IMD 1.17: 3/12/2010 9:42:02 foundation set version 3.51 1031015-mc02 9 of 12    UQVQFloppy(  ʾ^Iw   e@J2gF e 9Le"09LHm"09LHr29LЁd pLN^Nup`NVH<Lh3LhJ09A@<89C:9D=yGByL~> gp?΀`GH H@B@r2.-y I ,Bf  # 0. H @gn @gbn @g @g @ g @g`Jy߼g,p0.?Bg?BgHn 0n /NO.N,3߼ Do Dl Hn N XOp0.?Bg?BgHn 0n /NO.N,`b @g" @g @gL @ft`@t `:*y Jy߼g,p0.?Bg?BgHn 0n /N&O.tO.,/*(/*$/* /<NtO.,Hg,Jf,Jgx,Jfn,JgBTJ`JmP.HUNXOJg@ r -@.HUN0XO-@.HUNXO g n(fX Do Dl Hn NOXSm../NXOHH-@. R/N4XOJ.f`B/NXOgB R/N4XOB/NXONp./.NXOp./.NplXOp.HnN&XO.Nx`NVH B/<NXO$@ f L N^Nup@.HRNtй Br $v 9 :ѹ >B :` 9 :r & 9 >й B$*f: j g2&yL`"Jkg kfg  `:G Fe y 6g y  6g  `p.//NjPOJ9 g .Nx J`NVH <$n y  6f -|`BJ :gZ*fR j gJ&yL`$ kfg L й B$ . r (*9 V.//NjPOJfxp&./< N XOp&./< N X @ g&n* @g @g @ gP @ ft`t` @gv @ gH @!g( @/g0 @f ,HH@H@Hrf`t@`-| ,`rR5pB9 y rè@ y  h .N J g  `n.HRNxXOJg y JVgt 9 >r r. 9 >r / 9 :r R/ hV/(* 9xR/ y (&"HЩ2/NOJgNȎ y (f0*g3 *g3 y 1y `p./9 NPXO# |# # # `bNVH$|nt./9 NPXOBy߼ y JNg.NJg$Jg. /<+NtXOBN y "Hi Jg. NNJ ,g 9 ./< /,DNPO y  L`D0n./<߾NtXOp0.?Bg?BgHn 0n /N8O.N,`NVp ./9 NPXON^NuNVN^NuNVH $n p0.r?H@B@r2. r @H Ѐ"|@Gp#. *@//*D y 0h//./<_NtO0@r2.?.Bg?.Bg?.Bg/<NtO. /*/*//<NtO./*/*/*/<N ` *fBXJ ep# # y r¹ J!AD y B@t`N y 0 g>0H"y Jg,0H.Np0H"y B y 0 RB0Hxm9 p./< Z/< NZPOLN^NuNVH$y @H.N LN^NuNVH B9 $y pB^t`0H"| #RB B m0*jf*J 0g" y 00jfBPp.0j/NXOBjt`$0H"y Jg0H.NpRB0Hxm. N. NxJ g. N. NxNNN# .N   TB/9 NXOSN D|L jf .L<N^Nu=j"0.Hrl0.H@Hr€f J9 f2-J# B/<NXO$@ f.`*p0* @g  ` j f jgB&|0`2Jg 0.H@H2+HAHf`Jf-KGNe&n gp&0.@7@.0.H@H/0.Hr"|ڤ qNXOJ9 f8N'@ @(h# # #  .N J9 f ~ g. N    `'Jp&pf09H@H2+HAHf3B,B,BlBl- @p.0k/NvXO @'Hg$.N@.Nx.N@`. N.0.H@H/0.Hr"|ڨ qNXOBJg .NxJ9 f .Nx`^NVH NuJgNN$=@J9 f>&|0`&pf0.H@H2+HAHgGNe L N^Nu=k0n.N*N\Jg.N.NxB$yL`Jjg0.j f  `E^>e.0.H@H/0.Hr"|ڨ qN//< NPOJg N D# N LN^NuNVH$y # # $# (#  ,LN^NuNVH &y $y $*^%S^# L N^NuNVp1./< NXO`NVH$y 49 H0*@3 # LN^NuNVH $y Jg*p.Hn/*NPOJg" L N^Nu-y-yB/<NXO&@ g09 kg$J@g Jg  `.HSNtep.NFB9<` NVH NJgNJfNNb`09 BHr€fN|Jf` NJfJ9 f `~NV y -hVfpN^Nu Cp`NV y -hVg 9 CfpN^Nuy Bp`NV CpN^NuNVy BN^NuNV CpN^NuNV09 BHr€fpN^Nuy B9 CgNr9 CgNp`NV./<FNtXOJtg 9L`|` 9L`r ./<SNtXON 9L\r ./<jNtXOp09BSg |./<NtXON^Nu |`NVyLh3LhJ p`NVH$.`2 H"y Jf# "y B1 LN^NuRpPm p`NVHBN$l*`.NtR5 LN^Nu$yL g#L H"y #Rj%nB J`NVH$yL#L` A %HE 09DS@H"ЀЁ"yLAeLN^NuNqNVH 4. 6.R5`Dp .HRNXO`.*g(|0` lf4,v$l fp0r"|MG$S`jfj gp$R f$yO f(.NAVR5 L N^Nu#O$g R!J%K&5B 5C|Lh3LhJN^NuNVH x$y  *<$p.//NHPOJg~6*B0H@H./N4XOJm\0H@H. BHhN4XOJm>.D BHhNXOJm(*HgP@%B<@%nDL N^NuJg./<NtXOB p./9 NPXO`NVp#N -@`"yLh3LhJJoSN JgJfBLh3LhJ.N N^NuNVH $n .