃w>1;%DG6P(=x >::ѐ/>*O}f'M+T!cE>/tGbT#_ , _E绚d2h~4T}v;rZ0T*@+/m.y 8(^ $@,EXW :~@B0cQA;j][hH-"eqQ/rrw @<]ٚ6,q7Λ g5'Ueb0 LÛ9b}D$5W`UGV B>~'AGi9E* IY4,!ް 3 qbB&zc=wBPgrfd r [~ ߩaDLt?H gqYȘ ^[V~!0Yi͍d DiѰV4k Bqt*ZZ2S>K"frBbg I}Ɔ5ݗ&}PgkhhK~!`!vsly7 " zOlU4G_j&19Y$h|TbDWiR2o3و&MDVHtb~"50WEi9z@5(5j/#Z6Jk`w 'ЎE  vpG7)nrBI+\$[LϾ?jUuKE_ib\a .k5UJ:t$IBN>ze3z $Vl* {'"of%[E5 8} JW(xY{?j4w0+vn1I}S{dA8唯ڷ6yp{@g`lAn)xͿbr i(WZyafi4Iwe9*eٸȩR|+=ar޿lڊTi#w5,`C8 #qmHh 4NCo+xֵ$4094XP1ck  ZDatiySحs EOb( {,F M`m0*ZǝiP<b Y&K^bǗiq1&xG%{c"N-PFcQ?c e_i$@It>:N :JB8@gډ\gK[gd:]lp5W[ a/$PÀnOQ*kNgE|IlD3H^6_Ut  Bgv!DŽO$+@1ҋ3;J3f#'"Dg` MT,r#CB:[ggDqe'+KP%EDF -@0B|p[ѪM  *$1i5 ӽ6joi I> P9pL-FWrnq`)r$)L$n/d@BQH5&Gw) dR"?.8R"2E KJs?wԚ9F+ztQKY1K烵1f,h)ن߻ H2  ;U$5/J fA1W7p3P8:<,zb:+aJ9VcG5nifqT?/xo5Ө|{Ll9:w`m=vc +^ݎ9cD<&{iGTuf|(X4% 0T~xXLe\ bEl)"fՂB!sq\BD4JEg̿#VkDJO7zh6_(.#{cfHD+I7]qu#Hu|FbO WM n QREHhA8E=&ypM#a\CBm 'y:]5[b/d. KxcZvQ/J._Қ/JoxdYìGUfc (xTQ[XfM;ƾ>eY M$gNwZv:Rub|Ȕ>K"f}Ws57ULK6`9U 6 V5b#z 6#`&t{+zW 28qҪ&YATjT185G!}F0ntFn]+ nz19J34 FQ-V&sc6|‰jqn] ~s`DX2DZQ K1*3Baqc0_FBqs\GF5tG VQa\L5(kpi/Xcp[#L\̧?B4Y`͒hcōBc(.;/F7e|SvGLbx#{58cͼbS$`oU] R%G6<*g`yneP4tbT%Y>{iQ[8lCD_fgm'Y?Dymh*n ům=3O0fjjVD-H P]OJݞME@V 5>M5IGI[nh<  'Rq3<>JR209AOcG{/`Y޲ǧGBG%22mOm"^Vr/TG,^&L9 xf=j%3Q -.i3))L QM`~]&Q.u$Xoxsبލ6ĐU7JZ=o΁A2Uq= I{Cd4%zs5( ihC]&#F?;fHNn,bSDTUC4$׽^:2L9^;Kua?%^`VnpE6~FXv:NԎ~ (~ݭ"AREsemef:B@>=&m3M:5A/b,'jbc|J6B,Tl̾N& U6+Pfok4|w\)8YMrlֹ=6a5ZÇ9rs= iT-}/kl>M̍^U4!nЃ,Cd[p%m={x*LMu7@(K=x-nYјqL3V[#)pRPD<5(X$tʥQkl|f>kDأLV!'GSxy oXGws](~[p[G a*NiPD%$#ON ɣJB~T)ĩ' q S؏t>-,'3 30ZpF*ތy cAAj̈́ʼ>ڂ,ipc,) ;ү]09N+BJ e`F 2h?jJbW)U>8\{MZtd0{k p ­""2֮h0cHnoКh^K`bE4\̩?"؍~ф!տ\;UAAj{| ğG-X5a ?IVn^44LSOca &d1z%s܌\:rbGа]&1M+TL G"n6dhS@jCZV;+&3G]'ؚAeK&j)oSX ma7Ik[# &\G{"eov__ P7 IJH\q.ikʽMO` dÙb9D)tt(V\GRކ>tn`xO~( 84 M 7t9j'M*{sc.?1`$&!J.|(I .y#zWMBiVLL^(C\'{FɆ1,7ni7E EEwSg:>un m@QMXb 0`vb8m)Tm3d8F ,"C~`s{_JG)[NQQ`.bc޽WEjtׂji5"sǎqvQXeV*&|dd^?b3d ZSQ%aߴJ^UTO/,+!HE \X%fV33g[8eZ fCB'~'x5bSsBcGrPmTic,8>pEn5 F!sMO P`?J}3'Ti8.|{$IvƌzU<_Dy PwpKFp n<3-^Y~4/9zd)cϑ75^IzüzO6"pm4 ߒJ97J|5GE,^bNLU4m$jLϹOΪ$\kkEPzǏw|z) je#6pc6XnW˳FK,Ծ0[ 󨃷YeFs& ?|#2 cj"KU oXQ\uv||Τ!qE"j]|$CM脹##*8q%^&xg_%CX6,6f^FvV̞ghL6rs02GixRӸN|-"<48YxikɅMZKg,n0/>5My1U v>0㽑)>J\ 0xkcw55քղDӕ|b3Or6F"* 6t6H+pE^E@)u3\a8-sH=isEJ [iqevS'3n&D l5k/I0ҹ7T}/įl)E:(1Q,hb:5VC PjeB,ʹrH!m`7fv(H:0,- Ut+i3WB2#pEO5a V[D=Eɖי[_jGk.d'c!| M G>"a6$o`0tl2(^@gR,Wh9ؔ%E#_K]aMfe!r l{v).HZԀz&$To\(<#K|OcbbySLIԯ{ZN3R^}.mU`?k =g_DIJ~|Cs'd1Cdu>\ #3<39 ix#&l^b&RKpNx124mСW! }'"M,5> vxov[1nQ#C|8J =+W2$ -tQ'9@h\N'oҭ.6Rv@CS{ϣ,_k`yLq~bOP#IoMZ-d&ht"w[OUh_@QP'\)u6%4w]OsP4f2>WFK[Tޢx=2"6"x-/_ -0tza {#x^\1p-]'!?6d>>VHIKK*

ifcsH UqIXN(' dX UB~!ܭX, s0"ecux1FH <Pc88_w̠1/i;qE\#~.{z=I %G, ̲>-"3xHU{)h:{%]"t4of{|pFq%@e*M!mY)Q[c@r[$8FN^,n``pn>D-V:FrP}$qkbFx e;܌b+$L.qs)R[PeQV deC~s7'3 HaI3e9> @OyC`F 0O`'3wfhl>&tqNJB ~ ekHhiufrw2f|_@rp6Û8r6B0c$71 gD'/R< Y*V܇IP_r);R40jQ{qJG C %RG{xqsأ !|+2D b~44 ~"CWFmi}_vs9jkJbkhG?Z1)֩ÈwT6UzӴ~NbS's.zl "$j,2Ind4U6|PfӽZISBmmhkAmc>SzANq^m>b|F6!drҏh{BPG0ca*YSʘC"7s|!!_ KOZmf!/LRmFu3‰)Voj=LdNu|@hE`b8 WQ ҳ&"XįlCD}7=YV/1W5xi|Ǫp>P# {N#EP`>?t>gTO/V4)h!0!w<6qEt9 3};Cc)R9]D1*Z_rTv,lL!!(v8%vΠ?}Ufn$.iS>鄓jX u̥@ ]P]Jc%k GΔ^ϙ#}ex TlmI(~3s?{'݁QgNRhM"v/7 +\ 6_`z=ndb%\I8H?dTފ0~AXh'" q Ë b /?_ pd?wl*;TҀn^>?!/,a[x)OWSw^Pj[*Ri~GwܳDbG*Z(ZB/ƆٗNN[(BPǏ,VopNQkMTSb=;A.L6.(Iqa54j n ~j:G|,4in]E~'OU](vG 3$ g64p7{]=ziP? q?v83&szW&Œl(tZ€(VlO5T-yQNJCSU\-^Q*T"zcbEsbӒb%Q)s>MzCXޜ/uyF~^~!4L6b48=&1Ly `XH D8w29 @z=̽xΑ Ί# ?«3BI G8a9j2vjweK&=0qNk?cq5%Y ?$J}=&y,  /jaK)%=qU Uo/%8X04g1rCWnEA &j8zS!MYpT*av)m%CҴ$B=yOL)bMWI&R+Mb6T@Yڼ9%')S hff@\ O mLgf2YP# /?Ua P`<`A'Eoв4n yq 7 iL4ap hw/$Tױ%I;56^Cv.bmfz+TJU]nK'R\ga!c(t3B,e:(`< |닳W-Ht:s7HAsGc,w76k5 ]Q n9F_uqUB+ש3UoP6~#&y6o#GqGGvz`qa-DE@=613uEk1qMVpiA;A3yf# 3Fe2Ji&Vm/W]e:DI)/6&A3{c}p]L1e 9f32 $U? &{dёҋqhD^v%-8 eCEJ;`ԯ{;2rC[`uKLXÑa܉Ӳ\F|p6J;/}?fK%;I}LK4>B)5H N# GpxH_Ș7xI/)1}`k&oP-J"[-xN&C)dvwwc+XTYeug%-嫎CjW@^NMDmK0>5JS^\Xb2P1e\=+5U&(t75tx-yL;x }|!dbEys#753C HN4<@94s&CLW@9xua8$-0Oo&tSlz rB5^bBMo[%}1.%>m+^AsȇfB#Nx~ iyݞ5#qht+-thf*$ClVb+<hf pB;^[N<6UU_9@l_UjN 0`Iw0Bqp9hU+lv,uhQ._81'p(eH%_e7@z cLC/bc G%#o $DJ?[/]H,la7Kv27jRf8|C&fNJ$dV=h ]a83nأQ6G}5Ari|%9GVO(bjxńGiƋҎCV!-ZA]s&) &@<:ڲ\ V9;(G1/Оb `' I#+\6e6W& LSRcv8JĤ$H9/‘b<|)BCoRz-f\6ՓFmJ`%lijS-T^f0FA.8w5B~=2_-rOe[gk-A>btGl5P6sϡ4#ߝ3Zq4+fY' K{'wv]SD͚1Wr4izM= 4wAYZٙ*C/V0w8/Awr6kdH Y?>7GT%pb7aX5Iui L+Oh\ 9Uq#r@B!+U^!ڷoԸlX23vjMAp)xo[xvcӏmy\6_4#7  Sb56{3C0X?(2% }FsHNbU6VKfRrW"*@N/[1 '@C#r8>- #xwRgӸX6%ViIEz`pqZ[=5YT$I7c!hV!Gvu=Qw#Ļ_CJI'"oN$3F {UVeX (s􃿌(Q׉q"H]stvklO[g'<;jAxd|YmaM6N+e <;[CR*9)YwwSzT[RN r/ܑ,F'u~҉DZQT\rrsMa%*YXO2f֕^72BLlydeH_QYY[mnFg|0'GGrC|INOk3AuMOf3r@F3;ؔR׸{oB}Z[}vNJ$(؊翲Yt2PՃA 1/(Yqw:uzN63[3 Np΋cv!?kw뱒(&M5xv*I9C򐯐ᜏTqU_GYiD-wŁx\JSu~z|my%90G83`,.T2W.pU.[cfDA{ س:bLS< ,&BKI)#TZH*Q"_hf{xkbeM-y4C8 ZIW}5kww%sO} j5ɪ΢7C* >fU)rj GRIFCJ8͢^wxf- ^;UH..ڷ'L;6v~Ƽzkh4eî6R s'KA˪o4|h06K/s$& \P ,UYK9^Z3&#@vXlGh# N6L{(}t:J#vnu,OezrA,~QGo agN o~HdCC=4W}-, qK" KUa`ϬK:/-N jjAmhXPXvae.]>(@627G#3(Ջ.#~h:H4`' 3) _&VU;G YXlSڬ0 g2?;O>EyqRΑf#+3Z1m@Cfg`| l "WХVi{PS3@EW /aJjOϬ_^RKtX+d elA!Gi"tooWJ^P!kE^I~385 NV?ca7;Y+ZJ6$~!a0_a'Ǎжd}*>*{m X k.8$e˳.^vB˪F8b tLpumuT?a<@r6 s]Xi SOɐyfLD|uVa~M2`;M%iE3{f)Su,Q5 j 4. oeNFf ppUF\Cqu[$w6N (T0;ܲ[4J~,}\9~dCN9a_%”Shw+gUY4X##HIH+}LK'9p^~@XKƒihUh׹Gho'MrvsHn-]nLk;Z:gTp^HKE SC\;cbpH|a(SN>k1-ڏ_~1[_^zRWg4T{;uiGFr|f%U39xe*B4YT& C !h>T5m.Sa6H!_+KH\s0x. a;ԱɿvG,eZ]wU@-/UQt.A!aّ>w ZͺAc .w=/!) fʪ 8:7)6 ڃ0hX= 1g0w\o _SOEwxT4G~f4U4& ^V!K}>70vo0 Eb *xP>dCc1Vm,^%dtuNr| 'YyݣA/a`C$<HdX#f+`}YJI" AD]S}"eCŬG\ w3 o9a#nsP>YlP'de,u#daTW7g!LZFzi,y hJCEp\U l5ㇾ+%%QaP4 9L\ v)rLpA',U9" ]pfi+Qg k"![XXń(`YBpR%o0 jY\T,f4cH~N@yfhɯ%joYQ 'd[d7s_/Y7~{ lfbKq}'!Մ7Bzv$M3%$ C5E7-\6ͯc1pİS'23{4$`=I V1s <*@Z4lU!>l>n|qCMgH.yGiGVEbe$PL1 iBetz^ծ>^ zmn*S m=aj6/>Z<^Z4*fh7$ g6]qCFy֩=JL>\tc fF^YcC7KL'?jr4TN[V_b3EM>{2ioBŏ (W &?/Vrq =okP6hC8aQU2tlEQoǪfU?9FKJ0lJU#Joy%1L_8qv6KJ"Hcy_CK,yn\r\Jʌ T= FBD=B@ k?> sރGYF Z35W̕X$Vd}^}S?7.bNEȞYr OxjOڊ 9 2voB$( yIT7EH)[|K1!6H6a2Gt 2sG,PUu6 'ef-euk͖x!!qyAf+8Vg,0 GY1NyQs2J(TsV$`FBL {9s'(WL8⑫{(cEO`le4e|P3F\hOn(6w3ct:x){CKO.3ދ'E$[c:{3Ld ɦ)mPP IWxIUR4; &A cug& pdp#$D H/csj#yH\xDx f`A.+_2PTݦtȼL 5F.ۇC0;g"oKmIűb'SP#0+m`kuz!}3Y7q8A սt ߒP*UG-zW{H[e8 *4u$Fq9^%TUFl>]C#+/d4/s fB`CMl,; v_ܟ *D7ңV3rɖqsUgmj{#H3umIenzM?² -w j'elT67 sp|? }ufo+ 7Dcs0_ަ0J -:*HJ9?aϕ`!'aGhHgO2K*|_GAqd._9O ?Fa(Aqt uhhb-T[g8C,6"N@%arya&zQ5?7ɜdEBEb `-?sVa/F 8K`!Vg+kTIKUge}ROFMDs%n'7q@U,*gc8NkڽXǽvN1Hy>T{(F?h'`!7K".1XJ'Y`>@P:{Pd+b) 0l?i)Ő4PR1BG2*6n @\q,B5l?mafߏ4|MPT<}A5<Q|rMjX2LG&Â4Ix4FG`k%d '^թ6չ6C1mP.y$R4}Ru&&dźm|#mE^(F0^<ҝUmCvfjK^qAȥLɒWNXvxaL 'L Z |3M#?&yn-{79tpÓ rZ[c3<}a<6i|Rr9l{}YbfN#.=y=dEyH '{%9Tn(8Nw_ "E -i.JY1N>J+6ut*fB@gtx,gx|p)Y7 ĭݠ$P((}^?F5?y X{̮_:>$OKOJ7K'7-\[V[++6f('HqJ#TE>9r BJ^pJIAbR~a7!R'Xq2rLntAfU+_y;iG70e%gݥEt*y[*{(`YQf"CzTQayzNJ^2"5U*vKdBKM3<ҏ( )M&tp!ž[Byރl".fR^95>yjKbS:2DO)[Q4cTed%:aPf &.ygo 4/; [#6 )\j2#TBԢTqa;@AvM WU+_y;iG70e%gݥuj7-*^ф!8FOiL0"Lc9O- B<JJJ¼.cGx?uffq:BF i;mI5ރm%$jA4p-9Rp e&fOX35?$Hed*lϰAbx'm|`3dY>h!HsiDH{wS{L̳s6Enc!K#Y05m~Ɨ %$dU[D4qvqc*`Bp6a;4 5U5jt /~ W$*9cP 71ɫe%Hퟃ'fyg:3!)c\r/:tRPDJ"vH͑U3 (q8iAs((33qiG8e%RS%t bGoR^V/vo:,15jv~ J(J-!_<$`"@ c3ua4i%+iڰ͋щRUnaI}^?mn a7j{K8[W*6w%cW Qk=%^`>X. .ygm<+r%[KyXFȵR_z2nU:(cfA}=}S?7FaL/;7a_$NCg:"=c&XG5 2S!C3Ty() &yG;G.;]<Ɉ]T*A\li2'xu P2V!pN|3x;H 1R=@4ʤ{-!;=IFx*,llxa,o_YR2s?S$U$KKa'gQDl@Q~\"Q$3cΪ7#:r2ic)ח_a*$jy]Ar >DU 4(DJ"<6m2 <;=)(`64nC 8e,I2Ju'Zha}% 2^H.~ÔFoWt"JS:7)bBVNT0 hV}CR\uf*H5B g) eZ/G$p%s7{Ӗj fF@"57lQenwLJ c= |3MwH O(Cq/\jstc42V dUX9tq2':L<[y1!pFKltr'V b{tdijn--2Ʉj6 BL>.h%aNaSP~)Jጮ T= ^LDq۔BH~u̻g;t'8Hd0[PYR$kz',nf(r3u}Q+!"7j:7tx?dȔC5E7-J.]^ oC%©;F '+& yk,;rZ7&+(DltoЧnTYh>dpU;sx*S'_f-gtk͖nyt W,t  , "D b-/4b1Qf:J),^- e1(2=7/^THȁV;'t.TWǁw%Abf@U9[G>ZQe/IrBRi`!4{8f+,8PC-ldyQNJ(8Ct*FdB5WEfaUoДc*L|ZG5[JU$zff 55W D̵7o>VZ,[$O]/^>P[Z4xkC=` (1+Ti4/;ީ[kop0F;;6Mk2}Y&2;6'8 _a$I-J{5Y!!P^ԄVFc_]qCs Q(J) ^P<*fd/BLGy+~ ƃym%Ct[ZGYRkz@vf(2^{/7@ya^tjtv4$A8 Q$K5nc<[5Vxͬ@kJ_f|Usage: mp mp .dat not found bus err seg viol FP exc sig inter: invalid file no mem out of memory out of memory screen width sQib;uX~{!E _ YQN>0j $kYCςQH&feDŻB@,9kk;ѥgKcPz5r{cu͓$v'tLK]Vq7 {=@Ry,:6j[AO.SV@20KB=JLN>fCSHyg"L;V-`Wg?TEt:9R.4;0Kk)RAP2':L4[q7)AjPH[pi'Vm-aQ%t1sTqa?nFOw lDwia b~NJ)J-!^YF⛫: 3M+S4zm%+i~?sp%Y7S0ݾۚ( (q3y66U^5V:7۰3O3M\ 2SL}L),E 'N){J?;<_3HpX3G f hsNfxT:ud(m&)/; (b&ire?ҝuvdv}q3}kW X> ||6>,n-Vd%[5'Ӳ2pyTͯ.CH1f_`نAd:Rykr㴤Q/usr/help/MP.HLP.MP.SL.VC.PR.HP.**lpr.mpwTERMTERM not set Can't open /etc/termcap No description for cmcltermcap: 'cm' and 'cl' required licotermcap: 'li' must be at least 10 rvrergESEEEGGSGEGVGHGUGDG1G2G3G4BECOCFKOKFMPMR[]|-++++++is    0 1 2 zV8|,[uzyjJTys$CYU WG=7/\M |&ckzǀ>g=&`yo:TEt4]38 -TFETg~'8" }Y2Ar(UWĆ~8e(/P9QbcTlʧmp9 `C-j3nHj\JʌC}uIBH?#P+i&Hp%RthgL ff3+?m5?y> ]LfYfUL3Xv%W~-k61?( > I[/ X\ru[ 3 4 5 6 7 8 9 . v RKkrLKklDKkdUKkuHMkhBSkbCNENDLHPRTTBCLCRWLWRCWPUPDPLPRNURFRCkey table full  @(#)Fortune System Library Release 1.0 8/1/82 22:11:36 @(#) compiled Thu Aug 19 10:59:37 PDT 1982 TERMCAPTERM/etc/termcap/etc/termcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf OOPS <   /bin/shsh-c 0 0 h 3|y6fv6[Jl/PHqس3twP^ݡIf ֶ,0&8CP-1m b7Ga;PJJŒ~O^(e:A^bpluփac)'N")5"ZY^%fjKjp5?;Si:MU;vR;{ 3ذ-$N`X15qRb^%7^0R rTir6;_|VZl176UdQ<uARjg!ڙ#|9c&%%˚I/ '1v #-4)KW*Dh!L0"dnkchQcLHwdsPJfI:F@-y&os)| %g [s"rwR2v:bVlDvfKr)W,a,4'`Z6{ 3ϱ/dVgr`tVu-/>&;5f0Rgy5W :vUV|Da?5̑l@#|?|i'&'5Lda=>bgU9mFpM!Ts{ bƬ&owLݸGSC BTJ* )sRZ2Quڙ`x;"@ K44r_{փ@Y"ZF):_c5ޓ ebD35H-[WbJJ sO)%~p87s(E+Jzm&u/VI9rW<KZq(B>6m?l>Xy}O!rX/W;ri!+~vUe$egu) ki5V^z+8JW. .Ľ}V"yQP ޵>Ru(\crB@!+A ts;'5ޤTc$d3>[FzYtvf^)87,o!-bAj:6{V jOʵ<{;Cr581RUdI%㍽) &2)TiL;<(R<>n+'qgnNd.Uu6#_"P^_+#g7gӳibBuO^$/],9\C7 B Bbr TJ%}MoN]V%0|dٲB` K[Qq㗝#{h|PG=Pzj6o\s45W,cݝ0kj:6|jh_{߷;T8=;:+&̵*szj*`?=b ;rV{=ƆNA]+Rqr*f7HG Aq|zIKJ2ht>YRzY#fRb)577 cݝ7cp2:6gtcOJsKB-B[8zc:'D R '8=yL;<$K*8(eAX*}6 T(1mƇAr(A_u[~uPߴc6Ig m9(q XUHI;FoWhC,., ]㱯yJ;V:s~5HAud>jx#:B94Vm%E~?<>WUtfI4FՍzYۚ-f50!{?L;o_ډ$OxKChc4{c<2sRSf*( C4IBq[dZp&EZ7 6mR',z$2H]8{ogw.k 'V .Hu)*i`>E̤8CEV -m[ By7k~| B^%;e9d,EGH~MebI&[PrR@Ycγh(Ǚ3?F}+$b|7jCZ4_n[tsnOc߻P$WZRQSi-ZF1``IgTA:t";<!mIV 3jA\liIY+>XxeArj#.3;8 M.PJ uk͞pq ƣ&ʧ(^Tw hIa BV~R? q5MYud6jŲmnB6 O{ڬm-Gh 8}G&go2eB3+?myOYLjtKc>ONd=c<:V9v%V-2"7޴B+u|y`[3wdA\di/>[CT1SO˙.k ,rs'I-[/0NibGu]l^IvoL+,0`taY@%LC6CRQZfKź Өe3<$i4#ۄZ,t_}ְ)$%˵KFͯ=<^J_H /YI#\b:u[(`br{;L \2SLuLc0Pfbyg?<d;r#=VX]R0\<I &$>pgMb .|hE' cķEJFL{cJIvoL,0h_~.TJ +TRQ7\z)(*:F [A]|mg z)R " J( l_Zq3U7o\a,ʗbpCIjONs"pL =MI2sckz\0='Py<<>;Vw7nZW.Uu6iGPee$E,Zw%tl/etTl~ovo;,0hs `ytON>,k>ҭ=JIٛޚB` kWCGYV|f]%J2h[>_YR2zN$~jRq{L5o[~hgBO+cr܍7-X2SoCN1H'.V[-]]_YRuh۵ff(r%hf#upgCG5`d{;r+r[H(d-:'+0R;/{uP1:nVK*Qv`mxgD2TpQ&z5ƇhFfGױE"t"k*9'4GT^H$Fotj*1|^y|21~#sV~OTZ*fKź ө i܃B+{&p 8RB!ӎpfI]pq73+L{b_:>` $OVT`{Îc7#b-{%@d'I5 . ygtg<Jr tK*IH<p6 PY(fXUNL/,SJ ILޮJX9D"{{^Hf'BFo|EVA#b+~QF?%dsVsru&&dCb m)Ew؃madG& Hq5Rthgof,^{w6@LV7bb$GQO7dTÎcR4biV%`r ( Co&1Qr A3eoXHmn C POUXf@~2Ċi_+#m vib;u3){j*UJ"dl+1kvy]2y~)+_O%SEb&q:F,E~ss;ꧨ'JD">\Jzv.[wU Xf(r%9 L7jvzp[ s&OJsÎL ^RjCC;]( CcxI=+1r Lp.VaP~f<)28",P+Y2 ?.K;rh['7_+#_ )7oTl8ֻWVLݮs9Ϫ)"T57-B+kLCyPf 'xygo26uL^o9<C2':L<[#P:n\P.Ch;r4mPYضP"IIEz ib{c Iʄ(u*9hn"dl+PjLBy@{N3 ?hq5aY;e*tdFSts; 1&t_$F[FӽQݶj.N[bq?537 hݑ7c<(Ƥۣh%L65ո~_9o؇tPik' =, ;d;].LBX3Fܛnx 7inpR#916 Fe~HdA L9uk"FL[!BEf+vbEh)al&;~Qc\A NTo-, &_"D#W_ a4m$+{\p Y7AUݕj(m(Yb_?