(t&<`  gԄf RЀ"RGe$ Ъ @d.N-@rfB ,L N^Nu0.n.HSNXO`NV#NN^NuNRj BT.N @`*g6`INe8.N,Rj  J`NVH49<`0^"yLA$H0S@^#SBf#LOLN^NuNVH<$np0*rЁ.0j /NpXO-@J9 g.N.Nr L<N^Nu n*hp0*rЁr5U5m5m5m%mG I t` BRp e.N J`NVH$n j fJjn&.NDBj*Bp0*.0j /N[2XO*HHrF€g./<HRNLPO.N@ j g R!j$O#OB*BjBj LN^NuSj .N@`NVV9Ag By9Af3B3BB`@O3O9Eg yO3O9EfRRpn .fRyBByON8N\03I3@I3@I03@Ip3@I 3@I`3p.N Bypd.N p09 @H g3p.N 3$p.N 34pd.N 3$pd.N p09 @Hrf8@N3By3@3PBNhN^NuB9@`NVH -|t-|0-|T nA r @-H$|@t` @ 4TJR .r ⨴   eppdBZR`BRTJR e 9Ԁr #Ԁ#OJԄg* 9Ԅ#Ԅ 9Ԉr #ԈԄѹO 9O#L\#L`N y"9M#O 9Mr -@3R .Ѐ"|@E .r $` @ 4Rm&n`BRK .r @e yMA r "9L`Ue .N, Mc .N,309Ԃy3 .O#OL\#@O#@O#@O#@O#@O#@O#@O#@O#@O#@#@O#@OL N^NuNVH4. 0H^Nu n !yO n B yO"n !I#O`NVH n ("n o6 (S"n f p%LN^Nu n ("n op-`t` n ("n ft`t n ("n l6 ("n ")SfB`: n ("n lB`"B` n ("n fB`B `\NVH<$n f n P` J J(H`(k0+ "y if./.NXO-@r r$b@0; NJ%DJx`Jzv n0Sf!k` n0SfNpL<N^Nu n0Sf./.NXO`.$k nԀl0Hr29Đ`0HԄr29ЁRLN^NuNVH4. SBydp092HЁLN^Nu0Hr29ƐйԄ`NVH4. ye,0HԀm,JԄg0HԄm 0HԈm pLN^Nup`NV3333JyBf:p33333By3N^Nup`NVH<$|2(|JԄfL Ԁn@(|`8"f .N,(|"BBBB B(B0BHBB`*| "ЀЁJjDD`4Ud 0`p0$ *"ЀЁJjDD`4md 0-0Sg n0Sf!k`XA G n (R-@*K-M n (l*H n-hf.Hn/.N\PO @ gpf$ n (S'@Jg .NVB$K` ./.NXO`x n0Sg n (S'@Jg .NVB$K`F n0Sg. n (S'@Jg .NVB$K` n0Sf!k$k`&L f n Pg&J g +"nl $K&k f././.N^PO @ fdp:``NVH nB$n g *"n lx n 0* "y iff n (Sn`J n (m~ n (n(0* "y ig RgB `p0%@ *"ЀЁJjDD`4md 0-`p0%@ * "ЀЁJjDD`4md 0-`p0%@ *("ЀЁJjDD`4md 0-`p0%@( *0"ЀЁJjDD`4m d 0- `p0%@0 *H"ЀЁJjDD`4m d 0- `p0%@H *"ЀЁJjDD`4md 0-`p0%@Rp opT&@#LJfp0$ r29dp0$ "Ё"yLG#L r "KG#LJf p0,%@ *r29dp0%@p^. *N"yLA%H &H#LJRg< Rf Pg0$j f`< n (n& Rg Rg Rf Pf J LN^Nu$j`4`NVH BBB.g4 n Pf ng n Pf nf p L N^Nu n =hB//.NPO-@f n Jm4 n Jf !|` n "H")SӨ n ("Hop` n hEZB n 0HSrbL@0; NJ"Hn/. /N"O @-Hf .g . /.` n 0`.g.NJg p;-@`B/. /<ONPO&@ fp:` nR n7h  n7h.g n.N@./.NXf p0,%@ *r29dp0%@ *"ЀЁ"yLA%H&H#LlJ f p0,%@ * r29dp0%@ yLlA%H$ * "瀐"yLlA#OJ(f p0,%@( *(r29 dp0%@( *("瀐"yOA%H,&H#LJ0f p0, %@0 *0r29 dp0%@0pF. *0N"yLA#LJHf p0, %@H *Hr29dp0%@H *H"Ё"yLA#MJf p0,%@ *r29dp0%@ *"yMA# 9O"艐"HA#M r r`b 9Mr r`bzL<N^NuNqNOJgp-@`p-@BkBk./<ONVXO.gP n.N`@.gp `L n"n """"` .g. /HRNPO` p`Jf n fB` n "H")S0n./. /.N PO .`NV n hf "n")` n hf"n"i")Ө` n JhfD n Jm:pf n "n")`pf n "n"i")` JgpN^Nu n 1np`NVH $n=j =j0."y if pL N^Nu&yO`&0.k f0.kf=k=k`&k f$K fp`NVH n hIZ$T` &j0* "y iVHt`JOfD "瀐"| A $I "瀐"| # "瀐"| A`J "瀐"| #O "瀐"| B "瀐"| A"yO#H#ORԠmZLN^NuNVH$yO gRԤRԬ#Og yOB n $$$$E y 5h BjBJf n%Pg j!J n `$ n%h nJg h!J n!J%n`RԨ J LN^NuNV n Jg h"n !i` n"n  n Jg h"n !i n Jg.NV n BSԤJOf n !I n !I# ONf .HTNrXO$K fLN^NuNVH $y $*&*A%H=|Jl-C D-@`B-C Jgrgr=|p`=|`=|p%@NC9 HH @ g @g @g @:f8   L N^NuNqNVH -|$y rbP@0; NJ&,@@D&@@@LL@,(p`NuJgNL N^NuB ` *r b@0; NJ &2@N\\h#2 `#Ll `# `#0 `#,T `z# `n 9ԀйԈԄr # `N# `@#     `2 `&HnNnXO.p ./*HnNPOJg `p .Hn/*NPOJfG+ p.HxNjXOt`HHr.?BgNPXOB B cBHxN:XO`JgyLh3LhJ`pLh3LhJ`Zpg NuJgFNe``&NuJgp.