{7!0cڡ7Bjtԡ0jOpÎc}5Mjol?:()"r{u=hu|r([1 \㼨]U<Q%}l|aNAR$-%5Ċi-j_+#U*b&_^$vbE Ƽ E! sNDj1NsZ~u&F; ky&}o"|rMKk*%z34ۂfI}^?mXa,e[jw|))%T5?L2[H&yc)m:+,) &VeTI=>TE;AqMjN5yF{@ _Jfuk͖:{c4?HI)WFokt"FC-/[T.~aJEzsB~ˏ;ed;$=i4#TSH_+%buB ( Ifq3t."6Ȓ>z[jw|F%E$%[5\\:w2S!e}LH (AȴPy<=0Ur Dރ >j-rx32':l}Y l# O0mGĐeeq5%Tdla^>vbE μ ENr:]AxJ)F_TR]*E%<~hB` g9YMƬ J&lp)O}.[J+Uj6@;5@P7b[bCC3/{ōL \cg2S@uLoJsFNٝ3{u\T}r"vv(}<6m2'["m2%GnN6Z.Uu6FiG70e$jPZ}%tڊiB{c{?f+83 "dc.ϔ}y~)J)J-!RXJ?(#W~ 3aUo g {Mɝg B73{iy u[ʁ[$GO+pc1dE62s=)C]z^( C2%6TI<+u|r(B[3wDA\di6%|[ 2=OAzf@.9pF@_+##o*F[&;H^H>Foynl1{/DuRJ) ^RquFx꺧 kWKGhE?V');@p)$vr[Fcu|z}^\OD,۴aȞ1dI۳XBVJ͑c<57Sckz\ejWFͩ\ގt'?|JZ㚤Qwxyz{|}~<:'7UyAB_nϞQO+XpÎ֗Rb)B%3jJ=EH1 /B:~ޤRf(|6mzIG"mG>Ϭ6;r4o̴qs%t$9%͙8Fohd^"dl.1j^~yQA3J-`.K?7\L$ԽBO !CYh$iPNRlt.ny'%Q`S."Ȟ_6 $OӸK:Î8#b-3Hך,# VI/B\8-R&X~R1Y:m9tl1A ?kf@u;vF~LJ$IL)Zib[!U6f+,8C\9myQP ij.>oRQy\Mfid<%@ k/t Dm%A[_Y7 s^ Jm&}35?;ShLUyqHT[j58OJs$^7-r3~#xckzj) f7~g6;Wr=6 V}tc76M2':L4[WTw&~fH dUuk'7 nI-Iuk͞Jg6>If#_ w BH-/[lHQT0b(c>;udNwŚm|lDa@풒aG*0Ðp5[c5ޓ(f\qގ/57+U;vj:[ڷF%ʔC5E7-J_71Tsh-%H"aƩTIP\Eq|[L7(3xX6m,zl2F8U]f`p;r4'7 n(gu&ib{aơ-ʧ(^깻w,ݜ y-/[\JQn1V)J-!T|A=J(\)ςB@NA p =UG CrriBk tXUI+p0CC51mpc4q|Mq$koZ6zdŚmyBor KY8T qN@.2XfqS#Ydzf$#)K7dP7b_Wŷ$O7QjXۢ7l:V9%ËjV-<d}'EZJ7:ש::7J Pd2 6MLRyq]nbF`6 EPDE4SfC 'SX;ʯv,0)C71m yQa1J J3 u(\hB@#RA  3A4?fe& KRӽ4ݶjIf}Gq35?@Lɲ 7b>VjX$o]/^a6T' c |3MD&;F( Cy/{Iwl*j[kyXf2&tg2PYAr(ubF'VL9 k"![]rBf 8bS+,$)C7P/N b7G|/eΌ^5O ud>jź .E[ }}֬MqGh ire:έZ2$vII}^?eV,cݝ;jt::6u|AneWʺ6#cb \:f/2S-{}L,P( &7޼5<+u|r4[R0u=0D4\x;>'<"l8 3]f`l!Uu˱''0_Jfdt%t 'LyTqHm]Foqt"DOa#qJa;JT^o 'r6F Śj4+=VK+T&T_$N3J[F Ql(v((?eQ LW`jtEY8oc{;9)u; >%f5m(yg4O;<[RysxDJ"7"6Mp\21AwiCf@`6 ;:iB0]=I-[%`RibG}O^(`Y#?W FC-/[\Qa1J J0o (*ź  K6<c`փ#TGTPP Rl0ݕj(i(q^95(pP97BJO8?>B$  c<[@Wo{E`a> !Psc|npn[7 XR2Z6[jArS6wc | 74Ah%H()UDe/{u=;r `6 ^"W/ڛ$S-[آib/u2E?moZ',"DO a`eUsnJ,B^jX2?\5IŚbyãf)*B$i&AբRlpYDXfR\^ 5?yj^-u^_6= $OK565ոI=: |3MDH4 AȴPy*E0n2T5T.5i'#w6u'FiZ +Qfg%T F^-55^ի6:FoWbzC_1Ni2y~23J)+Gj眭udJŶB@BW0EE5\mg [lY7}+:U J( fq3g\LUyI_fK]/^z%T57-J+e7 `ckz\e_"Y5/B~;]9GK*F90=r_˹t"mjWQGB.v`Ѫlu$h1;dHXTu Hk>3-!{Z(`YóW*CP?VQN?+)+^RQud6j:Bmn k6< ;s4#ۻMdp)re:RWUL?jf(rRLq5?@L 7b>VjJ$o]/^a>T57-J+?? |!BD}fĵNV[I8*VR|Kk;T<ə^p2>8WfLC~.ĂK7_+#( p94 bk O$E{BEv1hbf"dl.P} vyQN?+)+\RQZr)f*H5' k6<$M|yBJapp)rL[Jӵ7۪LZa.q5(pP97Bj g$NO gcucX8=oS^rc-5y $4Y8eXv㸁\r_ɕ t,}龊fAHm;r&'0WI/ %9ILcdIpFn"D ny ^HwTM*Iź ! w*a&%2MUR$v 7}^}7"7bq[(CiL{#2olHʼnT:O S꯫+R@-tp>02<0gxcnT"GRwU;r{C8*+zIL1u HdicG-*T^Մ(*W[,0l1 I-/ jYQL=0Jy~OP;*Yf*ź  kW]qjQփ#'Zhp $8k*[F# Q$Vfjr}~q7R9- Xlv. ~:[ xO v_1S'[B72}cR%2*(3 @yQT ;r: [V|a'6M|P2wGAr(9WFؠx0_+,=tBrƌ b{ceQ#FOwfl$@[aj3~Q~nqZ)J-aNRQud>jZ9"sA;]}|Gh {7B:GNcUlfv59{oTLUg_M$O]Ȱ-JJU?c<45 2S@>Cjm yGȇt2n;z([K*2F"VQrx l\ OAr(Gq( F'Ue#E<"5}%tXhw ITz}(x} l bQ B]TR?:\~:RUu&6db(]q s|zIKJ2h[>9N[fzY$wXQfN)9LPrbob,>_CN8_Uc)S5_( &\a#p u<^VN˩k9(=_.6m$z a\N ߒsfE7P/'Edd4 6)ߙ׈BBJ"Dl+1am:y~2J)J-!;O^u* xźm|#hEz?B'`i&(;U cf(r-k{j\Lios:6 L`TE65ո2=: |3MD^,c4 7޴ѕ=J F-ELRquhE}ŻB@E`z!JH">\3~nSUۂk*fq5<7L,QX b:W'x`L 65ոZ$92Pc:+0_a.`yk$[nV{Gv6F|8Y'6MItL$<KS♰UhId' Xqe%fڀib}t9*Fkh "d}YQB-y$JN:8,:'e*.%,qm@wEz0'gl!r+Uް|f73m; -7D,qȚXW'x`L T"ÎxsnRbB:'&̵0n(9Y #t!&`rQ>%V@@C[l|aNu&|,#96Fi@ +Q{ !iBS sJ^Fy(FNߗd0lcE7a1?I=j ~PgII*fKB( m\JvvnFU$ff}^}57i~Vu}v*':o.*_7-\tX2SoCvB[K(G\];{a2T$uUr2"Ky9UW<Q|tZ2}Ȼ!BfL#z7F'VQ@Eb-%tNiBGJX^(`Y#?Wbtsia buGQN/x~F)'h^^uN*jdч:%BW0EE]5Tm%Ol)]74Wbuـ$>f}~^;`LUyΖ rW$O>ְ-Ndc<2r2_%)( CO/{u=>;VO$OA<. +4c[@V}>oma:O[ &2!6TI\+Zr& "LV(Rr_mWwt"mjW)GFnNU;rFW~4&T&Ik* '4[g3RIJV,0"D /UNh!)lR]u$Kꆽ j[IO?m-&tD3U޼$z( fq3g\@L7b>jb[jwvJ65M;L2: |3MD)sMY &P!/</OATthfz&'R IOmFb{c<(4o/S,08PC73l`;~>HN\Js^>KuBdٲB` kWYqjQq #yFt>R2޳$fBc^;m6 lY7bj6[$I.VO445ec  2C%[" B(1}{I,s:t}V6zLM=*7N~߭ux4K~,9S3} '5G p;y26ɑu$Z,F/;/77.^, y;rC\0S$o3F\MIo2SNuLV~2fWִX7P6qk[[{vDA=6l2wtl|aNGK5Ăfm8Ot/;Uwssjs-l|_tjo_,=# e%a[J\-JV:sR u v~űn, 3gQƃ?$)Sb|HfU?G8Fp7io}%T&erKN^{vv1Wbf"O9#a bVJN{TJw\aRQu*I ŵB@ kWKGnU|v#sGngTTU H[fbxDTI7Rpq?{7ۋxLg1]&3۳-Nd?X5RSoP),(+ &7޼6"J [KyXff2/UH|>/OAv$蠫u;z+'Z_Jff%%t '}u~f'8kE"LcyC^kn]N>޵~98RX_$xFDU#k<+Am%$v?xQis7WFӖlj f,r^m;F7IL_ȞXS 'ޖjA6+c<2rRͯ%)M &`!\^r&"zAVT<`Vc23tl|aFrE~* ߒu3C'D:($GoTE>[7-2Xs#ckzKh n8!-ty{/o8GAr` -33)T#  ,22(Qa1J^:6o*fh$H c93k5ia5$i@p!7}.;H ߒj>/}~%{-CL0_:43h{wCN2)"{+mCj) [U+iO\+urH"mF^Tā=r6m5,zl4X1}gGFR.9rܕFHS'I}%qʤhj-!2^݂qF98FoE0"DEP-a b7G ߒ\jԁX譭ud(?ŶB@43 uY~.Mw )&*YŤQړ$vfB?m;(7,o#. r:[ shX{Y3ZD71ͧc%Hj3( &T't'xq|&[3w1-Dr<tq2]4!R{`U7b!'0_+#g& ib st^ل`F{ ""TC1NGNy2\N\Js"SuBdŻB@ k?; ?KY ;;|p riU RtzUY$~,f] !5u @O]7h[\C$otO65ո1fu2sc_`g .`,VvV(Rw<|Ui(e]nNl ߒUu6#_8^SJ ILޮ@$*F^41^ʯ>vmC Lc-$5s4}u*f*H5'9$;aUo ug }r|˪"N$VF?P67O;P@Y$Oޖ|CA21{YE-2R>+:g^(TI2Rc7U[V0pA?6lT"R@P+Y2o# 56ʗMe(-gq%t9KY$^FėwAXZ-NBy4N1 ( B']u BiM佼B=W3 <ގ:m+{Akp)Y7 >zY$wf]p)7-L7Bb.j]O$ˢ+n:V2s&%^-( C k'wu<^VD88'6MU'>gL27WAyf@2CLU I@'GedI%%<i8%-p0~5f/>f=w,$Y5B yrnJh zud-7yXOmk3{"e c&^:u7R2[VL.}ef^Qa57.^VI : DY>c[Iec5@|ÜESJLN>f_CSنSp40J[K*N26}27TLpi]a Xz F'8X+*.g'BlFJ{c  YFyFL|"Tc;+#JYJN`J{\:2{u.b {<%I;?m5z&& 6bqݕj(m(Y95!0P7bjtG߸3o&[se! _8_UEc &B(-N7GtX, t<%18㸩K<?2tLRm'|fp+UďhMkx$_+#g'E|9kJ-R^ՕFyvoFMڝ,03cE_a Ci3=P e;mBy=b&(\KB@,yA  a…M7W&_)Ʊ| Սzێf(r=D+{Pv_ʨ7$OުKO% 9?c=u2Sckz\cF[k;ϋMZRFmƍÏ]1uPw2#t"mNGi6# [56i4_+#R5 ^ijst6~8g= d`C)B;Y=N>B%%ԝ~o7t ,Kd K6]q֣5Wh<D3ߪ&$vfI3q:Q7.un]7Bj"$FO)-X5 >%:/&̵Rz`࿫;㲤Q{EV(3xY6mI,zM$uga fL .|F:1d %p9I {!3^ބIvoFd,0BPA bYBqNz RRSZFfdź T|KI?.#P*LTTU3 R[FU֟p$ffRb=507 XRdP$OުtOZp{7L =V2_38%V- ^a-t\y{}TA bDW=pCV6z|TI60v?2+tC^(yGA~In`6kf4[ELI#5&Xifodzʄ(u9+8LC7 T]nxJ)+^RQ7\r)fEɪbkmY+A3}ʃa5V@|p 7r|sUҳDfj] R}lO7J$ @[,1hZ>{;r12ui!>C1{CJ,h-H.uw32RyՍVK*Nbf2\6}OT&2>/qFM.uui'Vvh"5%d9Mch1.8b08hcEwa& Y1N`V^5H4Z FdŪb(\W?O'u Kؤ|ZA3wP?J- <>_UMVfKź TgQ`+A.MwcS&\P{$,0[F Qf,1Fq?@Lw7b18bWfs6 VdVd6c4X#8_TqcokaPa-tyw' $;{{KVrvb}pH"fRvQg7.XE At Y8Osc%T57-J+r |}=.[nb-try/4U;rV 6|{]=COT"D23=G ܙs|\qb_+Z%t 'ۮ)L Tv}(zEL*"D 1;Q:yy[nP JZT;d.2-NL -/׎fmg̉}rbq}Zz$vI6D}^?mP3@c7b>hb[jwtvh+_{߷;P87#@-{7,/I% 7޴1= I[yvi2<6mtl]8{a!hu>hؚ0U/-`'%t1zM#X;ʯv߀8Oe)a B]]WM\zl@JRQo*,\BB`/~0 3i#Nf ߒ$VeI3Qag\DȚ4wt/FJT"Îyw5Mj)P?a"Y5oX2]xQkV5XD&6Mx ,]1!x}X#s( j*FiG~"Ce$T/' o9tb•] tRʄ(u89w lM}aB*iHh*Y}.Uޓ Xf(r- # cݛ;7h_:>$OVC(>T57-J+w 4>%:,̚,=( &1 /{u\˳rQRVX~R1/Uv6eI&2>pQbfLf9rF:@ie%|!!6^ՙ>]"L!3LLRݱBrx/tk.T;dI˛ BHp>S*墒G p+}}ɝgoA&f(r3Fq[i7,X]9$o3Os&ur@T~%:/&e1CpVI'{g4C|J}Qɒ`~6P#$(5.4;ri)^e$ILަD, F^-3x^ի>8I`"D 1VmNy\LCz>sHYu*fB^D oAqII"W/b1{L7C S-f73Mu:NJG 6}3w;)DA\\S2'xr2]]&t`6ur 9*OEdiiBk a8~҄`K `nmnB7Qe t^:6 n*fGٲB` KStA;q-G"0p(R9fejff}pq57Lc7t1:S$oAs$ʔ;c\uQC2S-{E#Nf_CSԄp52n;b(-<y8 lZ-r_mStLbWq8oAr(Kߪ| Vf-I&9|"I0-<{FypVFsWd"D /FY6N4jԁ!RH5W(`fh任$D,9[$;aUo ucCl7Wj575[VuY$ff5 )mWIPlz[jwvkQH$ha-iZsM<16c%"ޕBc(,1}{Is:t=9z`CA.Uu˷(G̕ejBgwUڈg[--tCʯvE,0"dl+1oi2y]2TJOZJidź T|XiQxJh죏٩R[Fs$wff}BlO<,aR:65+57-f"}+mCؓ&9EHVddTIsErymK^F3GBRjŚmyB[q ]CYdmGh yIwR2tzZZ$v[>D}~^U8,cݳ8!J + OodĞ{ÎL5MjL?j^@'UiTI1\E&r o}V6zLMXQ)2+[l|aFrnZF.z FB0 =I-Ouk͞쾜S s^q.hnL$"T _( Di3=1e)J-!<;R(*m(_ 3I;m+Gnp\P{}goE.zFcXq/ LBd$o.y[WWWJ[Ic2r{ckz\cP5 N.ygDM=l2pAzf@mH|ĊhAf'5X/b oj[Bʧ(^p+ /C7 G,eJNl.)N^brAu*fhqBCl2pYApf@IUI;r!5|q)U9xMEo^8kh>68#malQcLXUd\^zuڙv:" HlɌ֏ &YRg9ffIRbq*57 XV:J 6ܛ h\E&{;)uY-jL(1pjƴVgiTI@\E[nF^Ti=tf6I'<5l|aNv(`qF'8 0Igu)`ip@ac^ӄf)8FG7,P"$Cwa yQNJǏ^jN2iUJf@Y*b j3laF`m'}p)qR5ؓB$K3{iyF۳i:6{3O65ո[6 _3C 7F["&+iO2n+;b(-Ry}*DAQ6}2'xLl2y} S f.u]x '~0//&ib)J+TREf$)iSEC9mFY6N>J,%+ B,s7t dB<+A4MwJ&4 3r5&bzj>(Q5mI,wPb>Bd$Co\E:9r=X 52_C )1xnm/JgRRf[V>@<לP2':L4[^*[,U`WĮJG<AXm%TwLt1TtNzD<6 D 7q#b1>QN?+ N-STO^*gDb^9kaUoZ+GMt>.R2xZO$vfFyk'5>7 @aU7w*;]t]mOڀ{+#c3Gct$S`) 2yTNdVą:tLO9;EρZHz6mg$zLkS1}..k0ȳ-q=0g5u0{!mf+_ ^"DO9aQNQ~[ryZ%(\,&B@&+I _&+s##{Ght_[NU`tF|0q3WaL y<jt K/nk$<{?Ir G42S%)P( CK{In,=E"*[|OLSo=r_6aN7tjTbWMGa|baĊ'Vf_+f{C%|ib%uT`8F/~ "D -B b7Qe)J-!+T:ud( m((=o6t 3e׃BJ5Dtp)O4xl7fIRpq{7tLg1V]>S$ose6%J3u?L2\]n2Sc?( |y}4I< v[r f[oBVW8 2&t ɠ} fƿCU;r-&܆J`'E 5%x=v*u  Uap kL1C7-/[\t.F{q'RQZr).dB\7Kʁ)(^RZZV,ŴRmDQ/]q$Y֭FT`}go_r,K}q^C7$L)7j B:v$Kgc[{c@ Y2WC!u[( &yo?^7RDsxDAJ"1gwq"K1AAsf@fUNF0_(kJv;z-!>ЯUw BQo+3aD1~AaVp)-F5s4Yg|*5fy"*kK/tAbHUƽg*]7{cEؼl.v̭9{oTL[gJ 6훨o\El(7 2xfc ڴ{792L;RyrGV)Du<6m. r2m jA~Im`6 8T~P^6IIm6Fb-!Nѫ.pVViWdjSP-)"Di~}?>`挶^O92K D W#HCČA1qO&^9Rs.5$Vf,cU697LPTn:6CaCVc&{\f/2SC}L=num yGN$'ur %,}XvA\x;<"l4DfHVN u@;4J4guh[9B^ؒ^F2GC=9m,eWsJ9$Ԭ*ZT;dIdB` kWKGnCaUo!ZgGh %YRpC~4?1{Jy  ujtC[j[qO.X{'cV$y> vcRj;C(ygo &< B|}İ->gɒ l>YrGC.zri0-5.nev`¤ ^(^8CjUCA"Ny1 ;FjŒ^T}V*t4~{ . O5 ?VF`<_NRc2.$vj#}uq39P!L@P}:]nɺx3od7i[ock:ӎO( C)du8m#:J:"HCE jytN~f-$8uS~Vu.KŴRmDQ/]q$Y֭G s֦[B2ԓ$V/}VQ{=@R y~:6jx[AO.:K67a$2SKC|/$jhjyckzI8/;B-Y-{OVv.^A2f2mzs[l"V_I@j;.U'>F':Se)rg9YcTlʧ [wLBTWK1)u:y2J mFK(x?;df*H-DW9+ރ]G$0$q*4Z[KZz$vH>D}Pa}S@cἅ7b[bHM(>T67-J+k~c'C.=k KyktN$Ju<^k|A8xDA\T&t"pX^'{(`6TnO 0&e,lGao_F~{c$@kXfd۹nݰ{1X/ b7G!OVg~G4^ ZR]֚fh$F~yms 4Gj^*эYR=kzӖj( 95S@LZ-7bjt_tV”c^J5-k6e1( CX8R$J%r[zOv.ʄ(u89Wd"Di+_a`fyv =<_Ў.UF+g_Img ud*Js-!Tl~,l1 b-/ b7Qa?tqi#RQ;r)(\*HB@W3(CsS#\_Ht_ҤZz $vF6D_Nq;~SFbȞ`:6|=ex{7oUYc%ã_( y-R2|^[V'-zr[l|aNfnwJ@f$;r4R^%*liCBibW-)9Pخ8J—_,1$/ q=aD JAoJi\ Vr\< F(*ź B=v][;Vm-&Np)z[RUޗ`|gfRb587Ӟl7~:.$OA<31+62$YWVSͫ-{k!J1 E][S;T<[CvX3TQf%lP8W:^f@C~.ĂO ͞d6I(v69FL{c"ūL"iAWbr8;L#LVJEbJTqT*K4~T#WW s;k+G&t>k~bpIDffRp{+z|L{ouIqAn;K#ߙrrA /:%f搀>f"&~yg= A:qk]s;F0] "m j GM>m.v|]xF4d'ibڌ*o;>6~_r"dE_mrY=!-iz MHϭ_2f$w Śb|@ (/U#JIB죏ū/Rv[Fq⹢7nfNgbQ/L] r[jwhVOJvhI^xe8#`eB%,Y( &VtTITE(r sXVTX"tozd6V\<_ B_F'VE_+rqJu H$ic{-)^Ӡ"8dAS@0.-a v .GiU y<y [j6OJs`6)5 2sc8())ZXK#Ti2b/r [-?V$d2<6m2W5Hh& mga\@¼.{l3_m .dEV&A7x-!t9!T|]p 7ɓ,wQ L=4xXf}Ih&4\d1ѮB` k …M"G&E4NORgo.FNiJqskmu[." Ovg\Eֶ[rȜ2r'8}Ca_( &ڎY5tpbEs-v)D2VmՇTJTU}qbF3.u!9f'0ڲOiciTcT;j^{ (}_^{kZ B.,vX ߒ60x)HzLT$.**> 49 L|ym%LAt>i{kyCSl 6fI}^?mK{dU7b]RC/Ӵjo2{7P5JVK7:/&J]p/A>qE=O=ARFew_'VE_+mڀI -!~pf#k[ kL"NC1NyWs2J^T}V,*H4~ɯkoY{ƒm%${@lp w zj6}S,l{_4[j:#OJ36S w[8b2]C%LJS Y[ZiY7D4i" , seRb+,7,cݝ"œ~:6tsOJsrGr\[ |-J1Y^0[bk/J}0DQRyD0\R/tl>LpA',UduyohEliVn_+mڀvEb-Txc q,"dl+1tBvyus2\0,dqORQu(\qCN"B@ kS9 a*Pm%8|xRbrYl#{fW){a LoY?[jwt.65ո 0H2pc:'7 &N!s\L'rZ"qXTFnR/Rxl>LpA',U?lL4;R Uiě_+QI2[k4 '-Bz)LEvo:,0`o#EDy~}?>x^1"u**f͗BL glm*|zGKJ2hpPFu7RӖ^fF䁢=7 Uy_cwnS`\m,7޴I6*7Bjǩ[[u}dQ=<C2':L<[un\I@.Վ;r4iGVEe$LL1m*G[U96^٩f#Q?O0cPNBۆN1 + ^7UJKBH!WRjf}^?5# XHVjtE{]/O΀65([,gckz񂖵1(*7 }T69s1Zd]9VS%^(&Kyc8c5;[K^q&H0\6a2t.A2QwGAvF->U;r2^*+zIL޸#JݖGT^ՄLE8nC8l"d+t~lb;~OJ%4\4|SRu&d2A k[/]}0m%O t>xRuFM2nIfc}^?mXn c@7w:W_nɞc`t>T57-B+jtOSc)z&Zz( " xѢTA}"+qQX3Cn2/[l|aNh H@Czy՗dSe$*b}wBp `U!!^Uf+Wf`м#xkj3xPN~J[9CRSuJfdTbL)k]EM 2     n    2   2 %v , 3\ : A I1 P4d Y3 a3 j5h r 8 y t  doc_indxidx_dskidx_chkmntlslibydattimigngetstrselectcreedcopysrcnamsavnamdeletedelnamrenamenewnamgetcurdmntdskunmntdskdiskidfdiskvertcheckmtchgdirmҧ(Rf~V -SUY( .Ŋr| kWVȃaUoFHڏ}.[ܞ Uޓj>\s5@XX!7b[buConO65ݸ4X: |;M}f2:-7C[ˍVv17V)D}Q6m2'["m2֜UGl26-w9;zFiG@Ke$b#k6ibz-!TqHrRFo |"D b?Q b7Q?kfy@0!jQ]*@dF]J"3maW8ؒGhŤt>x|Ťe޻$~vfV/S}na'wBr6[ny[WH$h7-i[V[]+7>~D *ctBq? @LE N S W Z Z [ \ ] U^ ^ `aVjjl m m^mmwM{K7798!49e99!4 5 B6 l5 6 l5!:!8<![<!y<!y<"=="="=">">#*A#A#!4#A#4C#F$I%J%J%K&1G&I&I&I'M(L)CN*9O*IP*zP*P*P+YQ+oR+R+R+R,U,eU,U-V.jW.X.6X.{X/X/cY/Y/Y0Ld1d1Ze2e2f2f2f2g 2]g3g3h3-i3ui3j4n4np5q5np6s7s87t9v:M{;>l>څ>>?Q@@l@ƍA]@BYJC{D|E}Ez~E~!There are three ways to use HELP:!$1. You may press the "?" key at any$time during your work. The helptext that appears will apply tothe command you were using when you pressed "?". When you resume !(by pressing "R"), your work will!be exactly as you left it.2. You may view information onspecial topics right now by selecting one of the topics listed at thebottom of the screen. Type the!first letter of thof thetext.#Insert new text: Type the text. It#will be inserted in front of the highlighted cursor.Move the cursor ifnecessary beforetyping."Delete some text: Use backspace to"delete in front of the cursor. Use the delete keyto delete what is highlighted. Move the highlightas necessary before deletion. %Replace some text:Just delete the old%text and type thenew.$Move highlight: Use Character/Word$Left/Right keys (seeunder Keyboard).FORMULAS"Formulas are recipes for producing"values. The table of functions%that may be used in formulas is shown%below. Other parts of formulas"are described following the table."$The following functions operate on a$set of values either given asarguments or contained in areasreferenced by the arguments:%AND(list) Returns True if (and only% if) all values are True, otherwise returns False.&AVERAGE(list) = SUM(list)/COUNT(list).&%COUNT(list) number of values that are% given exple desired word.!%3. You may familiarize yourself with% all the available information by "paging through the help text right"now. Select "Next" (press "N")"Previous" or "Start" page.%If you need information on a specific%#command, highlight the command name##on the proper menu (using the space#bar) and press "?". Applications %The following table provides an index%to the commands and helptopics which apply to common questions. %If you need to: You should consult:%$enter data: Value, Lock, Help$Keyboardenter text: Alpha use menus: Help Commands enter arguments tocommands: Help Editing edit text or %formulas: Help Editing, Edit,%Alpha do calculations: Help Formulas use mathematical or financial functions: Help Formulasmove through the%sheet: Help Commands, Goto%create headings: Format (Continuous), Window Split Titles use data in inactive sheets: Xternaldefine or deleteicitly or by reference. "MAX(list) largest of the values."#MIN(list) smallest of the values.##NPV(d,list) Returns the Net Present# Value of the cash flows represented  by the values. The first parameter d is thediscount rate.%OR(list) Returns True if (and only% if) any argument values are True, otherwise returns False.%STDEV(list) sample standard deviation%of the values.SUM(list) sum of the values.The other functions have fixedarguments as shown:!ABS(n) absolute value of the! number n. ATAN(n) arctangent of n inradians.!COS(n) cosine of the angle n!given in radians."COLUMN() current column number."#DOLLAR(n) the text string showing#the value n in $ format.EXP(n) e to the power n.$FALSE() the logical value False.$$FIXED(n,m) the text containing n in$ Fix format with m decimals.  m=0 is the same as Intformat.#IF(f,a,b) Returns a if f is True,#otherwise returns b.INDEX(vector,n) Returns the nthponential&"notation (123.001E3). The exponent"!sign (E) may be typed in upper or!$lower case. Percentages may be typed$#in, followed by percent sign (12%).#%Text-valued constants are enclosed in% double quotes (the constants may not themselves contain quotes)."Multiplan may produce error values"that will propagate through theoperations. These are:&#N/A not available: a special value&that may be created using theNA() function and that will bepropagated by arithmetic operations. ##NAME? result of an undefined name# reference. %#NUM! result of overflow or illegal%use of arithmetic functione.g. sqrt(-1).&#DIV/0! result of an attempt to divide&by 0.##REF! relative reference reaching#outside the sheet or referenceto a deleted area. #NULL! intersection of disjoint areas, e.g. R1 R2.!#VALUE! use of text value where a!number is needed or viceversa.Use of references in illegalcontexts when a value isneeded.%Absolute references are element in the vector.$INDEX(area,n,m) Returns the value in$the nth row and mth columnof the rectangular area.$INT(n) the largest integer that$ is less than or equal ton.%ISERROR(n) Returns True if (and only%if) n is an error value.%ISNA(n) Returns True if (and only%if) n is an #N/A value.$LEN(t) the length of the text t$in characters.&LN(n) the base e logarithm of n.&$LOG10(n) the base 10 logarithm of$n.#LOOKUP(n,area) works as follows: If#$the area is higher than wide, n will$#be looked up in the first column of#the area. If n is less than the$first cell in the first row, #N/A is$#returned. Otherwise Multiplan scans#$for the row that in the first column$!contains the greatest number less! or equal to n. The result is the value in the last column of the$same row. For areas wider than high,$"rows and columns are interchanged."%MID(t,n,m) characters n through m of%the text value t. MOD(n,m) the remainder of the integer division nspecial names%$that incorporate absolute row and/or$#column numbers and that are used to##refer to particular cells or groups#$of cells. A reference may be used to$!get the value from the referenced! cell. Absolute references may be &entered simply by using direction keys&"followed by the Reference key (@)." RnCm (e.g., R2C3) refers to a single cell. Rn refers to all of row n."Cn refers to all of column n.""Rn:m refers to rows n through m"(short for Rn:Rm.)%Cn:m refers to columns n through m%(short for Cn:Cm.)%Relative references are measured from% the cell containing the formula. They can be entered using thedirection keys. The forms are:&R[-n], R[+n] are the nth row above and&below the active cell.$C[-n], C[+n] are the nth column left$and right of the active cell.(the + sign may be omitted)!R is the row containing the!active cell (i.e., R[0]).$C is the column containing the$active cell (i.e., C[0]).#and combinations o/m.!NA() returns the #N/A (not!available) value.NOT(f) the opposite of theTrue/False flag f.PI() the value of pi. (3.1416...) !REPT(t,n) the text t repeated n!times."ROUND(n,m) n rounded to m decimal"places.#ROW() the current row number.##SIGN(n) Returns -1 if n<0, 0 if#n=0, 1 otherwise.#SIN(n) the sine of the angle n#specified in radians.!SQRT(n) the square root of n.!$TAN(n) the tangent of the angle$n.#TRUE() the logical value True.##VALUE(t) The text t must contain# the representation of anumeric constant. The value ofthat constant is returned.%Formulas are made by combining values%$(text and numbers) and references to$%other cells with the usual arithmetic%operations and other functions.!Numeric values are stored with 14!"digits of precision (mantissa) and"&a decimal exponent ranging from -64 to&+62. Numeric constants may be typed as integers (123), decimal &fractions (123.001), or in exf the above, e.g.#R[-2]C.Names may be defined to be any!absolute reference (with the Name! command). A name may be used anywhere an%absolute reference can be used. Names% must start with a letter and may %contain letters, digits, periods, and%!underline characters. They may be!%entered by pressing the Reference key%$(@) and stepping through the list of$#defined names using the directional#keys.The operators in formulas are:+ arithmetic addition- subtraction* multiplication/ division%^ exponentiation. Calculated by%the rule: a^b = exp(ln(a)*b)for exponents that are notintegral numbers.% percent, same as /100&& text string concatenation. The&formula "$"&"1.00" will yield:"$1.00"."<, <=, =, >=, >, <> are comparison"operators: less, less orequal, equal, greater orequal, greater, and not equal.To be used for comparing numbers only. &The operators require single values as&operands. If press when they occur. The status line "displays coordinates of the active"!cell, its contents, percentage of!&storage remaining, and worksheet name.&$There is a highlighted "active cell"$#on the worksheet. The highlight can#be moved around by pressing the&direction keys. The same keys are also&"used for scrolling the contents of"$windows. The Home key may be used to$go to row 1 column 1 quickly.#The command menu offers a choice of#$commands. To get going, you need to:$"1. Select an active cell. The"direction keys may be used.Thesame keys also scroll theworksheet in the window.#2. Select a command. There are#two ways to do this. You canmove the highlight to acommand word using the spaceor backspace keys and thenpress RETURN. Or, type thefirst letter of the commandword.A new and more specificcommand menu or the parameterfields with the proposedresponses will be displayed.%3. Specify the parameters of the%command. The TAB key may beused to move from field tofield. See "Editing" for other useful tips. %4. You may use the Cancel key at%any time to return to the mainmenu.$5. Press RETURN. The command is$now carried out.%Press "?" for additional information.%ALPHA Used to enter or edit alpha text terminated by RETURN. An emptystring of characters may not beentered with this command. ALPHA/VALUE If an Alpha or Value command isterminated with a direction keyor any other key that moves thecursor, Multiplan will respond!with ALPHA/VALUE, ready to accept!!another alpha or value entry. The!$first character typed will determine$the type of entry. The#characters 0 through 9, =, +, -, (,#and " select VALUE; allother characters select ALPHA.%This process may be repeated to enter%a sequence of text or values.!If the text is too long, an error!#message will result. Note also that#%double quotes may not be used in text%strings.BLANK Blanks out conented with a#vector (a rectangular collection of# cells of width or height =1), it $will be automatically intersected by$$the current row or column, whichever$"is perpendicular to the vector, to"obtain a single value.%The following three operators operate%on groups (sets) of cells:&(space) intersection of two areas, the&collection of cells thatbelong to both operands.%, union of the two areas; cells%that belong to either operand.%: range operator: the smallest%rectangular collection ofcells that includes all cellsin either operand.For example, R1C1:R2C2 is therectangle with R1C1 as itsupper left corner and R2C2 asits lower right corner.COMMAND OVERVIEW%The Multiplan worksheet consists of a%"grid of up to 63 columns in width,"&and 255 rows in length. The screen has&one or more "windows" into"the worksheet, and an area showing"#command, message, and status lines.#$The message line suggests the action$to be taken or explains errortents of specified cell(s).&The parameter must describe an area of&the sheet. Check if all names$have been defined and also check the$!use of parentheses and operators.!&For more information select "Formulas"&(F) on the Help Menu.COPY#Replicates cell contents into other#cells. A variety of sources anddestinations is provided.%Overlapping copying is not permitted.