`NuJgB/*/* y NPO`NVN DNJg"33|'.y yNN `NVH $n&|Ht`060@@60@@666669BS0B B cL N^NuNVH 4. 6.$|HK40.N<(Jg SЅ(mz`zA"8. .NF-@JfJg Rmf&`"A08HH"|1HH. nNSJlLRpm g.Np fXJ"0.H"瀐"| Jg. yN`x0.H@H.0.H"瀐"| qN`JJjPgB9 f6S.N@p.HjNNXO.NJg0*JH# Bp/HRNPO-@J9 f09 t409 v6Jg=y Jl fN-@.N`8J g. /.0n/NPO`.0n/NpXO-@ nJ$gvJgp./ n hA(HPNPO f6 ( mB Ѓ f $l n.NJ9 fJ gJf fJg 5y J` p5@L5@J*fR.HRNt9 g .N`( `f n.N` .N g @f 9 o$%@` fժ ( fB *BJ9 f J f fH5y L*SgjRLAN.NVJ9 fJg # `NVH $n$. g"J9 fhJf.HR/9 N`L N^Nu./9 HRNPO&JgPJg./9 HR/<NtO  `Jf .HR/9 ` ./9 HRNZPOչ չ  `N.NVJjNfLJjPfFv `, C (1g C B.0j /NWXOSJlBBjJBjL*BLN^NuNVH$n`p .HRNXO*fLN^NuNVH$n**g*.NVLN^NuNVH $nG `Jg .NB`L N^NuHHpdgpug pogpxf.Bpofp`>pxf6p`4psf -S nRHHJg".NB`pDf.Bp //NPOXKHHp%g|`^NVH<$. zJl `p-@Jg .D-@pfp ` p`p f-@`pgJgp fBp-. nNv`P. zNqp`:p`4p`.p`(p`"p`p`p`p` p `p R y pNpSNuSN(NVH$.g. yLlEp`0*Hf . HRNXOEpVeLN^NuNVH $n$. SJm6p l0N D&p威N *f * o.N8.N L N^NuNVH $y `.N$$pfV9 g8 yLlGpVdp0*kf +f BHSN5XOGp`J gB L N^NupfJ g(9 g` S"| 1g*fp"FNJNfRp`NVH &y kgL$yLlVd>0*   kf..NV|N+gN(JgL N^NuEp`. N.N2`NVH $y *gNn.N$g`p"FN S"| &1gjf6B9 rgBrg>k BB%kFFBRB*Rt` "y Jg  qRhRxm y Rh J g y Rh .HRNXO.N6Jgp`|||.Np|0*H# p`NqNVH|$nB p0*, `fr6*"Ht`Z HЀ"Ё"|0 f< HЀ"Ё"|001H@H"AHf HЀ"Ё61`RJm`6* H 3 9 r -@Jm *TRfR09 @3 <r29 Ɛ( 9 d(B`%nT BpOg y !yOD y BNJOm\p On`PJOg.O/9 NbXO.ONVpL N^Nu.ONV. N.N2p#O.ONVp`pd |0(HH"y Af | 0(g$O`R`NVH $y =yږ@||JLg|`2Jg *g .N,%nRB* * o| .r?"|OG$&.@ oJNg"NJgJRg.N||`\JRg||J9MgB9M.MNJyږgByږJyڔg yڐNN"JNgNNJgDF3 `f Jg .R# .L|N^NuJ gD f B**` * *Jlzl( 3 f"`.N` ."9 ⁰lp or$. C -qf>J f.NV|&@ g +-@.N C #*Bp lzJgr RC `\zp-@p x` P .-@ .ܰm .ؑSJnJf  `(p C -qfJ f.NV|&@ fp` +-@.Np C #*B`./NpXO&@J9 f-kQ .@H$ "n-qfRJ f.NV|(@ gt ,.gHpL N^Nu||JyږgByږJyڔg yڐNN3ږFp`p./< 4NXO`NVH $n@||JRg& *Rr?"|OG`&H Sf&BRFL N^NuNVH<$n@|| r?"|OK`BR(B+ +f0.N(M`& +g +g .N, kRg(K&T fFL<N^NuNVH $n@||&yP g*f"Jg .NtFL N^Nu&S`$P#P`NVH$n@||*HHrb@0; NJ .N,.Nv|*g.-@pl .N`.N "n#.N`.NRpo^ dJg R"n# .`NVHJ f` pLN^Nu. N $mS R R `NV N^NuNVpN^NuNVH$y *Jg,rg6rfNuJf LN^Nup..//<`t` HЀ"Ё"|0Gpfn0+H@H"*AHfR k (h ,Ѐ-@=lp.HnHlNZPOp.HnHlNZPOp./HnN`*RJml `@p../</NPOJg& `NqNVB   /./.NHPOJfpN^Nu./. /.NZPOp`NVp././. NHPOJfpN^Nu./. /.NZPOp`NV yO2. A 0 yO2.A 0./<0/< NZPO yOBP yOBPN^NuNV yO2. A 0./< N XON^NuNVH(y $lV gt.N&j*S*2f+f.N. |/<N&XOj.Jj.g .N,++g"Sk `$p.Hj6NXO`LN^Nu.NxJj6fp0*$.HRN*XO*4B*`&p.Hj6NXOJj6f*4.HRNRXOBV`NVH$nJ :fLN^Nu.NpLN^Nup`NVH 4. $n vG=R=jJnfvJBf L N^Nux`P0D6 C@cv@p0./<.NXO6f$45Dp.HRBNPOJf.