% The from: and to: area must have compatible shape. COPY FROM $Copies contents and format of a cell$&or group of cells to another location.&Parameters are:&1. Description of a cell or the group&of cells to be copied.!2. Area to be filled with single!source cell, or upper left cell where the source group should be !copied. Copy from a source into a!similarly shaped target area isalso permitted. COPY RIGHT &Used to make a row of identical values&or formulas. Parameters are:&1. Number of copies to be made to the&right of the "source".Total number of identEditing.FORMAT$Presents four options for formatting$cells as described below:FORMAT DEFAULT CELLS!Used to change the format for all!cells that have the "Def"%property. The desired format (as well%as alignment) is described%under the Format Cells command below.% FORMAT CELLS $Sets a specific format and alignment$for one or more cells. Just#typing "FC" shows the properties of# the active cell. Parameters are: 1. Cell or group of cells to be formatted. 2. Alignment. Choices are:"Def Aligns as specified in the"Format Default command.Ctr Centers cell entries#Gen (General) Aligns text left,#numbers right."Left Aligns cell entries to the"left."Right Aligns cell entries to the"right. - Do not change alignment. 3. Format. Choices are:"Def Format as specified in the"Format Default command."Cont Continues long text across"column border, if next cellempty and also formatted"Cont".&Exp ical cellswill be this number +1 (the original). #2. This parameter (the "source" of# copying), is usually left as the !active cell which is the proposed!response. A vertical group ("vector") may be copied instead to create a matrix. COPY DOWN $Used to fill a column with identical$$values or formulas. Parameters are:$%1. Number of copies to be made below% the "source". #2. This is the source of the copy,#usually left as the active cell!which is the proposed response. A!horizontal group ("vector")may be copied instead to form amatrix.DELETEDeletes all or parts of rows or"columns. Space is closed up, hence""cells to the right of or below the"deleted area will move. DELETE ROWS $Deletes all or part of row(s); space$#will be closed up; formulas, names,#and references are adjusted.$To delete the active row, just press$RETURN.&Effects of deletions on references and&formulas, as well as on$structures of rows and columns, m (Scientific notation) Displays&numbers as a decimal times apower of ten. Number of digitsas specified in "# of decimals." %Fix Rounds to and displays number%of decimals specifiedin "# of decimals" field.%Gen (General) Displays numbers in%the most appropriate formconsidering the size of thecell and of the number. Int Numbers will be shown as integers after rounding.%$ Displays numbers with leading%dollar sign and 2 decimalplaces (negative numbersenclosed in parentheses).$* (Bar Graph) Displays as many$asterisks as the value of thenumber.%% (percent) Displays the number%times 100 followed by a percent sign. - Do not change format.$4. Number of decimals. This is used$in the Exp, Fix and % formatsabove. FORMAT WIDTH #Sets width (3 to 32 characters) for# specified column(s). Multiplan's initial default width is 10 characters. #Text (words) are cut off at edge of#&column, but cell content iust$be carefully considered.The parameters are: 1. Number of rows to be deleted 2. First row to be deleted$3.4.These two parameters are usually$"left as proposed. They may be used" to limit the deletion to a range of columns. Cells below the range will move up to occupy the deleted space.DELETE COLUMNS!Deletes all or part of column(s);!"space will be closed up; formulas,"#names, and references are adjusted.#Parameters are:#1. Number of columns to be deleted#2. First column to be deleted$3.4.These two parameters are usually$left as proposed. They may beused to limit the deletion to arange of rows. Cells to the!right of the range will move left!to occupy the deleted space.EDITPuts contents of active cell on command line for editing. Edited value is reassigned to cell when RETURN is pressed.&When editing formulas, check carefully&before pressing RETURN.#Use the Alpha command to edit text.#Press "E" now to see section ons preserved.&$Widen column to display entire text,$or use Format Cells (Continuous%format) to run text into next column.%$Numbers too wide to be displayed are$indicated by # signs. Widen#column(s) to display entire number.#Parameters are:$1. Width of column in characters. A$"D" will cause the columns touse the "default width" (SeeFormat Default width).#2.3.Range of columns to be changed.#FORMAT DEFAULT%Used to set formatting for cells with%"Default" formatting, width&for columns that have "Default" width,&!and for other formatting options.!FORMAT DEFAULT WIDTH#Used to change the width of columns#that have "Default" width.$Initially all columns have "Default"$width.FORMAT OPTIONS&"comma" option: when selected, numbers&will be displayed withcommas separating every thirddigit before the decimalpoint. This affects only fixed,integer, percent and dollarformats."formulas" option: the formulasthemselves will be show Lock Cells command can also unlock cells. In a worksheet the next unlocked non-blank cell can be easilylocated by a special key (see Keyboard). Note that values imported from$external sheets may be unlocked only$by the eXternal Copy command. LOCK CELLS #Used to protect specific cells from#%unintentional change. Parameters are:% 1. Cell or group of cells to be locked (unlocked)."2. Shows current state (Locked or"!Unlocked) of current cell. Use to!specify desired state. LOCK FORMULAS $If confirmed, all cells in the sheet$"that contain text or formulas will"#be locked. This may be a convenient#first step in creating a locked&sheet. You may, however, wish to leave&certain text strings unlockedor lock some important numbers.MOVE"Used to move whole rows or columns"from one place to another.MOVE ROW"Moves whole rows from one place to" another in the sheet. References %affected by the move are adjusted, as%are definitions of namn, notthe numerical values of theformulas. All field widths will be automatically doubled to accommodate the formulaswhen this option is turned on.GOTO%Used to move cell pointer over sheet.% GOTO ROW-COL Moves cell pointer directly to!specified row and column. If cell!&requested is already visible window is& not moved. "Otherwise window is shifted to the"specified cell. GOTO NAME "Moves cell pointer directly to the" upper left corner of named area. &The direction keys may be used to step&through the directory of names. GOTO WINDOW "Moves worksheet so that the active" cell is at the upper left corner of the designated window.INSERT#Used to insert new blank cells into# the sheet. Existing cells may be %moved to make room for the new cells.% INSERT ROW $Inserts entire blank rows across the$"sheet, or portions of rows between"#specified columns. Rows below added#"rows(s) are moved down. References"$affected by insertions are adjes.Parameters are:1. First row to be moved.&2. Moved rows will appear in front of&the contents of this row.$3. Number of consecutive rows to be$moved. MOVE COLUMN %Moves whole columns from one place to% another in the sheet. References %affected by the move are adjusted, as%are definitions of names.Parameters are:1. First column to be moved.$2. Moved columns will appear to the$left of the contents of thiscolumn.$3. Number of consecutive columns to$ be moved. NAME&Used to name a cell or group of cells.&!The names may be used in formulas!&or in other commands. The name command&is also useful for inspectingthe existing definitions. Theparameters are:"1. Name to be defined. Names must"start with a letter and may!contain letters, digits, periods,!and underline characters. To review names already defined, "use directional keys (right arrow:"next name, left arrow: previousname).&2. Definition of the cell(s) that the&usted.$Name definitions are adjustedaccordingly. Parameters are:"1. Number of new blank rows to be" inserted. "2. The new space will be inserted" before the contents of this row. %3.4.These parameters are usually left%with the proposed values.They may be used to limit theinsertion to between thespecified columns. INSERT COLUMN $Inserts entire columns in the sheet,$$or partial columns between specified$!rows. Columns to the right of the!%space inserted move right. References%$affected by insertions are adjusted.$Name definitions are adjustedaccordingly. Parameters are:%1. Number of new blank columns to be%created.%2. The new space will be inserted to% the left of the contents of this column.%3.4.These parameters are usually left%with the proposed values.They may be used to limit theinsertion to between thespecified rows.LOCKUsed to protect specified cellcontents and formulas fromunintentional change by other commands. Thename is to refer to. Absolute references may be entered by use "of direction keys. Groups of cells" are formed using a colon (:) for ""ranges" or by using comma (,) for" "unions". OPTIONS$This command lets you turn on or off$various optional features of Multiplan. #"recalc" option: controls how often#formula recalculations areperformed. "Yes" causes recalculation whenever a cell is changed.!This may take some time on a busy!sheet. To get quicker response turn the option off and press the Recalc key (!)!when you desire to see up-to-date!results.#"mute" option: silences the audible#alarm.!"iteration" option: when "Yes" is!selected, the recalculation ofworksheets with circular!references will be repeated until! a completion test (see below) is satisfied. The following special "functions may be used in iterative" worksheets: DELTA(): returns the maximum"change in the values of cells from"one iteration to another. Byreferring to DELTA() frf output,$#and printing of formulas instead of#%their values. After RETURN, Multiplan%!will resume the Print command for!$the selection of the Printer or File$to be used. The options are:"1. Description of the rectangular"group of cells that is to be!printed (if not the whole sheet.)!%2. Arbitrary text may be sent to the%printer using this parameter.3. A printout of the formulas(instead of the values of the formulas) "can be obtained by selecting "Yes""for the "formulas" option."4. The printing of row and column"numbers may be requested or suppressed. QUIT&Ends Multiplan session when confirmed.&This command will not save the"active sheet. Use Transfer Save to"!save worksheet before using Quit.!SORT&You can sort any part of the worksheet& using this command. The sort key %may be any designated column. Rows of%%the worksheet will be exchanged until%#the values in the Key column are in#!the selected order. Both text and! numeric values are allowedom theworksheet more than once themaximum change in a particularportion of the worksheet may be calculated. ITERCNT(): returns #N/A duringnormal recalculation and the!iteration count (starting with 1)!during iteration.&"completion test at" option: specifies&the location of a formulafor completion test. Iterationwill end when this formula evaluates to TRUE. If the option field is empty, the formulaDELTA()<0.001 will be used.PRINT$Used for printing of worksheets. The$%menu command Printer starts printing.%&File prints printable output on a disk&file; Margins sets margins to%be used; and Options defines the part%&of the worksheet to be printed, allows&&insertion of a control line at the top&!of the output, or prints formulas!instead of their values.&Time required to print depends on size&of the sheet and the speed of the printer. &As many columns are printed across the&"page as will fit. Leftover columns"$begin a new page. When all rows . Text !values will be ordered before any!!numerical values. Empty cells are!always sorted last.$To create multi-level sorts, sort on$the last key first, and proceed#backward sorting on the other keys.#The parameters are:1. The key column number.%2.3.These parameters can restrict the%sort to a range of consecutiverows.$4. Sort order. ">" means ascending,$"<" means descending values.TRANSFER&The subcommands of TRANSFER affect the&entire active worksheet orsaved worksheets. TRANSFER LOAD #Loads a worksheet from a disk file.#"The parameter is the "filename" of"!the file. Spell and punctuate the! filename exactly as it was saved with Transfer Save.!The direction keys may be used to!!display the file directory on the!screen#and then select a file by pointing.##Data may be automatically copied to#&the loaded sheet from other supporting&!sheets. See XTERNAL COPY for more! information. Use TRANSFER OPTIONS to specifyspecial file fohave$been printed, the next set of!columns will begin on a new page.! PRINT Printer Starts printing on the printer. PRINT FILE %Directs printed output to a disk file%instead of a printer."If a file of the same name exists," Multiplan will ask permission to #replace it. Output to the file will#start immediately.%The parameter is the name of the file%!to which output is to be printed.! PRINT MARGINS Used to set page dimensions for$printed output. After the RETURN key$%is pressed, Multiplan will resume the%&Print command for the selection of the&#Printer or the File to be used. The#parameters are:%1. Left margin (in print positions.)% 2. Top margin (in print lines.) "3. Width of printable area on the"page (in print positions.)#4. Height of printable area on the#page (in print lines.)%5. Height of pages (in print lines.)% PRINT OPTIONS %The options allow part of a worksheet%to be printed, the insertion of$a control line at the top ormats. All#special format files will be merged#"into the active sheet, rather than"loaded as a whole. The filename must conform to the %general rules of the Operating System%of the machine you use. Only$worksheets saved in Multiplan may be$loaded by TRANSFER LOAD.$To create new worksheets, there must$"be space available on the disk and"%the disk must not be write-protected.% TRANSFER SAVE %Saves a copy of the current worksheet%&as a disk file from which it can later&be loaded with Transfer Load.#The parameter is the "filename". If# the filename already exists, the #message, "Overwrite existing file?"#$will ask for confirmation to replace$!that file with the new worksheet.!$See TRANSFER OPTIONS for information$on special file formats.TRANSFER CLEAR After confirmation, the sheet is cleared. Columns are set to 10&characters wide, default format is set& to General. "Sheet name is set to TEMP, with no"depending or supporting sheets.TRANSdow across the screen&at the row indicated. The new&window will occupy the space below the&row selected, and may be#linked with the original window for#synchronized scrolling in thehorizontal direction.WINDOW SPLIT VERTICAL&Splits active window vertically at the& column specified. The new window &may be linked with original window for&synchronized scrollingin the vertical direction.WINDOW SPLIT TITLES Splits active window into 2 or 4 windows which scroll together.#This command is used to hold column#titles or row headings in place$while cells are scrolled. Parameters$are:%1. Number of rows to become a window%across the top of the screen.!2. Number of columns to become a!!window at the left of the screen.!#The remaining display space becomes#%the active window which is linked for%#horizontal movement with the window##above it, and for vertical movement#with the window to its left.Note that the acceptance of the"proposed parametersFER DELETE#Removes worksheet from file system.#TRANSFER OPTIONS%Modifies the context of the following%TRANSFER operations:!The setup argument may be used to!#specify the directory or disk drive#for saving and loading files.&The file "mode" may be used to set the&desired file format for the#following Loads and Stores. This is# important for data exchange with $other programs. "Normal mode" should$be selected for all files thatare not used for interchange.#"Symbolic" mode is used for loading#and saving of worksheets in the%symbolic SYLK format. In "Other" mode%#VisiCalc (TM VisiCorp) format files#may be loaded.Great care should be taken to%distinguish files that have different%formats!TRANSFER RENAME&Renames active sheet. Offers to update&%references to the sheet on supporting%&and depending sheets. The parameter is&the desired new name.VALUECan be used to enter a value orformula in the active cell. The#command is complete will split the"$titles so that the current cell will$be at the upper left corner of&of the data area in the active window.& WINDOW BORDER $Used to border or to remove a border$from a window.#Note that borders occupy one screen#$position on each side of the window,$#thus reducing the display area by 2#"screen lines and 2 screen columns." WINDOW CLOSE #This command removes the designated#window from the screen. WINDOW LINK !This command can set or break the!!links for synchronized scrolling.!Parameters are:%1.2.These parameters define a pair of%windows. In most cases theproposed values are acceptable.Note that linking of windowsthat are not "neighbors" is not permitted. #3. The parameter shows the current#!state of linking, and may be used!to change the linking. The direction of linking follows the direction of window splits.XTERNAL!This group of commands deals with!!references to inactive (external)! worksheets. XTERNAL COPYd when RETURN is#pressed. A directional key or#any other key that moves the cursor#will also terminate the value%and move to the appropriate new cell.%Multiplan will respond!with ALPHA/VALUE, ready to accept!another alpha or value entry.#This feature is described under the#Alpha command.&The following simplifications are also& available: $Numbers may be entered directly. The$Value command is entered auto-#matically when the leading digit is#typed.%The characters =, +, -, (, and " will%also start the Value command.#At the beginning of the formula and#after entering an operator, a&relative reference can be entered just&by pressing the direction keys$to move the highlight to the cell to$be referenced. The reference&may be changed to Absolute by pressing&the Reference (@) key.WINDOW%This command is used to control size,%!number, and display of "windows",!%which are subdivisions of the screen.%WINDOW SPLIT HORIZONTAL&Splits active win %Copies data from an external sheet to%the active sheet. Optionally,#a permanent link may be established# between the active sheet and the $source of the data. The Name command$may be used immediately after!the copy to create a name for the!target area that is related tothe name of the source%("filename.areaname".) The parameters%are:&1. External sheet name. The direction& keys may be used to step through names of the supporting sheets.!2. Name of the source area to be!!copied on the external sheet. The! direction keys will step through !the permanently copied names from!thesheet defined by the first parameter. &3. Target area on the active sheet. A&permanent link (see below) may be broken by deleting the target area definition. 4. Link option. If "No" link is "selected, the copy will be carried"out and the command will"terminate. If "Yes" is selected, a" permanent link is established as described below.&Linked copies have a number of spe EDIT FIELD LEFT,$f1%word right EDIT FIELD RIGHT,%f2&character left EDIT CHAR LEFT, f3&$character right EDIT CHAR RIGHT,$f4delete DELETE, f5 reference REFER, f6recalculate RECALC, f7#next window NEXT WINDOW, f8##next unlocked cell NEXT UNLKD, f10#end END, f11home HOME, f12"page left PAGE LEFT, f13" page up PAGE UP, f14 "page down PAGE DOWN, f15"#page right PAGE RIGHT, f16#cial&properties: a permanent record#of the copy parameters will be kept#!with the active sheet. Every time!%the sheet is loaded, the copying will%be repeated so that the most$up-to-date information on the source$"sheets - the "supporting" sheets -"$can be imported to the active sheet.$$Whenever sheet relationships change,$$the supporting sheets may be updated$%with a "receipt" showing which sheets%$"depend" on them. These lists may be$ inspected using the XTERNAL LIST command described below.#The imported data will be locked on#"the sheets. When a cell containing"!imported data is highlighted, the!status line will show:%[source sheet name source area name]%%Linking may be changed or broken only%by redefining the target area&or deleting the target area definition&in the XTERNAL COPY command. XTERNAL LIST $The relationships between the active$"worksheet and other worksheets are" displayed: %"Sheets supporting" shows sheet names%"and possibly a substitu^.f..]mp.datte name for"%worksheets which support (export data%to) the active sheet;%"Sheets depending on" lists filenames%!of sheets which depend on (import! data from) the active worksheet. &Press any key to return to the display&of the active sheet. XTERNAL USE Sets a substitute name for a$supporting sheet using the following$ parameters: #1. New sheet name to be used. This# name should not be used in other substitutions."2. Sheet name currently in use in" existing links. All copies using this name - whether a real sheet name or just a formal or "dummy" name - will henceforth refer tothe first parameter.KEYBOARD for Fortune 32:16Action: Key to use:cursor up up arrowcursor down down arrowcursor left left arrowcursor right right arrowcancel CANCELexecute EXECUTEbackspace BACKSPACEnext field RETURN TABhelp HELP$word left  & &PPL#NULL!#DIV/0!#VALUE!#REF!#NAME?#NUM!#N/A'T+-^*/,&:<>=0123456789-."