\`TKD@Be5B5B` JBfJx`.0*D6 C@cv@p0.?Bg/<.N$POB[D@je0*j8*Bj`p0*S" RЀ8*v`neJp0./<.NXO6J@f*4p.HR?.BgNPOJf .fN,p`j`,JBg Be$Jgp0.?Bg/<.N$POBSjC C@dCTKA" po .oN,neVBeP4p`nNVH $n j$c .|N,&Jv`40*`.NR+2 y !KV. Nf`dG8`tJ*f f(K`J+2n k*(g k*f+4g`&L fD.!NAVR5p.N Jfp ./9 NP`Z&yOȷ^d`| 4J g4 9 :r 7@$.NrJf../9 N"XO`|2B+3Bk.'J*Rj y !KV. N`J fH# : # N #  y .N y B9 4+4.Nd``NVH$n.N.NFLN^NuNVH$n`4BHRNXO*4f4LN^NuNVH$n$C4 B@ct@p0./<.NXO6J@fp0`FC@j$e*4gJ j$cp`p./<.NXO8p0%@ JDfp0*$.HRNXOpL N^Nup`NVH $n$. &Jx`, D6 C@cv@p0.?Bg/<.N$POB[D@p0e*4g0J g* * . j$cp`p//<.N$POB L N^NuNVH<$n $.&.x&J-B`YJ`XJJg* f0*@g*f0*@r2.NH"yK*fr- f-?`R nPfF*g>././.NPO(@ f .N,p0@`H *4g.NV*4LN^NuNVH $n&n gLJ*3gD.NtS*3f*(|+g `(@*4gB?*$BgBp/HTHSN̸O*4g j$cp`p&+g. yO0@=@0(@=@A-H-|``A-H-|.0y//< B r //./* HSNOt`RXLp0*$d,gp0*$f*4`p0*$.HTN&XOj.Jj.g .5N,.ND.NrL N^NuNVH 4. v&yO`$$k* g Bgj f .N`JgRG8^e L N^NuNVH $n*g &yO`*f`f*g R0*@r2.N`Jg4././/HS/.NOԄpf 列` xJgRpfYK` L<N^NuXK*fB0*@g8pf.HRN&XO"n"iVi.`p.HRN&XO"nBSRpf^`VNVH $n&n $.&.pf`p@r?‚(o(0y.BB r / / jDD`Ѐ"jV01r2p?Ҁ/HRNO.HSN&XO"jVi.Ԅ Jn|`pfp`p.Hn/.//NO(. .rgrg"rf0 ` 2Ъ6` <"҄S.NG8^eL N^NuNVH $n.NJ*2g.NpL N^Nu&j**4B*p0*$.HRN*XO++gSk `.Nxp`NVH $n&jV g.N %k&Z'J&R+3L N^NuNVH$n&jV g k&f'jZ&`LN^Nu(k&` lZf )jZZBZ`(lZJZf.AN,`NqNVH.LNVJLfp./< Z/< NZPO#N B/<NXO$@p./< /< ZNZPO g4A# p # B  .N nPm: nRn2A# p # p#  .N n g-@`./<N,XO0y.BB r / .//.HRNO.pf K"S剑` K KHPN&XOBԄpf 列` JfL N^NuNVH 4. 6.$nx nGJBmJCmp0r2Ё"H2HABAHAc .N, nhd6p0" =@p0.Ѐ0(r2.퉐A8 D@cx@B?`. nhr2(S "Rҁ` D D@dDTKDdp0r2Ёr29(c .N,p0r2.?BgNXO%@Jg"p0r2Ҫr2Ҁ$L N^Nup0`NVH$n$. (&d & jDD`Ѐ"jV`V   `#P .Юr #L09L@@yL .r r. .r 3L?Bg 9Pr R/#L JHP 9xT//<NO.LNrJgRj `  BL g.Nx.LNÐ 9LLN^NuNVH $y *&&@.2HSHRN|POp09L./<HRN|PO 9Pr r. 9Pr /p//9L 9xT/HSNOL N^NuNVH$n&np0*c(J$.$K-n &L-B p0-@BHR/.NBPOJg"BHS/. N0POJf$p.HR/.NPO  ep09L@"ЁLN^Nu09LHe8 29LH& jDD`Ѐ"|L01r2p?Ҁ ` *6Ъ.d BHn/.p/ 6Ъ2` d(p.Hn/./ </NO .`XBHn/.p/ `NqNVH$y %n&pЮr%@6# |p./.NXOp. . Ю/NXO .. .Ѫ2#. #2 pй r%@:# ԌLN^NuNVH< $y &jV g8N*|@(|v` BBUXLTMR&mԘf #Ԙ *2Ъ.. *&/N&XOB.* *&Ъ2Ъ.Ъ*S"**S   /N&XOBJBg .N,BJ`p.HjnNXOJjnfp./< BNɮPOp./< BNɮPOB&B.B*B2B6B:B>B |B B B BԌBԐL< N^NuNVH$y Jg$Jldp f *&Ъ2"*.ҮЁ`$LN^Nu *&Ъ2Ъ.Ъ*S"**S&@ .D.HSN&XOB` *&Ъ2Ъ.(@&L. /.HRNZPOJm$.`(QSlPfp.HSHRN|PO`\NVH $n`Rp./<NXOJf#./</<\HRN O .hNJg pL||R9MB/<M`jNV 9jDD`.p / 9LLNFXO/NXO./9LLNXOLL 9LDйOr.N #LDp. 9LHNйOr.N #LH 9LDlJ9Pf$ yLl(HH"9jDD`≰o$B9PB9M.MNV.PNVN^NuNVp#LT#LP 9Od< 9L\#LT#LT.p/NXO#LT yLlA.NVN^NuNVH$n&n r Ѐ"|@It` ЀC01@ 8R* HHRmLN^NuNVH $n&n e4 r29Ld 29LH N^Nu | "|r"Q2 | "|r"Q2B||JPgBPB/<`R9PB/<PNXO|`BB 9jDD`∶o p-@-@$+JJVg kVJ(3f0(0HԀ./NXO$./NXO$ "."9OLLc*չLL.N4Jf^.LL/NXOLL(KBp l#po#BBQ yLlEp`b *@ HrfL *gBg .SrbL@0; NJ $$>$0.H"瀐"yO(q&`0.H"瀐"yLlI` gp./9HlN(PO .Srbv@0; NJ 4BV .