+(=RrCc[]dpP`rbf>864(+-=>^/*&:<,<<> DCGLR-DCEFG$*%-BD@>'()TEMP0F 1SF/F@F2SF3F@FF@F) #nF#F#uF@F#\F@F#hF#jFsheetformulacelllockprintrowoptionlinkmarginscommandalignmentavailablemultiplandependsupportkeysavechangeeditdefineenterfilecolumnwindownumbernamewidthformatreferencecopycannottoillegalfromofselectnotdeletebeforehorizontaltoogroupdirectionblankverticaltransfersymbolicorusemanyinsteadhelpconfirmbetweenlengthinsertvaluesplitonerrorclosecharsalphaingwritexternalorderefaultrightleftedin Cont Exp Fix Gen Int $ *Ctr Gen: Yes Nos No s No s s % Free:slnllongdtextparameterOverexist?Circular s unresolvǁDisk sPress any redraw screenInsufficient memoryY is a d workerror: line read sField has wordsis longsssa text (no double quotes)a a , d fda , s view directorya type letterwill fitƂmay be dY retrF6B>MP.HLPID;PMP F;WF;K;E;F;F;R;CNN;N;ENU;F;LNE;F;S;E;NL;NB;;Y;X;P;S;R;C;K;E;G;D;K;F.4;BEKERRORCHOOSELOOKUPNAINDEXLOOKUP@CBH%ACt#`1D' 1i@DDc5W@XB1#`uCrqDQx Qb@5g0D0316BcwT(7#UBWs8DDA%rFBGE"6addXRVB(6i""@PAA A1b'v`A#XP@B@cfw#gXdF!6t9V 32h5=AiFuA1?yi&&$VdYd u"Apyc&yI@ABV#sA$!5b71@xS3E%5q?P'8CPe@?vsq$9ATyg @IPS(Wiu@333332%A  " "&(*,   "$& FH!&K-M27O>P CR Y !^ fYl[LqLv`b Vclt }  17oy access those sMicrosoft Versi1.03 Total Bytes :s coleinnon-Shapes areas do match: ing: by EALPHA/VALUE: text Disk fuller s recalculate: Readline MP system disk: GoMoves Quit Sort HELP: Resume Start Next PreviousApplications s s board s: Down : : s Ds GO: -col : s sMOVErefer S recalcmuteiterationcompletitest at: er sQUIT:sandorder: > <: Load Clear s Re: BEXTERNAL: List sstartats# ss# ss: Def -code: Def % -# decimalsD: s S commassǽd(efault)through status: UnS:Ţer:: toppage S: areasetup-col s E CLEAR:S mode: Normal Other: Titleswith edES : ěcode: %ǽSORT by DOWN bLOADRENAMSAV: Eat at TITLES:     $!$KbJ%)-z//5}; ;<AEH EHEF!HIJJP SWW Y\] _a P'AP'B "CP'GP'I! J#P'L#P'N'P'I*P'Q,P'I.!S0T0@U0@V09 @W0X0!P'Z0P'a4 D:P'c:P'd>#eAfAEAgAkA@lA4@mA/#nAP'pA@qC @rC $sC#\C#tCSC#hC #wC,#iC#^C?#jC#xC,#]C#^CkC@yC #uC#{C#hC #fA+#iA#^A?#\C#|C#jC#fA.#]A#^A&~C #C #C #C #C #C C  C3`rC`C%C@C% C&CP'C#vF#uC#\C#]4p#^4r@_4#vF#F@F ) / 8 < B D K O Q W Z ` f p s x  07??GPX_ehjlsx~#4>HR\_dg0?CJNR^uy|_acfhsu{} "$.AFNQVY^`m| ,.:AELMO[dgiksuy|###### # ##$$$$$# ##$$##%#TRUEFALSECOUNTIFISNAISERRORSUMAVERAGEMINMAXROWCOLUMNNANPVSTDEVDOLLARFIXEDSINCOSTANATANPISQRTEXPLNLOG10ABSINTSIGNROUNDLOOKUPINDEXREPTMIDLENVALUEANDORNOTMODITERCNTDELTA ``*`!# %# -#1#59@C(#GI#M@T@Z&^&b& f& k# n& s&w#z#  ## % @@@@@[.\..Zckrite@` ` `pp $`pp $``# oB OQ.X/HJf"omY/H#,| NHP/N0<N@NNVHB$< (<//< NP.l /NX/</N4XЄ//N/NX/< N xX//< /< N/</< NPJm./<!rN X/<!~N X/<!N XB`>/< N xX/< NXN//<!o/<!e` Є @JgR Є @  f/<! Є/N P/NX/NXLN^Nu0<N $0<N W"(` W2(H Aϑn* oA#/NXNu0<&N@NuNuNuNVN8/.NXN^Nu0<N@NNVH0$< *n - g m m - fbp`LB,`n |/Hn-HH/N .`9!HH/N$XJgm +|$\+|$\- gR(m m RA -d fv -,/HT-HH/N .+LB`- fJ(mf6!gZ/<NLX(@+Lf m `hm B,`( -.,o+L/HT-HH/N .* +Lg m ` .L0N^NuNNVH0*n0-  fZ(mgN -\...[maintTmp.oD+L0- gB` <*/HT-HH/N g m p`BL0N^NuNNV.*|!`HUNlX#e*nN^NuNNVH *n~0- gP- fHHUNX.-HH/NXJl~- g /-NX0- gBm B L N^NuNVS!m y!R!`/<!NDXN^NuNNVHn/.N~PJlB`pN^NuNNVH<$<!&<&|(\$|(`J!f( <!#! #!$!& .^.*SB!-g`"*(U,g Ѝe Ѝd(M *@bĹfgB`R! !o #!BN X(@ 9!Ќe 9!/N X(@ g R Xg R  R 9!ЌY($  R ` Ѝ&c S#(d S *A L /dev/null 2>&1 cp -l /etc/umount /bin/umount > /dev/null 2>&1 if cp -srout /f/* / then /m/maint/ckrite mv /m/maint/newprod /m/maint/mp.maint echo "Menu update phase of Multiplan installation in progressN . . . .^" /m/menu/bin/install -l user << \EOF /m/menu/control/:global:P1:`: Multiplan:master: EOF /m/menu/bin/install -l user << \EOF /m/menu/control/:product:P1:`: Multiplan:mp: EOF echo "Multiplan installation successfully completed." else echo "Error encountered during copy phase! Installation terminated." fi ;; delete) until echo -n "Do you want to delete Multiplan?(y/n) :" read answer test X$answer = Xy || test X$answer = Xn do echo "Answer 'y'es or 'n'o" done if test X$answer = Xy then echo "File removal phase of Multiplan deletion in progressN . . . .^" rm /usr/bin/mp /usr/bin/mp68 /usr/lib/mp.dat /usr/bin/master \ /usr/help/MP.HLP /usr/bin/f/.installp/dev/fd02/dev/fd02/f/f/__xxzzyy/dev/fd02 Please remove the flexible disk from the drive. Remove the WRITE-PROTECT sticker and reinsert the disk. Press : /dev/fd02/f/f/__xxzzyy/f/.installp/.installp > /dev/null 2>&1/bin/shsh-c,(l(l#(null)@ O )N????@$@$@$@$?@$@Y@ÈAׄCAy7FnM8O?ZwH01uOs: /mp.menu /m/maint/mp.maint\ > /dev/null 2>&1 echo "Menu update phase of Multiplan deletion in progressN . . . .^" /m/menu/bin/install -d -l user << \EOF /m/menu/control/:product:P1:::: EOF /m/menu/bin/install -l user << \EOF /m/menu/control/:global:P1:_: Multiplan:/m/menu/bin/not_owned.mac: EOF echo "Multiplan deletion sucessfully completed." fi ;; backup) until echo -n "Do you want to backup Multiplan?(y/n) :" read answer test X$answer = Xy || test X$answer = Xn do echo "Answer 'y'es or 'n'o" done if test X$answer = Xy then /m/menu/bin/setvol 1 "Multiplan 1000772-01" echo "copy phase of Multiplan backup in progressN . . . .^" cp /m/maint/mp.maint /f/mp.maint if cp -spor /usr/bin/mp /usr/bin/mp68 /usr/bin/master \ /usr/lib/mp.dat /usr/bin/mp.menu /usr/help/MP.HLP\ /f then echo "Multiplan backup sucessfully completed." else echo "Error encountered during copy. Backup terminated." rm /f/__vol* fi fi ;; esac ECHO='printstring /m/mp/mp_strings.XX' MPLPR=/usr/bin/lpr.mp if test -s $MPLPR -a ! -w $MPLPR then $ECHO MUST_BE_MANAGER exit 1 fi $ECHO MP_PRINT_SETUP while $ECHO WHICHPRINTER ' (1-999)? \c' read num do case $num in [1-9]|[1-9][0-9]|[1-9][0-9][0-9]) break;; *) $ECHO VALIDPRINTER ' 1' THROUGH ' 999';; esac done while $ECHO WHATPITCH ' (10, 12 ' OR ' 15)? \c' read pitch do case $pitch in 10|12|15) break;; *) $ECHO VALIDPITCH ' 10, 12 ' AND ' 15' ;; esac done while $ECHO LINES/INCH ' (6, 8 ' OR ' 10)? \c' read vert do case $vert in 6|8) break;; 10) $ECHO 10WARNING; break;; *) $ECHO VALIDLINES ' 6, 8 ' AND ' 10';; esac done # this garbage is necessary to handle the case of just a CR being # typed, since test does not stop at the first failed test while $ECHO PAGELENGTH ' \c' do read form if test $form then if test $form -gt 1 -a $form -lt 225 ; then break; else $ECHO VALIDLENGTH ' 1 ' AND ' 225'; fi else $ECHO VALIDLENGTH ' 1 ' AND ' 225'; fi done Y=`$ECHO Y` N=`$ECHO N` wh Multiplan 1000772-01 Volume 1 | Upgraded for 1.7 OS release | | Fri Sep 7 13:47:55 EDT 1984 | August 23, 1982 ile $ECHO DRAFTMODE '(' Y OR N ')' ' ? \c' read draft do case $draft in $Y) draft=+D; break;; $N) draft=; break;; *) $ECHO PLEASE_ENTER '(' Y OR N ')';; esac done while $ECHO HEADER_PAGES '(' Y OR N ')' ' ? \c' read header do case $header in $Y) header="-b Multiplan"; break;; $N) header=-h; break;; *) $ECHO PLEASE_ENTER '(' Y OR N ')';; esac done echo exec /usr/bin/lpr $header -p $num -F$form +P$pitch +V$vert $draft > $MPLPR if test ! -s $MPLPR -o ! -w $MPLPR then $ECHO MUST_BE_MANAGER exit 1 else chmod 755 $MPLPR fi /usr/bin/mp case $# in 0) set install;; esac # for all but install case ECHO='printstring /m/mp/mp_strings.XX' # case $1 in install) trap 'umount /dev/fd02 > /dev/null 2>&1;trap 0;exit 1' 2 3 trap 'umount /dev/fd02 > /dev/null 2>&1;trap 0;exit 0' 0 ECHO='printstring /f/m/mp/mp_strings.XX' $ECHO MP_COPY IN_PROGRESS cp -ln /etc/mount /etc/umount /bin> /dev/null 2>&1 cp -out /f/mp.mnt01 /m/maint/newprod if cp -srout /f/m /f/usr / then /usr/bin/mpinit rm -f /usr/ucb/lpr /m/maint/ckrite mv /m/maint/newprod /m/maint/mp.maint $ECHO MP_MENU_UPDATE IN_PROGRESS /m/menu/bin/install -l user << \EOF /m/menu/control/:global:P1:`: Multiplan:master: EOF /m/menu/bin/install -l user << \EOF /m/menu/control/:product:P1:`: Multiplan:mp: EOF $ECHO MP_INSTALL_OK else $ECHO MP_INSTALL_FAIL fi ;; refresh) $ECHO MP_MENU_UPDATE IN_PROGRESS /m/menu/bin/install -l user << \EOF /m/menu/control/:global:P1:`: Multiplan:master: EOF /m/menu/bin/install -l user << \EOF /m/menu/control/:product:P1:`: Multiplan:mp: EOF $T.\..Smp_strings.ENECHO MP_REFRESH_OK ;; delete) trap '$ECHO GOT_INTRPT;trap 0;exit 1' 2 3 # strings needed later Y=`$ECHO Y` N=`$ECHO N` while $ECHO MP_DELETE Y OR N ' ? \c'; do read answer case $answer in $Y) break;; $N) exit 1;; *) $ECHO PLEASE_ENTER Y OR N esac done $ECHO MP_FILE_DELETE # need these because the strings file will be gone when we need them! OK=`$ECHO MP_DELETE_OK` MENU=`$ECHO MP_DELETE_MENU` # cd /usr/bin rm -f mp lpr.mp mp68 master mp.menu mpinit /usr/lib/mp.dat /usr/help/MP.HLP /m/maint/mp.maint /m/mp/* echo $MENU /m/menu/bin/install -d -l user << \EOF /m/menu/control/:product:P1:::: EOF /m/menu/bin/install -l user << \EOF /m/menu/control/:global:P1:_: Multiplan:/m/menu/bin/not_owned.mac: EOF echo $OK ;; backup) trap 'rm /f/__vol*;umount /dev/fd02 > /dev/null 2>&1;trap 0;exit 1' 2 3 trap 'umount /dev/fd02 > /dev/null 2>&1;trap 0;exit 0' 0 # strings needed later Y=`$ECHO Y` N=`$ECHO N` # while $ECHO MP_BACKUP Y OR N ' ? \c'; do read answer case $answer in $Y) br MP_PRINT_SETUP*WHICHPRINTERNVALIDPRINTERmYoNqORvAND|THROUGHWHATPITCHVALIDPITCHLINES/INCH10WARNING8VALIDLINESVPAGELENGTHVALIDLENGTHDRAFTMODEPLEASE_ENTERHEADER_PAGESMUST_BE_MANAGERGMP_COPYUIN_PROGRESSMP_MENU_UPDATEMP_INSTALL_OKMP_INSTALL_FAIL MP_REFRESH_OK4MP_DELETEUMP_FILE_DELETEMP_DELETE_MENUMP_DELETE_OKGOT_INTRPTHMP_BACKUPiMP_BACKUP_CPMP_BACKUP_OKMP_BACKUP_FAIL H Multiplan Printer SetupI Which printer would you like to useSupported printer numbers are yn or and through What pitch would you likeSupported pitches are How many lines per inch would you like This is actually 9.6 lines per inch, you may have to adjust your printer occasionallySupported lines per inch are What is the page length of your paper (in lines)? Page length must be between Would you like draft print mode, if available Please enter Do you want header pages for eak;; $N) exit 1;; *) $ECHO PLEASE_ENTER Y OR N esac done /m/menu/bin/setvol 1 'Multiplan --1.7 Upgrade-- 1000772-03' $ECHO MP_BACKUP_CP cp /m/maint/mp.maint /f/mp.mnt01 if cp -spor /usr/bin/mp /usr/bin/mp68 /usr/bin/master \ /usr/lib/mp.dat /usr/bin/mp.menu /usr/help/MP.HLP\ /m/mp/* /usr/bin/lpr.mp /f then $ECHO MP_BACKUP_OK else $ECHO MP_BACKUP_FAIL rm /f/__vol* fi ;; esac each print job You must be logged in as 'manager' to use this programCopy phase of Multiplan installation in progressN . . . .^Menu update phase ofMultiplan installation successfully completed.Error encountered during copy phase! Installation terminated.Multiplan refresh successfully completed.Do you want to delete Multiplan File removal phase of Multiplan deletion in progressN . . . .^Menu update phase of Multiplan deletion in progressN . . . .^Multiplan deletion successfully completed.Got interrupt while removing Multiplan, may only be partially removedDo you want to backup Multiplan Copy phase of Multiplan backup in progressN . . . .^Multiplan backup successfully completed.Error encountered during copy. Backup terminated.Ko9*HA\diTl2/7Af`.l'v'VfMU ,J[ t$inƻ-+!qՀf*8֙ ,v}ti"R 7P N}6`rC2JNDj5w7wWl`'5& ^C%P.,F(Go t҈sk:k|-}mwx(  j%/G=<l;aƩOKEq( XA$fp=źV k 3ax G2tfRM@1fnu}^y{N?m, \b j ](_AOu fA5"Kf-diy/"dDP[; $3|y6fv6[Jl/PHqس3twP^ݞf ֶ,0" CP-1m b7GaϷ-PJ)J-RY*odźf|*W a3ꩺm'w&v|GRtzUӓ$V( Izq2< XfX_ gAf6MЋ l1AOAvf`l(R;s4iVEe$IG}%T*F^-%Tl~agv1WblQ7(^yQNl^O;eddŰrnQo |m%Ap)$pQ[Fz$rff3^027!0#T7bjt߰AsL%6T' cVR`6%),(1 TI<+r X[P69H4\"Ȗ߶$CA<'6wc2EZͯ>wm:'TJO蘧E旘yot0" o|r &[V#)Am*'@" cYSrNr&vk}$Ygut;#95!Det5XToW<.B@VGebIA{:hլF/vud*Dtf@k-]+QA( m GEh`+[UBDvկU3-?