`8 ,&Ь2`* ,&Ь2Ь.Ь*S` ."|`0@r2.NF SJnL N^NuNVH $. .r Ѐ"|@Ev`$ CA2AHABAHAA BRRTJmJf .HnNXOL N^NuNVH<$n*j,0*H@"|A-H 9Gr ( 9Gf09G` n29G "9GҁAHЁr $*g*p0*0@ -@p0*2@ -@Gg:XK`6.HUN0XO&@e p./9OHmN(PO &@(|@ ЀAOc .N,v`0+@fH./HS//<NtO*gp0*2.?*0Bg/<GNtPO.VN,*g4  ,&Ю&@` ."|G g &@Bpf(./.0.H"瀐"yOAHPN 4PO .rb@0; NJV<\ -@ n (VOr8.NF-@` "n&2-@ n`L n (&"HЩ2Щ."nЩ*S" 䁐` `* "n&-@ I0(jH` -@BJg0.@jj0.@jj.N-@ .rg rgrf*` .@ **?*f*g .yN,.**SO0H@v6 : `f*0+@r2.NH"y1?1 KXK0(@@ 8RmZBT 9G@HL<N^NuNVH $.$n`NJ f L N^Nu9Qg Q`Qp./<QNXO./<QNXO&g g6 Ѐ"|@G`0*@g0*@@ 6`B[XJ SJf r @``NV .r ./. /<QN$PON^NuNVH <tS$ 9L\r l 9L\$p./<l <///<QNlO 9L\r ov 9L\r $ o$ <.//<QN$POp`"9M艐$p o$ y2IAPP H"ySJnn y Pf"pgJg. /./.N|PO . `$NVH |$n$. pOc .ONVJyQgPByQ.QNV`:0*@v6.NJf .N,.N& H"yG+g .N,Jgt+gB y0H@z: H"HA" 2IASS < y2IAPP`^ y ( < H"HA2IAPPS  y"ROXJ SJn y "yLlCJo" 9Mr .//<QN$POLN^NuNqNVH $n$. &m&m* d"09LHm&09LHr29LЁd < L N^Nu6m *6Ъ.m *2d <*e <`.tN,`NVHp./9O yLlHhN(PO &@`0+@r2.NvXKSJn`. .r Ѐ"|@E`N, "y q*h`L.HRp/HSN O 0+@r2-A.NH"ypf" jVRh.. //*VN 4PO`pfRyL` pgRB.gxf.N\`Z-y -y -y y 0.H@z:Jg r ` <# .r # r @# z  `.<p./HUNPO-@Jm.0n/NXOJgp yO2.A 0Jl. | AXHPN XO`.0n/NpXO-@. | AXHP @/(NZPO.N`L 9 c 9 ".Rf0n.Hx@   p// y AXHP/.HRNOڇ߹  J fpf.g 9 >@H*fpf6.g. 9P@H*g <. y AXHPN XO# # #  `f0.@g .N,. /< /HRNZO -@0n.Hx@p/Hx r //.HRNOR5.HRN XO-@.HRN0XO&@.HRNXO<p0& n2+AF0 rg\rgrf.NV0+@r2.NH"yI0+@r2.N`&. //*VN 4PO.g jV4.V`NVH<| NqNVH $n09ljg y Jbg.N < . < / < / < |/N~O #PA.?9LBg/*2/**/*./*&/*VNOJbg.N3lL N^NuNVH|$n&n $.d<e 䀰tm"e r29Ld  o` `J *6` <*Ѓ`0 ` ` 29LHЁ*`"Srb@0; NJ Ѐ"|@I+fBT` 0+@F8XK` xe$ 9L\R-@N LJ gNp. yLlHhNXON t& 9LPLTl 9Od09QH"yI,f,g SLP`,|H rb@0; NJZRX0,@H"瀐"yOG$k&0,@r2*0,@r2`0,@H"瀐"yLlE&jV0,@r2Ҫ6*0,@r2 *&Ъ2Ё`V0,@H"瀐"yLlE&jV0,@r2 <*0,@r2 *&Ъ2Ъ.Ъ*S*@`0,@H"瀐"yLlE&jV0,@r2*0,@r2Ҫ&*䀰tlx`.SlL|N^Nue r29LdxJf &&lxJf &2lxJf 2.lxJf.x<< pgpfF `NVH $n$. &.Pg0pg*pg$pf2 jV$h&`$jZ gPf g./HRNPO&@ gBSL N^NuNVH$n$. &. SrbX@0; NJ *4> ` Ъ6` <(`, ` `09LHЃ`.nN,.HRNXO @ LN^NuNVH nPg  e$ . td . Ѐ"|@E` J LN^NuNVHA`p yLlE0,@r209LHҀ*0,@r2 |`2 yLlE0,@r2*0,@r2 |Kp./9OHjN(POpgpg "<Ё*@-g .N,.QN2-AHABAHAg .+N,, f ,? rg rgrf 9*HH"*Bm-fR0-@gF-g< 9jDD`䈶n *@fN LJ gNJ f( p. yLlHhNXON `N .QN.NR./</HRNZO (p nPg  d .wN, . Ѐ"|@E J LN^NuNVH< $n&jV gHPg+4g8*|+4g "<@Ё*@(k&` ,f(lZ f` L< N^Nu g`p./9HlNPOp0+$.HU/<NZPOPf`(lZ gPf f.&HUHRN`B+4g9{..-Mt`*Rp0+$e+4gL+4g0.?+$Bgp//+* 9xR//.NO` k$cp`p&BHR/HnN\O Jg0j./<NtXO0.@=@0.