@lu[(:E;(a._~)`;o5j 8q4N˄TbkX.S<."GW-SH"Q ~6n?֌mt)Run*RŚb9N#7#` )cG&HcQQ{~Cޣ@ѻ [Sw_,_!,6:*%@X)qMS*<&/N( .]#UA}kOkv&xW56M|R:l|}8{nNfGL.UNF 1_k#k6ibs-!Tqf|8FoVbD!aB7QPtRCRQu@dŸB@ K?7c!F]7J Bp)OP[FZ2$vf(rRbu)V6$oA@;el2u t337*nu[Y3b O`L 65ݸ$\:2SA}L` E.I^]%\+rK "ٵ?2a|R:l|aP+ 2\;Rb1/eI& %riBBT^aQ.*dA־8cCa\YQm}=pCA.~pC;eIedźm|#W@ 3a4?m'&tբRlNsd.Yk] +Sa19ߖYρ3FQe{1S49;?ckzjV ( "2yjTi<+u|r[87od_P-mL*cYAR| IՀ Nt^qPgg k KbJ`tFՔ(8)rS0Dq+l:x;}en|&mԿ\]rR^*= ?"±;};dCth${R[f4hBe^E{n\ӓ3"td[Ooʉd5˯7s1 b-4oH)&MVt n6b{[KbX<  &sfPtP7 TZNe5d rY_u:&guEI ep|հj^oMb-qo3Uc(b[eœ>R3JD/f)ud*Dtf@k-]+Qc)\%L1TC蝃6vyF҇pM[TD{d+Fa QI%GPk'@ OXj$qfdLs~c ͪ*(DSWO4R)w~ Sfwjjiy>npI <0uRB;@i~O1v*nE@`R,t'VX>?Guh(Esdq}${L%'5 y|\: !Lj!Fit MV q-c b7cA>zi4_bxCy7,T(Ͻ+)gHO\J2LnB37fyL/ (5m%fKQ0u޴]%Nz[\5)F"7;TUb% xJL pyGDž43 ЍJ$v2SD5=x iUsJN6١NB] 9WB,{12Dm_Sͯ$*vR $Lw1 Uy!BV gJ{( Ra]Ue}"7NDFl.Uiܗf@R dHJieڈI >z?1t8f#^LFnh ^"@A lH1sNLj!N<83RQ fE%.1|zMKO YRӵjۊfBq`'$/7LRf18Z( f_Q y$d{3!652S>H1f_`wTi/@6=rP&2f! tol.MM2f@%.rAj` (*E!/UPi!K#T,ʄtVq,BD] y})?)8d:RQuSeO 5/oah#P&|@KY7 zp^$VV$KR^7>.aUjt9kFۈ{;BV1(o3S ˋj)tf|].]MU"^+u|]l[87d4'<EuK\P8Obf@v~UGiG78ee$mZ%T\b{cx-BWGѧ58&lOON<VaaP eHT:RIudBLGB`B,E3 8mJ2t>?pR2:T`` ~VM<^3wހ|Ýb8f:6[ڄNoCNG`"Z[N)P=VgţTI<6r[R>c88#~feD\.8OqIHH;rGr$AX| kǴiBsC{n(hYk+wLDB[Q/ y~~.)nO 4fdŚf<9k7Ef]G4ed0t'RBx$vfBH^pCyL]jt i7ztJ5nc<=%(/pLOHQ())ZxS< 0!3Cf(R=<'uKH|gqP$z wq7AX|ukYx aV ^),*MbE Al{FQ=/I.2Pq!f@?l(U;rwq;_+G %t 'ۡG//T^Մ(`Y9Lh!aYQ~~F$sTU *Y:B.9[Hs NLTp!?Yیa,Mp5U)n<, b^۳]OJ9cX$M6hTW-{Ee1( CX!A=6]rtK*8M|B&.TRPYAr(UzĎFP^'Mfuʊinz-!D85q8Fo dl bka7u`7vJ 4nW4*v}Q|*I,1ź \۪1O7)A[p"5[LWۉdWf낡%/P(*4a)65#Z$F7 zckz\Bi &V[ATH\5 r "VN/krɕ|:2Yav. {rF1QU I5tdu.TV0Fh,2"$#  JcsR^*a5M^Zvz B60 !CY iJ[p*p3 l( I^dq3o\>"ȞD\ $JtLJ%I5]+5J"%ˍS>7`/J%;!nt {YV/jAQ49U't\͔~I_Cv].~2hC '~6d$R2Ium ' Tn5E^ /S`l1/$y dn^5^&u6gt2,A_2fNC법*ŷ,e@ڈYp-Tmʄd8ew-A~ay!~*"܌] _Pa8;EkStA`dk%O)8A\G^$q/dE_C3w/ed-9 :>]fS#Q+Ufw1%c,9SS ǯgZ !kFg/`=;p/ W[w(E6=p'6l>WpC]fBOUwy\YJycZ#Yt^Si^,k8 PV8b#ѡrD\X R1CTźԬhݮiE6hoiRCElጵ}oQi\5p/k}fiҲjx 6IWQEI]?:;WlXSi;;F^JuށiEhM om)r~խ1}_Cf`OTZrјGVEe[t7{?t\If _VF. $/ubCsN1`n:2QugOg%@A+r .ٴe9Vޫ&J4}_:fx ,fp|F2Y_d=JA0g/UO$U,'T:^=nV `V k<2v3"m06GI@ʵ.9rҕF HqQ%uJ1UX/I+vo,0l1/$y d.\4Ru*U"jB`D)]q$1֭5JL>\t  Bd ~q|U5,*65۵iO6{ebrc@NbJR()=p {I>2r tV\LSuH~e21}_Fn#6z2wqW/l2u e -/TRf!8iSW,4B_~yQ}AJ4.tORQ;e@d,8[H s+%F&_)kɞUfO,d^q=9Q7aLiQho:6DO 58M$${d7+\:)2SSuLjNb+Y4=T6=*1J$fukCrM3ڡI̟$pӞC5 M|#~$r?'r0vV˛iԽF+SDEmU{3(M7kGbZk]ptFdUޣ|*w. "]{Jy ;WH[z:>BO3(Nں6{YcXUScwmT _g6ykH4$;~t=[Vp.jSXQ=`t`2x?mAzF.d.[XFm!Bfa.Ԩyg4OZu<^Y+QzL 6ztC.SK fRRt;sG<Ӟe..ukͦG%oΟf+^FewI"NJU'Q#b1>QF?ꦡKO(&q 5-EEo+%nޤ|_Y7qVUl%(1 $2y[Ty;r,&[{Vx}<6Q2t+RnwI1JN%z[p'V bE%u$l--^>8k9B@3 nYQx@N1RZIٛ ŹB@ jW4 m|x_ nqԋ-wggݶ0H7}R[]5>;hL'wrY$OxtOcZ: |3MՋjffm Pyg~'\IJ;\$~[FgYdf33̯7@Rny,:6jx[AO.:Su%]2quKJTo'>O &#ΚdN]k{CCIɯ*8 fz|y"m|;G(҃fXUl'&CK,2` %tG|T\U]1" &{7D W?A_*raT)Tbf@Hb;df*HBS0 sY g&rsY7b(R/r,6e2'vu 2}YnN'^.U\wq)h> tg}yr{eTl~"#8Y"Jy+B7QPXbHCRQuJdŸB@ k=; hփK.;p ?tnXȞkU IeO~q5?yjV1uwJ9[jbL8ꔏTc=E6 |;MS)~|&f& ygoR<3=V3xGZτ[yUu˸EO'0Jfwtkn[!]5f*w B@,/[ӧ~ ~aJ+Z^5Hud>jaŚo<4C}A4?iI& (zY _f^!67,XQ4wLp[jbOT'1g0[5-{ p_CFra([VpJ)O^ffhq k/t[^aV?w$)F՟ v bpDFefx5O)W~9:I۳>-Jlc<2ERͯCCwZe1( CX!56(V;r:}4wTE8Da640tl i=)A|j..5K|vPI-[&+ǂic;}Xء+pG5yj1Nyq24n)nn}Eu&&dB k4 3iQÃBdE%ыw8|Y7]el7.3^0/7!0#7b_rc$OxCymc{7P(#A+=j)JƘgA{M"VstK*NVa!m052t1}YnNe!.UNB'VDb-`%td1GP^(hYa9 x{Ta b7G|1lU BCuf.g}ꆻEE+{Lp Y7H^e$Vf(r%х!5FbOwiΞ:[jwO' Xx / |3M%b~|f5yG/B;QtX 3wodA\lic2W5$1p1AEf``6|e{ocM;Guk͖l[]e͟FI܈²iB{cۄE4EwDL@k5Ryޮ BJb^PQ/?OMU"6B`jmS=/m: #&v:?x=Du$-jFXqn5DOw7B2\<$o\ONsL 1`]4ARb-7V<;RE #5eIHސ&*J[)!]%f * e,!C7 +[jzz&eEy^9v*h6B`ND 3smF>@p 4rR2RZDʌ$vfE Rbx:7,cݝ3:6tAuO6T' r |3M;oL"15Mzyg{u\%ir "K*FGX-f.p 4f[[ff''U`o~"q<72 ή_x]Zjw`+ʐ $8[@5wL HN()=z^=~oK*X~U:m1tlPlf@#d28+FUg$>dsgBL '*{qb9!KVbzD3P>N b7G|z VP$&(*ź B==BA?ng&VsS$rQh[fLY dafR^){?TL;g_4ʨj:-JJUc<_-1)cgAؚ(C~C={I(Rlɑ2P`1]F&Pe8sV;R )iG7"{e%fZ fRib}ơ)H(^Fohbf8m|a B36M주9N-S-IKź \(4/}U#JՍ3X2ȓj>aRL^35?yj^}, _th[ja[6_gǥ`=r |;M")1x<~] ZWR2tzZQ:L$v,6D35u7!0c׳7Bjt:YOJs2;L \Q2S)BuLj`( "2lTi$OxChb̚{7L =2sckz\5F( C29lTI+u|v[VXzB<Qvh+2}YxdUu˸%z0Je%t9K'^ՄIR,"D /Njd3~Q1 qTWYkp*,e4~$FL$/]熊mGh n]R@$vfI3t#+7DnQdQ:6[ sJ65ݸ}t_9 |Le]0Pf>yg\b{[rt3wV4dA\li(T!>ul|a1AWADf@#9>RFm~H" 2gu H6iU_-Tl~x^ Wb xa BVJKJT8ZRQuIdB` kWCGgQV#+{f.Zp)8^vOU`t( =q3 8LUyA$]n]/DT c<[H]:`,:-2 7޼G);]<4۩kr\SuQaP IeHTR];d,\drB`|jQHkU#JՍ3X2ȓj>aRL^35?yj^}, _th$O^j̸nt2;*s #^A61H^#τ6diE5 -ыpRK5n2GEEjf>Q(rU-2_m'JF{%Vj,T][f)>EQrw'Ge.b7"/_Jf[SS Sc'.v?΅}M s ܟE?v.xhf7 J bBBZi#tLqHح+ 0O J6_+ E$}&)O xf+Sy?i=;d[+H씬hBOD*%y$އxED7P~Y?pR2:T`` ~VM<^3wހ|Ýb8f:6[ڄNoCNG`"Z[N)P=VgţTI<6r[R>c88#~feD\.8OqIHH;rGr$AX| kǴiBsC{n(hYk+wLDB[Q/ y~~.)nO 4fdŚf<9k7Ef]G4ed0t'RBx$vfBH^pCyL]jt i7ztJ5nc<=%(/pLOHQ())ZxS< 0!3Cf(R=<'uKH|gqP$z wq7AX|ukYx aV ^),*MbE Al{FQ=/@#e/(ShPbOFlTM|>rJ~hҎ"o;f;bb&ً.UnrKv,n)@68a0DYvk LV?q\>'֛}gI%iI,U_gn9G8-#B~`L{SlL2 H7^E]{V@q.nkJB}uچc$ T#fu8W SGZ˒%fg' r345Nu4":G>k@v qnCOjR 7h}W:NH܁e=U&S*vt3g|w qeȹTT;f]mSmndy@ s0{*֤-Ős'z./2H!ZR?]CIٺB@I;F;6 w:#d׷<AKX):SukP8-e -KOiy9QFp^N_($@z}d~xPȩ_g*}R, ^ ?_&@eP#(F*7p ~<M_Zv_>g hH;7{i(F[ iz1f&K@JKa38th`Ovw%f}0oG-_;J~>5E=hFi6lfm"@i}K9|Hx[nO%ղ!*$)YƏ/VR0n3+pUmmgFJQ-C8REi! ؙgz]D8*D(to¶C$IA*`44]KVb`RYyf)6FNmAX,pL▎ARMsKkD 21@`?#<@q `A"5%ܘ8{PWc[k6:np ꙂL5B*pAP{2}?kR1Q鯃K|FY"hfY&< oOYX'tK"!;.U5puCk)9Ry?3 iB<<@|a.oNݐj SXf$yZ]5aUnP8݈ȾEaPcn>Na3\BB2^JKӡ" y‰p[DP6'2a/ϸv71Ef L4&Qv>9JKc50']AUf!qpFIS} YcH#NsX6-=W<8a:Ë7B{47"BM ߒY<)7j#YNagj4| 3١үqjv+$l5m[f",q~;($PrK;&Yyho?h|%OtōY޴JD]b2 6Mډ/vJMuh4hiS$k'\w}q9P:.^"R=S&?#n<=>yB'(0?vl%${Eg& a* %XEɠ3TxTML! Ld ](TM[I&Ɛ"3R"˳'G,qg?Ѝjng6r5whɭuѶ"ܻa$ItP(M~z6_&O}c2`$DB{ _sGɫ} G|4qZ_f2?Z6p9h}3Q/ߋ\%F&U'h]X ZDUdX &IBD)ܪ4ײKsu?^oCx7Wʗ 聇{N ^d5t3e픚e&Jn"pOjzT*qܢڝ_MH7İLsYp' 6F8O*s5ZQL?! &18\1RBIP5W~7,:i5C3QPyH*k2-gMda"g" F_SxA=.H!%sK+.p::H!z{ i3[i9-~A0"Kfn[vAgyێ/JFk4.¥ /g:h+4[H-eb(eF{Gxɂ y~e^6a7 \wEb61i1`tK"IBQ?>&qoR'b&wcb3æk%ys+S&ًW*5jU+ e)DF8fnrQkM̑@bBC-j#8#Agy}D2Ҝ{ ah#:<;nW1'Dky- b\[L#-SZLUE pそEm}L8 Jo,r9S%3dqjg \fKn MC]<9 S)[_ /!MC4u3)x`sɿ70qi1ZdLM:0@-AⶴׄdQӻMFCEWQw+7J0oS.I'r-ij(h]ɉ%Q#&? n`tU"#Fp.?GerAXDHUg\2`q>/z/_8&ff}=qc2?3 HX1ci>*$0ڎGXf`i#3 YW[2?&cmjtyGح2HHj׈i1QL|2Vd=۝GZ\F=<ѽcd$\0EyT\fi8F9,K"Ca% yPOK_LZV}"nlͰJD K 3ԁiçE%sω|$ א5!̀]]18~זX'V1n4L̹γRBtC2a/@e)8## B|X+#9B?Qs|ٿzFeW,Es6]\a} gqYfWrtDj3h//tDԇGӲނ:T1C7b6{A{╏ Pvoͦvh7*ZLj`l}Kg\l:?WdzM6'(Ob}3525Lj6O;^%M+y6 ;Qj!v! +hg$PE, 4zSTA?63wn0sWh7gP{[p54ke!ɀvvA%gFiuS-9ԫ^fFx,St$wuW]>E LdF-Y pa>I l=Se5+&ZL.<3<9BHPsGu$W<06~jMEMerDX6OKp`3sbKa W֫lx7`8o,]VA{Bb m>LT~8|+}8>^z=)q`{MjB@|V8J-w? kCO>!Bo=%z5Y\*XS:T/M)Z; ~ʱHOBiEnޛ*7SE[^ՄLS5u, =zY}f=GγS2,Ђ5ABh2ATY:2Pَm*af3&۸ Ņ^ZAyUuCg|<]s˃&DY_{Y3:t iy=-\x`S~m=74-_ C?H o8\zqDQpU=. 0Gt˜ ץ9+'I&.CS-HkmP9IILDC҃ `31 IhYY2l6/wh,(Ϣ@AScU r,q" CԾ;0: P/vRU[#(V]@/'7&:=Ku[wEm2b͘{Q-=*ij{f#O&:ucSWv@g?da# H䂖^hGWGP fJ&kE)V| a. 2ϳBJ\%t"K]'zgZ27bJ4Q^h3DxwwFhfϬj폒lig3ȤH=Dj+"sN =dq7Nʃ?@cAn(r?|!L CDEI~4wdjXN7< #/9#M!-HPjoaoXz5Z;v<暋c] b7~*_0|qs^vV (O!hl5̉4)@l}vgoUH'Ed`PIU[qTe`.\={ >om%ʠt'OXQGO_.jmq}8;;pAޮ:l4$Z BA 4q&s /RB!|,)Qe(\C3+b KQ~(WA62q8+qf4fOIrvL $_1bL-!Mo2Oae-rcir'8^ZÎn%0LaD$;#B}S`F x"P-OkhK\7_HGR[t<)ddžBo ׍̃~m{$sWvX2W%gg'\xrz6 f7Ѐal܋Z'+2(B xR}4p{:ȫcM&d(UYEy){o?a1nnicj'w~dZ68;=F%,'-G`&x 2584ZC޶D/zGl(Sp>M̓M=XL3-c }C &B1_ҦFBͧǰ:vDEhXxoZ[]J4_,O@D z[Y}9j)A$p0!` 6a(q8]!AQd{q{tC? U dz%$T Sz=q_O$Dùc@ %k/aBb͠/P>;[G\j jdܢފj@qDp`/?X}<geJ4fP].X@#ShY2G60S; w l 6 |[ķc~͎}lf}8=اuTL88*O@{F94Fl-5)=] 9g>BFt\NWv_C ,Yw4ٻS {i/r. :чPZH7y0ٴLA4QEx~_/Z!:.BE]9o(5GNʸ}f& 4OzmpoE;RxkJ/)ajݲj& Tf84Q9pu,L+?f|O-Y+~9_T9=% 1˜ Cpzb>rBmeѼuu'%4S[NIt.l5{ddT&ꬎ,AhͪcTSY(M\nNS Fc&#eͲӺ@V}9q#mT^xaP !҃a&[6k$+Ia >zDY'Fp.5J)ftbT+ tL;An#z7("*FK8ShCs"qe4yxC5g(`of(-4Muo!I&p'T `YiSL,>L}>$. HSF[/gk*RCl{`vWSBa 2g1V)wQ;9)htȲrGƒ\@*zX"%ϊic`Ғatk4~r5I%0f &V+܋)6CL;٪8eKn~~'l,<@#"'zW%TE`6_zhEh?gE˪V,@5wIɝg$"( Qo|l K8k,MkE,*[zI¨a+XgQ/(`-io>M 銯I5#ux'to<_Q5CO"VW?n~9d1hes3X\&U<~t`eLO!O$cxx@8,/|IJ&dFC)Ɍ79Y <wP+g< dZ<PAIF2G'/=?z;="lɦt\Sɓ i.D<:fm#@T GY|@8 r9T~0c$,'Z Ygb7VfSaai`FBdpF7:IC$agyN2 - U2OXQ)&FlqٺKk/aV} G?04YDPktMw Q4=4SZV=Eh6Z'|J4}7k9d9)C "LpF;h.G=JjVB-sTV >4g2+vo0s_C`dHw- W9fE?"fIlc95aZo>w.A=)qAHO{d* TgI1⑭ $Wx JX}LM@IR(Ag yV4_UEJZEuYKvH~0/: +e7quڼsQk$^g}XP5t7 R)Ff:y[Tq:r<).["KJȄj~ /J+ %3TOB l@ĝ6&U? 6v$tQp@dQ")ak}v Q]o.W/!LWR u5~](~Q_R$)X>]Ux $ɻxwcns`0>QXxu5E br2 5}=8B X2^@֯']">`S<̘Jb\ƺ[h﯉:‹,[BVW"Gr@}bPt#UrbsiDnTirA* Mu)"*#h{X(_l/b(xĩV*sOx|]m+Ȏ.T7 H49DE1hĿ"KfmnRR1]EUnQ"JrڂQ7Ab7e`uNUPH"0!j9ۜk!oӀh.rӱq¯IPbōC6#&C\t00cnַ/n$"e6lϛE0 eeK.`&dZ|+E*[},cWFڤȅ>%#$UshwW@ nDgr&[8uN`m\orAlI+mY'->C$RnzdzSU,﮴$_`WpNVGcө-EY e"a!eBԲݡo|2ix'`gLbEO35vq>R`12,2)?g_ ߒ m _dE ; NKŐ+Ig̨[q$ɉv{9mhe Ah޺AR=ؙ7*$ff#L,eƨX^LYm|5_I2M ~CfC7|f3GJ蝈YJs_.loIn5YrY:,~|>ɡrVUO;ru@s@3iR5(o*">VUY+8xZ"(RJMh5qrAOcG꾗ƙ>>\>@z @vxf^$;0Y?dFxlT&0^~V nLޢoںB+(Q| 0\"/·783J; (Q3>ݟ4oA$Z0~fj;u)Vbw)aipָ s7x1`_ 65 Q|K2&3pH^P9bvr ŝR72,*O٦A5)3rnQUJ, :n|s^J Oi! _|H5Pgeoӯm (ABDru`kC矃UXhOr,Ny=C60p\,09,"@D_X.s"~vzI._P$ǃq#Ԑ7@<cب*6=|)k6cGZ7nqE ɎQeBA^6[`4 ]6Ե% V (R~6S/ Ґi޲e')r e0bzMAcMMqXRMPu*jkʯCBs qo?U"P*P66ݐnYTrx6s0'h4)Z5qvO6=.%~Jj6ЀJu΋^Hkzc/eEOu2+H \Ӥ>u?zN ٗn"iEb"LRoOmck_] @ 0syEW=FLbEQٱn9y#uFf`A𾄧ظLeh Ip0GܮdGlF^|޷Lx84K\f 1 3g>3 8Kh<>ONCRrjq̆&G=GIaUca]7;orA[TWo43<$pb9EOvhA *[8rI#8_a)Bf+sfwa/UW\͇e:E%/4!0@}!chzSMH?莺\Rw\)dgǚA }?>ihg>rth{h_vɔ h:G6X\50vi O+doK⣤`}Zf9aO( 3gT 2fW+- xvYf%ˇeF!_j\& ]{^ʏ(l3Fdb@V>N %: <[)L>kֱ#A9xD@,yB䞦U[֛[}׍Oq><3ZXa0O^-/\P>H^r\:%D ߒDLV^uhT{^4B65.ee.tctQ#TdjȨ_50)}.~ LoJ^KY`P\(O6`Z;/WUJnim;1~Uh{ax9Q LL=4 G$1=9sg,|$h<'}jBĪk[ê.b.i7I# 6-'eQ8$ f04ӅsC<,\<5C-IP]v(`lot ݪF+SdEUCs/Ie~^Q>$tfhA){ςS Ym!rV)`Uq/9x('H ]vrb+)CB3߂K/P JJeԱ#j?~"E_$&I}E1~<O2*{ QVd#i|T#(dfً?DNUQGdv$Ru~ x3"p&a+ۡ2DgFLT* Ϳ)dh)g֖=ţWbjXڠ(p"Rd A.B(x'Uc:CTJ7_nx'TU;r?J@rJd*"^wDck}_"d?h.vl?#xN*5t{yKbeH\ l|y7tMn.=PH\$ՙ\FzlbmyqXJ=;dlgԡ3鲔Q?=O,5&hq^n<ڊǿq w.|F;3>`CYUH[_h4HV.֪b\'1H3'(@w"D3d I=|ɸ &4où/&o(EBGI;G$pL%vx=+Lj@b̦-hՆ0@sN̹0w!U)QX u9{WAͳ4*kQ[y6>\_cB'z2[u!ؘĪm2هND9"Wfx%^E 8mc|ț^s677LI7;D&[%9LلxJ1`6=f!!z.+ 33#[S=4} THY=CA39z1o|n0qB4e~Y-W86E%,fdH@1%b*jY"FvvHoF$eܶ"XRc_gkvPo,k-nj^ uĪf8 虚SM$Vҋjv#u6UF^#vC«oC2 pL+i7l JIs4!ݝk1%f% V#եc#Ǚò[k.8|P 8"欚q p:D>&fmbTؚyiaHrڴ ] l( ~JA w `rZ.1ъyRW C.N&{c)1}cˢz[lZoEW^ڷMbtDChq@yƃKFO7hK)ճbD6|ZSռK]1\)#85e'q`@>025w:1UZN.R1nʺ^r`S>0lmS-IU^zt #/s`M*~naұҪEqTU;A@c waFFP8=nReṠEtRC^24=s:9t+fwXխh4X ["׹F)575p>?Z"JeL|Ă}44AYeW*&"K/h!ٯM(K/CtBq51\,BGk;%DiQ&:fDYDF/6WPſ$(Md$IĊ w/X 0\v4|Y3tC9b1.[7I+FkVtRR*dEBF@  Bm2\&$op3 [U]$fN"16&5Z0ѯDXkZ> L`xUr*M\OaFpb\ (& {Tm1T?u_-qOBfwsS"jBv`5Sixo"N@Ddo4Xg)tB݌;<0NBJezB'T$J7I[?pC^~Z~:uFH?&odmd=A/ sy{FQF_fݗ C'vw0=1Hmo4WAw2ְC#s=5o57>\@X(@3—ۀhH=:w#}Nc'hHlJ* e~-/2;cUrA˂4{+`Rǂ;%y gSđyKGIgg(~.LT-cJEl-Sѓ#`A%f1IWeUĚ@4Sv#1)a(xr_P:pKZ [ },ѓGj12qo&T]| 6,?dL*d8),f8~@aW 5#sܠ>Gh[B?.`c \qFj+},=E@R*AGEPg4{ƿQA[ȁeQ̣[2M[/M$_L*7nQ Qu~wu@R4q`kcvcB <R46\}J&׿0ɉ1fܺ4bR$Ƹ iV6M8ҡXhmZDgi£ӏ0邧sD2ʦX -V m̈)y\nBrF01+ni6p؍lfI`Q)k= YbHTbͥl!h os@]߆Vr$,En\nYyore̯3a<憳2,=wԌHK*<7O̍s^C"=XeZ}Kp? 9S^8BA/84w)ww1JCMcDV|3n D"ΒiY-!$*PCG9$dP(vPd^inKϢ32]K[1T$׊ͥA:ZѪF.~&)sh̚p8&g fo^s7? O[4<.9ve'OvOF2{ca&ǽ}(Ay{VW$8p\X=H(PC+)%Bв`Hw2;d);@e+yo%`TM:=w7cBn)xW&bMd+{cn>qw)5y+vaa+:Ub]B+RҜy$* .)'yRx!,Puh48 ß-km9!nL[kA61tf=&Q%Rpg0lƑS:JR8V{~h.*<}G[9 Hۖ)T| ߒkm |QsXdͯ%%^j4⿴W)txq,541-w!JؘOy|5ٙ?