@=@Hn0y//< p/ r fRk6. /HSN 4PO`pfRyL` pgRjnJg.0j//<6NtPO0y.Hx BHx r //HRNOR5`,f$pfSk.`pfSyL` pgSBBp/HUNPO0,@r2./HRN8POpf.0,@r2/HSN 4POtRLPRQ 9QmBQpnR` NVH<<||$y g#  | *r & *rg .AN,. yLlHhN0XO-@ @0(@t4Jf .ON,.N.NH"yK0-@z:-xH rb//</+ HRNO p./9HnNbPOp0+$././<NZPO*nt`-fBRXMp0+$ePf.&/.HRNbPOB//<NPO` NVH $. $n& n&h&`.+g"p./9HkNPO (@(&kZ fL N^NuNVH$n *&Ъ2Ъ.Ъ* o| `B* * HHRLN^NuNVH<$n&nBHR* HHR/Hn n NO Jf pL<N^Nut` C01@8 ЀC3R* HHRm "< Ё*@Jg4.BHRNPO* HHRr .HS/.NZPO+J`.BHRN@0; NJ ,ddd||L<`NVH $n&n $.`p0Jg p0@ `p6TJ SJfL N^NuNqNVH $nG ." 'J5|%| J L N^NuNVH$nRy5||`p.HRNXO*g|Sy5*g" f LN^NuNVH$n*gZ*g .7N,@||%y # 9 g yLlA.NVFLN^Nu*g.NV`p.NV`NV n./(N XO nB$N^NuNVH<<-np"n*Ry5JoX||` p./< NXOJ g$y #  |p$%n,.Hx@NXO$.g: n-H r &g .FN, n$T$5P0 n.A$& 'nL N^NuNVH$nGJ n .N,(K`8  m.$, . Ѭ . fPL)l)Tf LN^NuPLJfp`NVH$. &.oJo nE-J`PJ *nJfcT *ЪmH *Ъn^ժJg Ђm Ђn< ѪJgPJ%j%R` Ђm.Jg* Ђn Ւ`r."N,LN^Nu(*%C&($PJ$fA"nc:QJ./* I (//<NtO A Yp%@$ n(g n.NV`xNqNVHR5L. 0n /NXO$@*f>$5P2`T.g g ._N, yLlA%H,  8rD.NFr  @-H ../.N0XO(@ n"9L0"Ad$p./9O nHhN(PO (@ .r Ѐ"|@G .. yLlHhN0XO*@*0,@@ 6`l nPg@xP yLlA%H,  8rD.NFr  @-H ../.N0XO(@ n"9L0"Ad$p./9O nHhN(PO (@v` HC#R r ⨶e y hf .kN,p./9O yLlHhN(PO .r . yLlHhN0XO %|.0. H@H"|ڬ qNR tR5D.N J LN^NuNVH . 0n /NXOJfZR5L. 0n /NXO$@*f8%|.0. H@H"|ڬ qNR tR5DJg~p dr.0n /N0XOJf\.0n /NXO&@+g.NP`8'|.0. H@H"|ڬ qNR tR5D f. 0n /N|XO @ L N^Nu.N J`NVH$nR5P$.0*H@H"|ڬ qNR xR5Hf.N^.NLN^Nu g`*g" f `N(@v`* HC(Jg0,@r2.NXLR r ⨶e`x.//./.NNO @-H%n%B . Ѐ%@5n".0."H@H"|ڬ qNJgR5\չ5d` R5`չ5h.gSy5L<?L    N^NuNVH$n*?gBj@j>BBHxDHRN O LN^NuNVH$nG JSf.N:4`.N>(@ g,HH,HH./9 NXO$./9 ,HHCAHPNPOJg .N>nչ  `6.Nn`zNVH $n*>gJjfj>A8.NVGJ*nB?p*f *9fJg. LrF.NFrF.N"yLA.N>nA.N> @&f pL N^Nu S(H"H)HA7@7@ S(HH"HCA&&<`|JfN>" @A&gDBk(SA.N"&@ g+HH./9 NXO$.Hk/9 NPOJg .N>n`p @չ  p./HSHRNO `> y R .N $l  `&S p.B ?BgHRNO J fN XBHR j.NXON `xNVH $n0*,j*=@5j,*JngT0*6v6*>gCH=n&j&0.yLxex0@g`jtHp fgt `L N^Nup ff8gt  gpAm pZnp Ԁ./N" @-Hg^. LrF/NFXOrA.NV `NVH$nj>*=f4J*Lg.JRfJ*Kf$*>g&|C*?gj>.NVLN^Nuj>p*LЀ"ЀЁ.HR/<0NbhPO`NVH$n . Dg Dg Dfb0*<2.@=@.gLN XJj g4JRg0j j %jA $$4QA "|R8 0jCN LN^NuJ&f`*B&N Lp#L|p./<LtNXON N>" @A%H&g5yLx*5yLx,p .HR j.NXO`F/NXO"yLAHPN?XOp0.ѹ5 nA%H&5yLx*5yLx, RcN*?f  f *F9R4gp.HR j.NXOJgp0cp.HRN9@XO`*=vHJg`np.0j@/NXOfTp.HRN9@XO`Bp*Hf,p.0j@/NXOfp.HRN9@XO` gp fgCR*C`p*Lgp*Mg*>fp\f>p*If:g4gBBp/HRN$O CBBp /HRNO t`Zp*Jf(g"gBB ?BgHRNO Ct `&p*KfpƀR*C`p\fgj>g BB N Xp.HR j.NXON .N8p.HRN9@XOJg< *LrF.NFrF.N"yLA.N>nBBj"Bj$J&g *&LrF.NFrF.N"yLA.N>nB&Bj*Bj,`NVH0. H-@ ln0. H@H-@Jgpf$poF ."| q LN^Nu ."瀐"|$q gpfp n` .S` ."