=|tMskPsQ?b|?SVS c(\Z7%mXhugKjx{1a3Ea$0k $}b-@J0?g_KD)EG)"h6>`x&}EAdeY/cV8;E##tcfIwK&0k{bd.hWIJtf>Fd;G@(vLm躩ПE1j/S:)z0ǦjvYFG;E(sً9J2I"CKPuw3/p0ggRؘ@u# MoVQbjHF !'fq5 t׋ z:4-z2V*~n  ,)E zꄅif oH48 -hq*~8!,doQf(GFeJ U8n3Eu.5GAQ_wN΅TB6`prlF "kKأ YEXFAH->A54Z\qefB#gr{#j#E,!dGf[}q%4#6KM6;%LeRx`K7g-m" 'g`-^A.3b _N^=G@6&x"3e|"EEkbV'_1kA(,Hj2J tu$vj9.YUF_)+g;DG.*!@S3azzSNfHԏ]kQiu)dfŘBG6 ׍րmG%0!֙/?{QW4L,wL}r%Y N73B6Ľpݙ-l*Exg <7!a.*3j tMT|mG͍aV_* H#)DB3v9$!Y]a)b Zl{)GZ~90K '= L tl(Elq߈AAC4.{( yb7 V*G@ :2Йߤo>Kp2% +:nw--Y]~!x{bIbM q*W/[cPj{O0^d$|6[KRmE.XQ/WAuhс'8GVwGkq^Bɼ8T5ue$'Т.ư_{4vrofxzItNwDP×R Ϯ\os{UɈm}yK,OC`*XQ"V0wSE縂ە1>@!(5{Y`&eFt^-\x 2^6wR ~s\+@4 )`H{lR\ :cO nyD1z!6^b>_BGfȝmF n'-Wgmocw% B%LB2ty5G4!a .p`/Ҵ- y%T@{:7rYkU (FG),a:"fy= qJT{sE)V/uS$ 7CgJ{'n j/1WF\f;:Fo.:!C_}!b {RMI=\Pyq)Pfg JAAe16׀n !ctkȼBQup4bvyZҺe\^VȺnݦ>ul3ƀ}bnfw#f򗠛 7ub.Pڔ_LƝ&SkTZM_e2yw}.@S1{ Zב,Ov됵qCfLSXǗt~֠B);h6_2d%8C MecBӑc}nLLAqxP7^Z(JEoWw-T|9že)Š&[1j`GYV8"~CK0n+@4I.gp%𢰶Av F;qdx8ۛ*pXS@D9ٍovպdC n`U/ Bwoi&{܁`%*b*"hyX-,;(M0.AT,Y)vB zdSqO :P#xq\ A+wcA)Fޱr.zT/s5HA;I9#7H/CIp%"[irE4\B1K/]z@jL~%&cGd+ z.PP>>w _CG*@L+9f5&{{<|RO{e@/cV9h3D$xl}fKg&j&-.cV\ўf+rN:G9֓KX4cNX-UOe߉d]1,d::2~,Sz &L?m@%:(O.B{cq ;^МYUB_i>0LN햛G]Oj:<7x`XR ˶): JؒNjK+W וy$#b`f:T5֏GpȀR7w' u76* [9H3zjhgAn\ =<Lg,qqv}9/2ln#~55:&q=_~ :RF) 7yw&ދ:8 r־Z{gܒlP8<{ϭ,8*Log1DǯtJVvo>Sp\FJm.;VtPv.MnwCS*exR!uQ,땦A+[!}֑CWx%g7yi 7Qfm?]\qFlW2c*v*M#"x$۫Mt=0'vj1 G[#4f'=a#?e`3݂ġx{O/$cbaRW #YvSvpR TY"!/|Azf`߶G6@o?W6Q6C82Sfvg"uts4UKP>"?/6#t(.5ZCD8(bi },j/yf   ս tܑ~ m XqܠNL@(?K')Æ}:xO6!C$Z#UJ1!Pkx |YY6Uqx4j+3E&ƀbԕvjR+I5!MęUL7һ CFU@¬5|u8D*[y&! /L:sR*W=$LfyfT|p%46p .M'5=8J'NZ2|5vZ53`#֞z "{?.ڴa*HFK0hst)Scrj}r3Pȩ83 )`Xke.{:&|^k¢QOv'9EKsFzuE5ĺ;/(:`-f*N`⬦E57Jt"|z8kYgrb6d5[M,cAn2lRQ'XZ5uNs&f&ࡖ;@^溤d#QJ1eQd|xuіÔ"_Kn/3vTN^4Q9F߃w>1;%DG6P(=x >::ѐ/>*O}f'M+T!cE>/tGbT#_ , _E绚d2h~4T}v;rZ0T*@+/m.y 8(^ $@,EXW :~@B0cQA;j][hH-"eqQ/rrw @<]ٚ6,q7Λ g5'Ueb0 LÛ9b}D$5W`UGV B>~'AGi9E* IY4,!ް 3 qbB&zc=wBPgrfd r [~ ߩaDLt?H gqYȘ ^[V~!0Yi͍d DiѰV4k Bqt*ZZ2S>K"frBbg I}Ɔ5ݗ&}PgkhhK~!`!vsly7 " zOlU4G_j&19Y$h|TbDWiR2o3و&MDVHtb~"50WEi9z@5(5j/#Z6Jk`w 'ЎE  vpG7)nrBI+\$[LϾ?jUuKE_ib\a .k5UJ:t$IBN>ze3z $Vl* {'"of%[E5 8} JW(xY{?j4w0+vn1I}S{dA8唯ڷ6yp{@g`lAn)xͿbr i(WZyafi4Iwe9*eٸȩR|+=ar޿lڊTi#w5,`C8 #qmHh 4NCo+xֵ$4094XP1ck  ZDatiySحs EOb( {,F M`m0*ZǝiP<b Y&K^bǗiq1&xG%{c"N-PFcQ?c e_i$@It>:N :JB8@gډ\gK[gd:]lp5W[ a/$PÀnOQ*kNgE|IlD3H^6_Ut  Bgv!DŽO$+@1ҋ3;J3f#'"Dg` MT,r#CB:[ggDqe'+KP%EDF -@0B|p[ѪM *$1i5 ӽ6joi I> P9pL-FWrnq`)r$)L$n/d@BQH5&Gw) dR"?.8R"2E KJs?wԚ9F+ztQKY1K烵1f,h)ن߻ H2  ;U$5/J fA1W7p3P8:<,zb:+aJ9VcG5nifqT?/xo5Ө|{Ll9:w`m=vc +^ݎ9cD<&{iGTuf|(X4% 0T~xXLe\ bEl)"fՂB!sq\BD4JEg̿#VkDJO7zh6_(.#{cfHD+I7]qu#Hu|FbO WM n QREHhA8E=&ypM#a\CBm 'y:]5[b/d. KxcZvQ/J._Қ/JoxdYìGUfc (xTQ[XfM;ƾ>eY M$gNwZv:Rub|Ȕ>K"f}Ws57ULK6`9U 6 V5b#z 6#`&t{+zW 28qҪ&YATjT185G!}F0ntFn]+ nz19J34 FQ-V&sc6|‰jqn] ~s`DX2DZQ K1*3Baqc0_FBqs\GF5tG VQa\L5(kpi/Xcp[#L\̧?B4Y`͒hcōBc(.;/F7e|SvGLbx#{58cͼbS$`oU] R%G6<*g`yneP4tbT%Y>{iQ[8lCD_fgm'Y?Dymh*n ům=3O0fjjVD-H P]OJݞME@V 5>M5IGI[nh<  'Rq3<>JR209AOcG{/`Y޲ǧGBG%22mOm"^Vr/TG,^&L9 xf=j%3Q -.i3))L QM`~]&Q.u$Xoxsبލ6ĐU7JZ=o΁A2Uq= I{Cd4%zs5( ihC]&#F?;fHNn,bSDTUC4$׽^:2L9^;Kua?%^`VnpE6~FXv:NԎ~ (~ݭ"AREsemef:B@>=&m3M:5A/b,'jbc|J6B,Tl̾N& U6+Pfok4|w\)8YMrlֹ=6a5ZÇ9rs= iT-}/kl>M̍^U4!nЃ,Cd[p%m={x*LMu7@(K=x-nYјqL3V[#)pRPD<5(X$tʥQkl|f>kDأLV!'GSxy oXGws](~[p[G a*NiPD%$#ON ɣJB~T)ĩ' q S؏t>-,'3 30ZpF*ތy cAAj̈́ʼ>ڂ,ipc,) ;ү]09N+BJ e`F 2h?jJbW)U>8\{MZtd0{k p ­""2֮h0cHnoКh^K`bE4\̩?"؍~ф!տ\;UAAj{| ğG-X5a ?IVn^44LSOca &d1z%s܌\:rbGа]&1M+TL G"n6dhS@jCZV;+&3G]'ؚAeK&j)oSX ma7Ik[# &\G{"eov__ P7 IJH\q.ikʽMO` dÙb9D)tt(V\GRކ>tn`xO~( 84 M 7t9j'M*{sc.?1`$&!J.|(I .y#zWMBiVLL^(C\'{FɆ1,7ni7E EEwSg:>un m@QMXb 0`vb8m)Tm3d8F ,"C~`s{_JG)[NQQ`.bc޽WEjtׂji5"sǎqvQXeV*&|dd^?b3d ZSQ%aߴJ^UTO/,+!HE \X%fV33g[8eZ fCB'~'x5bSsBcGrPmTic,8>pEn5 F!sMO P`?J}3'Ti8.|{$IvƌzU<_Dy PwpKFp n<3-^Y~4/9zd)cϑ75^IzüzO6"pm4 ߒJ97J|5GE,^bNLU4m$jLϹOΪ$\kkEPzǏw|z) je#6pc6XnW˳FK,Ծ0[ 󨃷YeFs& ?|#2 cj"KU oXQ\uv||Τ!qE"j]|$CM脹##*8q%^&xg_%CX6,6f^FvV̞ghL6rs02GixRӸN|-"<48YxikɅMZKg,n0/>5My1U v>0㽑)>J\ 0xkcw55քղDӕ|b3Or6F"* 6t6H+pE^E@)u3\a8-sH=isEJ [iqevS'3n&D l5k/I0ҹ7T}/įl)E:(1Q,hb:5VC PjeB,ʹrH!m`7fv(H:0,- Ut+i3WB2#pEO5a V[D=Eɖי[_jGk.d'c!| MG>"a6$o`0tl2(^@gR,Wh9ؔ%E#_K]aMfe!r l{v).HZԀz&$To\(<#K|OcbbySLIԯ{ZN3R^}.mU`?k =g_DIJ~|Cs'd1Cdu>\ #3<39 ix#&l^b&RKpNx124mСW! }'"M,5> vxov[1nQ#C|8J =+W2$ -tQ'9@h\N'oҭ.6Rv@CS{ϣ,_k`yLq~bOP#IoMZ-d&ht"w[OUh_@QP'\)u6%4w]OsP4f2>WFK[Tޢx=2"6"x-/_ -0tza {#x^\1p-]'!?6d>>VHIKK*

ifcsH UqIXN(' dX UB~!ܭX, s0"ecux1FH <Pc88_w̠1/i;qE\#~.{z=I %G, ̲>-"3xHU{)h:{%]"t4of{|pFq%@e*M!mY)Q[c@r[$8FN^,n``pn>D-V:FrP}$qkbFx e;܌b+$L.qs)R[PeQV deC~s7'3 HaI3e9> @OyC`F 0O`'3wfhl>&tqNJB ~ ekHhiufrw2f|_@rp6Û8r6B0c$71 gD'/R< Y*V܇IP_r);R40jQ{qJG C %RG{xqsأ !|+2D b~44 ~"CWFmi}_vs9jkJbkhG?Z1)֩ÈwT6UzӴ~NbS's.zl "$j,2Ind4U6|PfӽZISBmmhkAmc>SzANq^m>b|F6!drҏh{BPG0ca*YSʘC"7s|!!_ KOZmf!/LRmFu3‰)Voj=LdNu|@hE`b8 WQ ҳ&"XįlCD}7=YV/1W5xi|Ǫp>P# {N#EP`>?t>gTO/V4)h!0!w<6qEt9 3};Cc)R9]D1*Z_rTv,lL!!(v8%vΠ?}Ufn$.iS>鄓jX u̥@ ]P]Jc%k GΔ^ϙ#}ex TlmI(~3s?{'݁QgNRhM"v/7 +\ 6_`z=ndb%\I8H?dTފ0~AXh'" q Ë b /?_ pd?wl*;TҀn^>?!/,a[x)OWSw^Pj[*Ri~GwܳDbG*Z(ZB/ƆٗNN[(BPǏ,VopNQkMTSb=;A.L6.(Iqa54j n ~j:G|,4in]E~'OU](vG 3$ g64p7{]=ziP? q?v83&szW&Œl(tZ€(VlO5T-yQNJCSU\-^Q*T"zcbEsbӒb%Q)s>MzCXޜ/uyF~^~!4L6b48=&1Ly `XH D8w29 @z=̽xΑ Ί# ?«3BI G8a9j2vjweK&=0qNk?cq5%Y ?$J}=&y,  /jaK)%=qU Uo/%8X04g1rCWnEA &j8zS!MYpT*av)m%CҴ$B=yOL)bMWI&R+Mb6T@Yڼ9%')S hff@\ O mLgf2YP# /?Ua P`<`A'Eoв4n yq 7 iL4ap hw/$Tױ%I;56^Cv.bmfz+TJU]nK'R\ga!c(t3B,e:(`< |닳W-Ht:s7HAsGc,w76k5 ]Q n9F_uqUB+ש3UoP6~#&y6o#GqGGvz`qa-DE@=613uEk1qMVpiA;A3yf# 3Fe2Ji&Vm/W]e:DI)/6&A3{c}p]L1e 9f32 $U? &{dёҋqhD^v%-8 eCEJ;`ԯ{;2rC[`uKLXÑa܉Ӳ\F|p6J;/}?fK%;I}LK4>B)5HN# GpxH_Ș7xI/)1}`k&oP-J"[-xN&C)dvwwc+XTYeug%-嫎CjW@^NMDmK0>5JS^\Xb2P1e\=+5U&(t75tx-yL;x }|!dbEys#753C HN4<@94s&CLW@9xua8$-0Oo&tSlz rB5^bBMo[%}1.%>m+^AsȇfB#Nx~ iyݞ5#qht+-thf*$ClVb+<hf pB;^[N<6UU_9@l_UjN 0`Iw0Bqp9hU+lv,uhQ._81'p(eH%_e7@z cLC/bc G%#o $DJ?[/]H,la7Kv27jRf8|C&fNJ$dV=h ]a83nأQ6G}5Ari|%9GVO(bjxńGiƋҎCV!-ZA]s&) &@<:ڲ\ V9;(G1/Оb `' I#+\6e6W& LSRcv8JĤ$H9/‘b<|)BCoRz-f\6ՓFmJ`%lijS-T^f0FA.8w5B~=2_-rOe[gk-A>btGl5P6sϡ4#ߝ3Zq4+fY' K{'wv]SD͚1Wr4izM= 4wAYZٙ*C/V0w8/Awr6kdH Y?>7GT%pb7aX5Iui L+Oh\ 9Uq#r@B!+U^!ڷoԸlX23vjMAp)xo[xvcӏmy\6_4#7  Sb56{3C0X?(2% }FsHNbU6VKfRrW"*@N/[1 '@C#r8>- #xwRgӸX6%ViIEz`pqZ[=5YT$I7c!hV!Gvu=Qw#Ļ_CJI'"oN$3F {UVeX (s􃿌(Q׉q"H]stvklO[g'<;jAxd|YmaM6N+e <;[CR*9)YwwSzT[RN r/ܑ,F'u~҉DZQT\rrsMa%*YXO2f֕^72BLlydeH_QYY[mnFg|0'GGrC|INOk3AuMOf3r@F3;ؔR׸{oB}Z[}vNJ$(؊翲Yt2PՃA 1/(Yqw:uzN63[3 Np΋cv!?kw뱒(&M5xv*I9C򐯐ᜏTqU_GYiD-wŁx\JSu~z|my%90G83`,.T2W.pU.[cfDA{ س:bLS< ,&BKI)#TZH*Q"_hf{xkbeM-y4C8 ZIW}5kww%sO} j5ɪ΢7C* >fU)rj GRIFCJ8͢^wxf- ^;UH..ڷ'L;6v~Ƽzkh4eî6R s'KA˪o4|h06K/s$& \P ,UYK9^Z3&#@vXlGh# N6L{(}t:J#vnu,OezrA,~QGo agN o~HdCC=4W}-, qK" KUa`ϬK:/-N jjAmhXPXvae.]>(@627G#3(Ջ.#~h:H4`' 3) _&VU;G YXlSڬ0 g2?;O>EyqRΑf#+3Z1m@Cfg`| l "WХVi{PS3@EW /aJjOϬ_^RKtX+d elA!Gi"tooWJ^P!kE^I~385 NV?ca7;Y+ZJ6$~!a0_a'Ǎжd}*>*{m X k.8$e˳.^vB˪F8b tLpumuT?a<@r6 s]Xi SOɐyfLD|uVa~M2`;M%iE3{f)Su,Q5 j 4. oeNFf ppUF\Cqu[$w6N (T0;ܲ[4J~,}\9~dCN9a_%”Shw+gUY4X##HIH+}LK'9p^~@XKƒihUh׹Gho'MrvsHn-]nLk;Z:gTp^HKE SC\;cbpH|a(SN>k1-ڏ_~1[_^zRWg4T{;uiGFr|f%U39xe*B4YT& C !h>T5m.Sa6H!_+KH\s0x. a;ԱɿvG,eZ]wU@-/UQt.A!aّ>w ZͺAc .w=/!) fʪ 8:7)6 ڃ0hX= 1g0w\o _SOEwxT4G~f4U4&^V!K}>70vo0 Eb *xP>dCc1Vm,^%dtuNr| 'YyݣA/a`C$<HdX#f+`}YJI" AD]S}"eCŬG\ w3 o9a#nsP>YlP'de,u#daTW7g!LZFzi,y hJCEp\U l5ㇾ+%%QaP4 9L\ v)rLpA',U9" ]pfi+Qg k"![XXń(`YBpR%o0 jY\T,f4cH~N@yfhɯ%joYQ 'd[d7s_/Y7~{ lfbKq}'!Մ7Bzv$M3%$ C5E7-\6ͯc1pİS'23{4$`=I V1s <*@Z4lU!>l>n|qCMgH.yGiGVEbe$PL1 iBetz^ծ>^ zmn*S m=aj6/>Z<^Z4*fh7$ g6]qCFy֩=JL>\tc fF^YcC7KL'?jr4TN[V_b3EM>{2ioBŏ (W &?/Vrq =okP6hC8aQU2tlEQoǪfU?9FKJ0lJU#Joy%1L_8qv6KJ"Hcy_CK,yn\r\Jʌ T= FBD=B@ k?> sރGYF Z35W̕X$Vd}^}S?7.bNEȞYr OxjOڊ 9 2voB$( yIT7EH)[|K1!6H6a2Gt 2sG,PUu6 'ef-euk͖x!!qyAf+8Vg,0 GY1NyQs2J(TsV$`FBL {9s'(WL8⑫{(cEO`le4e|P3F\hOn(6w3ct:x){CKO.3ދ'E$[c:{3Ld ɦ)mPP IWxIUR4; &A cug& pdp#$D H/csj#yH\xDx f`A.+_2PTݦtȼL 5F.ۇC0;g"oKmIűb'SP#0+m`kuz!}3Y7q8A սt ߒP*UG-zW{H[e8 *4u$Fq9^%TUFl>]C#+/d4/s fB`CMl,; v_ܟ *D7ңV3rɖqsUgmj{#H3umIenzM?² -w j'elT67 sp|? }ufo+ 7Dcs0_ަ0J -:*HJ9?aϕ`!'aGhHgO2K*|_GAqd._9O ?Fa(Aqt uhhb-T[g8C,6"N@%arya&zQ5?7ɜdEBEb `-?sVa/F 8K`!Vg+kTIKUge}ROFMDs%n'7q@U,*gc8NkڽXǽvN1Hy>T{(F?h'`!7K".1XJ'Y`>@P:{Pd+b) 0l?i)Ő4PR1BG2*6n @\q,B5l?mafߏ4|MPT<}A5<Q|rMjX2LG&Â4Ix4FG`k%d '^թ6չ6C1mP.y$R4}Ru&&dźm|#mE^(F0^<ҝUmCvfjK^qAȥLɒWNXvxaL 'L Z |3M#?&yn-{79tpÓ rZ[c3<}a<6i|Rr9l{}YbfN#.=y=dEyH '{%9Tn(8Nw_ "E -i.JY1N>J+6ut*fB@gtx,gx|p)Y7 ĭݠ$P((}^?F5?y X{̮_:>$OKOJ7K'7-\[V[++6f('HqJ#TE>9r BJ^pJIAbR~a7!R'Xq2rLntAfU+_y;iG70e%gݥEt*y[*{(`YQf"CzTQayzNJ^2"5U*vKdBKM3<ҏ( )M&tp!ž[Byރl".fR^95>yjKbS:2DO)[Q4cTed%:aPf &.ygo 4/; [#6 )\j2#TBԢTqa;@AvM WU+_y;iG70e%gݥuj7-*^ф!8FOiL0"Lc9O- B<JJJ¼.cGx?uffq:BF i;mI5ރm%$jA4p-9Rp e&fOX35?$Hed*lϰAbx'm|`3dY>h!HsiDH{wS{L̳s6Enc!K#Y05m~Ɨ %$dU[D4qvqc*`Bp6a;4 5U5jt /~ W$*9cP 71ɫe%Hퟃ'fyg:3!)c\r/:tRPDJ"vH͑U3 (q8iAs((33qiG8e%RS%t bGoR^V/vo:,15jv~ J(J-!_<$`"@ c3ua4i%+iڰ͋щRUnaI}^?mn a7j{K8[W*6w%cW Qk=%^`>X. .ygm<+r%[KyXFȵR_z2nU:(cfA}=}S?7FaL/;7a_$NCg:"=c&XG5 2S!C3Ty() &yG;G.;]<Ɉ]T*A\li2'xu P2V!pN|3x;H 1R=@4ʤ{-!;=IFx*,llxa,o_YR2s?S$U$KKa'gQDl@Q~\"Q$3cΪ7#:r2ic)ח_a*$jy]Ar >DU4(DJ"<6m2 <;=)(`64nC 8e,I2Ju'Zha}% 2^H.~ÔFoWt"JS:7)bBVNT0 hV}CR\uf*H5B g) eZ/G$p%s7{Ӗj fF@"57lQenwLJ c= |3MwH O(Cq/\jstc42V dUX9tq2':L<[y1!pFKltr'V b{tdijn--2Ʉj6 BL>.h%aNaSP~)Jጮ T= ^LDq۔BH~u̻g;t'8Hd0[PYR$kz',nf(r3u}Q+!"7j:7tx?dȔC5E7-J.]^ oC%©;F '+& yk,;rZ7&+(DltoЧnTYh>dpU;sx*S'_f-gtk͖nyt W,t  , "D b-/4b1Qf:J),^- e1(2=7/^THȁV;'t.TWǁw%Abf@U9[G>ZQe/IrBRi`!4{8f+,8PC-ldyQNJ(8Ct*FdB5WEfaUoДc*L|ZG5[JU$zff 55W D̵7o>VZ,[$O]/^>P[Z4xkC=` (1+Ti4/;ީ[kop0F;;6Mk2}Y&2;6'8 _a$I-J{5Y!!P^ԄVFc_]qCs Q(J) ^P<*fd/BLGy+~ ƃym%Ct[ZGYRkz@vf(2^{/7@ya^tjtv4$A8 Q$K5nc<[5Vxͬ@kJ_f|Usage: mp mp .dat not found bus err seg viol FP exc sig inter: invalid file no mem out of memory out of memory screen width sQib;uX~{!E _ YQN>0j $kYCςQH&feDŻB@,9kk;ѥgKcPz5r{cu͓$v'tLK]Vq7 {=@Ry,:6j[AO.SV@20KB=JLN>fCSHyg"L;V-`Wg?TEt:9R.4;0Kk)RAP2':L4[q7)AjPH[pi'Vm-aQ%t1sTqa?nFOw lDwia b~NJ)J-!^YF⛫: 3M+S4zm%+i~?sp%Y7S0ݾۚ( (q3y66U^5V:7۰3O3M\ 2SL}L),E 'N){J?;<_3HpX3G f hsNfxT:ud(m&)/; (b&ire?ҝuvdv}q3}kW X> ||6>,n-Vd%[5'Ӳ2pyTͯ.CH1f_`نAd:Rykr㴤Q/usr/help/MP.HLP.MP.SL.VC.PR.HP.**/usr/ucb/lprwTERMTERM not set Can't open /etc/termcap No description for cmcltermcap: 'cm' and 'cl' required licotermcap: 'li' must be at least 10 rvrergESEEEGGSGEGVGHGUGDG1G2G3G4BECOCFKOKFMPMR[]|-++++++is    0 1 2 2TSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&% (null) @ O )N?@$?@$@Y@ÈAׄCAy7FnM8O?ZwH01uOs:   3 4 5 6 7 8 9 . v RKkrLKklDKkdUKkuHMkhBSkbCNENDLHPRTTBCLCRWLWRCWPUPDPLPRNURFRCkey table full  @(#)Fortune System Library Release 1.0 8/1/82 22:11:36 @(#) compiled Thu Aug 19 10:59:37 PDT 1982 TERMCAPTERM/etc/termcap/etc/termcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf OOPS <   /bin/shsh-c 0 0 П݆$ 7S0de=D"6@ItK,1΀Ra 9Jk[3!z$uk'uf_Z4=aRb e*k.XEE2 9alG 3I6$^q|\  !!""#2~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVU#$$%%&&''(2())**++,,-2-..//001122     23344556672NMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! 78899::;;<2~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPO<==>>??@@A2ABBCCDDEEF2FGGHHIIJJK2     KLLMMNNOO