ЁA`NVH$n . Tgn TgT TgJ Tg& Tg Tf.NJf:p`.Nx T f p.HRNXOp.Hn/.NPOJf*?BgHRNO BHR j.NXO0.SnJ@g tHgp*Gf`jf.j>0BA*KAe|C`J*Lg*>f.NJ*Cg*?gj>.NV`NVH $n*>g*=gv` v`0*8v6JfxRf(R5.Hjp0./N=jPOL N^NuGRKB`x f.HjHxN=jPOR5.Hj/N=jPO`@f .ѹ5A./. N?XO` n (HH"HCG-H .SJgtH m *>gd*=gP(|Jg&HHf.Bp\/HRNO ,HHpAmpZn.Bp\/B.g@J.m.HHތl.BHxDHR*BHH"|| qNO 0*p.Hj8NXOJjf0*>Hr!€fN *:f p.NdLN^NuNVH $n.g^`.N>nA.N>&@ fp.HR j.NXO*?gj>A.NV*L N^Nu09H"|1(A-H3B nA#G HHp%g$.NJf.N .NV`HHpdgpug pogpxf.Bpofp`gj>A8.NV.gn`.N>nA .N>&@ fN X$`.N>n.N>&@ fB*C.N p.HR j.NXO*?gj>.NVL N^NuNVH $nN XJRfB*C`*?g*9 g0`A 0Q |R8$$4QB*CN L N^Nu*=f"J*KfJ*Lg2j>*>f.N0?p.HRNXOJ*Cgz*=gN &|RDv`RDcSK`p*Jf &|RD`p*Kfb`v *Ig *Jg *KfSK`8*=g( l |J0(g SK0(HH`p\f `2p\f`B p gLp*LgHPNO0`:09H*HHЁ oN09H"y)HH.NF@r@=A yE 0.SnJ@g09H*HHЁ nJjgBBB*HH/HH/ <\"y)HH)HHЁ*HHЁ/09H*HHЁ/BBpZ//<BHHrЁЀ/AHPNO0*Hy`6 . m .~ n. HHr "yC E09H*HHЁ oNJjgBBB*HH/HH/ <\"y)HH)HHЁ*HHЁ/09H*HHЁ/BBpZ//<BHHrЁЀ/ABp*Mf`6SDeSK.N`0*"j$Bj"j>0*>H@fN8L29ԴH.N<-@29Hg09H"|1(E3.N y 0(H$. Hj/9 NPOJg  `l 9 CB1B .NV`HNVH  d LN^Nu09yfp1./<NXOJ9 g`09H"|1(E09HR29ԴH.N<3./9 HRNPOJg  `t `fNVH49`<0H"|1(EA./<NtXO0HR29ԴH.N<4yfLN^NuNVH $nN L-@09HR29ԴH.N<=@yf.N N^Nu>`j>j>`*?gj>>`NVH $|ShGJgJkf.*BHH"|݄ qNgJgN $.N.N `L N^NuNVH$np0*-@g:-Rg4` nHH.N4RSnJnB9BjLN^NuNV#S#S#S#K#j#jB&N^NuNV#S#S#SN^NuNV |Sh N^NuNqNVH @|| n h0@4F n fB(p0L N^NuNVH@||Jg>S yT4 y8e    #4Fp0LN^NuFp`NVH0. @=@0. Hr-@0. yDmNJdLN^Nu0. H"|$q*Ef0*>Hr€fZ.N85|&65|85|+.f `?p.Hj NXO*?g*?fN0. H"|(q&l@|*;g6,H66,(,H6F.*BHH"|l qN|`NVH p0. H"|$q.*BHH"|p qN*:g.V/.NXOj>`p0*"ѹ5Bj"BHR j.NXO`NVH $n*FtH H"|&qp& . r b@0; NJ dNz0*j>p.p//NFPO`|0*"j$Bj"@||BFj>@||p9&g: F9&p9(g$ F9(Jg./+/N PO`j>F@||0*>H@ gFL N^Nu*>gJjfj>A8.NV?FIJgJlfH.*BHH"|݄ qNf*j>*:g*Ef.p/NXO`xp0,.//NH`>p"㨁9&`Nj`*?fV|0. H"|&q(k8++H88++H8p.Hx/.N PO|j>L N^NuNVHp0. H"|$q.*BHH"|t qNLN^NuNVH p0. H"|$q*:g00. H"|&q k(f L N^Nu.*BHH"|x qN`NVH $.BnpĀ H"|$q*:g T fJng`8 T f*Eg$*E*?f .p/NXOL N^NuE H"|&q.BNXO0.Rn @?*?g j>`0 9R4gp.`@*6g.V`L*?gj>*?g >` 9R4gBp//N~`t*6g.T/NRXO`Bp//NRPO?p`.Bp//N:PO? 9SD"逐.NF.HR/<<NbhPO`ZNVH 4. 0H"|&qR5@|| .Jgrf.F+`.+$k4+H BfC4.N4F0HL N^NuNVH ||J9"g|L N^NuS|t&|S`VgB H"|$qBJ&g*p0*,r2**&.*BHH"|݀ qN; T f$Jgp"㨁9R4`@p"F9R4`0././. HRN3O JgJg:B/NXO*?f,*:g"p./HRN PO`NVH 0.H"|$q&jJn f2*HH@@@|6*H6FL N^Nu*HHr`NVH4. 0H"|$q0H"|&q(kJyMf NJRyM@||p&p9R4f6*6f*6g& 9.*6g 90`4 F90`( F9. F90 F9& F9( F920*:v6Jng( Bn8`8 N:gp@` <8N:8x@gRRK09DHmB9S`tNVH 4. 0H@H&0@40H"|$qg0*7f(*7g p.0j@/NXOp.HRN9@XO*:g$gJ*?gB9,f:0B.HRN`t0*>Hr€g g<9*gp.0B/HRNPPO`"L N^Nu*:fB0B/HRN.PO`g9R4g9,gp`p.HRNXO`NVH$nJng$*?fA .NV?LN^Nu*?g0n.HRNXO`NVH$n*?g8p.0j@/NXOBj@p.Hx0n/N4POp.HRN9@XOj>LN^NuNVH0. H"|$q@gD fD8gD `D @H8xg *?gx8p0Ѐ"|X01H @H8DH8 (*?gDD gpȀ @H8N:8JBf @r2ҁ |,` @r2ҁ yT00H(p@H8F rg$Jf0*?g~p.Hx0B/NPO`h |< `X |<0 JBf" |KAH'HBP||0B.N `$||.HSHT yTNPO0B. yT N8N:8*?gJg./+0B/NPOFLN^Nu0B.N`NVH R5|| .@fJ9SfJ9"g L N^Nu"|||BB j "n H0FLN^NuNVH $n $.0. H"|&q@|| k H0Sg k(g k H0S'J&FL N^NuNV@||3N:3NFN^NuNVH<<4. 0H"|$q0*>Hr€fyDl*Eg pL<fp`p:0|`=|0*6x8 g fBp0@pg(fgPB.=|T5`Bt`>p0*:r0Ѐ"|LqgB`B Bfg P=|0@J&fF` |SB00p0*,r2**&.*BHH"|݀ qN` |S0Jng Sn j&R&CSj*f`N4 Bg,p0@60H"|$q0*>Hr€f`||JfB9"`NVH0. H"|$qj>*>gF0. 9R4gBp//.NNPO`*6g.T/.N"XOj>LN^Nu*>gB0. 9R4gp.p//.NPO`*6gH"|TI0H"|Gx`& SJf` 0B. yTNp`NVH$y@| j09 9 Ђ 0c`L R9 HH./9 NXO$`& 9 Ђr 6ye"p0.NJf LN^Nu 9 r @6 yO2APP yO 09 @6 <r2./NXO$.p0"|AHP`F 9 r (` Ѐ"|@1gR 9 Ђr ⨸e./9 /9 NPOJg չ չ  J9 fJ g`vNqNVNJg4. 09 4H@H/09 4H"瀐"| qNXON^NuNVN*f&Jf6./*NRXOJf &j UQVQg.N L N^Nu J`NVH. /.NpXO$@./. NXO @ LN^NuNVH$n.N LN^NuNVH$n.N LN^NuNVH<|$.&. (. @:0"|E  Ggn, Gg> Gg Gfp-y n.Np*@ gB9 H3 p.Hn/NPOJf@0.H# T @# # 9 "*8㉰e `p.Hn/NPOJf0.ڰEfpAC 0p5j5jB40*Jg.09 4H@H.09 4H"瀐"| qNN^NuNVNJg.09 4H@H.09 4H"瀐"| qNN^NuNVNHJg>././. 09 4H@H/09 4H"瀐"| qNO N^NuNVJ 0f  ` y 00"y ig pN^Nup`NqNV yT`NNFN N^NuNVH$|TNO $p.//<TNPOJg ` ` p`rNVHt`.0"|B0,"|FA2HA0RB Bmt`00"|30"|A"|պ 00"|810"|30"|810"|30"|B0"|01r2(0"|#v`60(0H"|B0(0H"|BRgTnrgr f *P2* Hr2* HЁ%@LN^Nut(`t)`t'`t!`R *mt BJg$.p /NN |,`p./<NNXO9Gf.BNbXO5|A"|պ 0GpB*%|0905j5jB409r2%A8v`0HC4B0HC4BRC Cm9Gg .pNj .NV .L y4gg.` g.NAV`f.6` * f* gj A .NV`px.B/<gNbhPO* g 9Td oN,LN^NuNVH$|T< . lgF lfrp.Hn/.NPOJfN5n 0.H%@0.H%@LN^Nu=j =j =jp./.HnNPOJg ` `NVH$nLN^NuNVN^NuNVN^NuNVN^NuNVp#.԰/<T/ 9&S//<.NlON^NuNVH $n ,BN@@3Tg`p.N B /N XO&@ f `.N ppLN^Nu(k UQVQfN L,AC 00*@5@ 5@B40,%@8v`:0HC.10HC4#0C.HTNXO.0HC4#RC Cm(,`.N  @f J,g .NAV*g0%l 0.NJgJ,g .HR/NPO p`)y %l 0./+NXO.N`NVH .r$p& "|pf Jf9Tqg L N^Nu9Gcg pG`N .NJfJgp   fNX `pfJyTg . @g  `.g |Tt` |Tl$H Ѐp稁R`rNVH<<$n $.vpgH f\`>0HЀ"ЀЁ"j0Bq0HЀ"ЀЁ"j0Bq0HЀ"ЀЁ"j0B1RCj*ev` j,B00RCj(evJgv. ./NTXO*@ g./-N`XOJf(m&LI0+t4PKj*d80HЀ"ЀЁ"j0Jqf0HЀ"ЀЁJqgRC`pL<Jg8."NAVp`NVH  .r$.g |Tt` |Tl$H "| Ѐpr®F@R HЀ"|TlJqf HЀ"|TtJqg L N^Nu.G/.NXOpfNX`NVH97f(t`0H@ .N"^RB Bm.ANAVp4LN^NuNVH<|$n0*Hr(0*Hr& "|K f^ HC4$1g>-gyG0+ yGb RyGByG 9Gg0+ @g. @gb @g @f&p09Gr `p09G` p09G$չG ЀѹG3GGJyGg$pL N^Nup09G`p09G`JyGg@p09G. */09GHr/09GHr//<NAVO *G%@$B*"p`zNVJGlfBNpN^Nup`NVNNNN.BNbXON^NuNV . R@D@=@ .Ѐ@r2 |MB0 .@?r2 |M@B0J.f"Lh3LhJ0.@@@`xyLh3LhJ0.@@3Fp0.6Jm *m6 *f *g%j$.N L<|N^Nu|"`B %y(  @f9Gf9Gf2N>NryG;|p<./</<VNbhPOp./<NXOGyGN |-@`p./<NNXO9Gf9Gg .cN,9GfBNfG 2*Hf4Jf.*f&G.NVp.HRNXO.BN`yGB /NXO-@yGJf -|09`" n h-h 9Gf .N ydgN9GfVp.N` 9Gf@.N ,"@r29Fg .Ѐ@r2 |MB0 .@?r2 |M@B00.@@3FPT|N^NuNVJ9T|fpN^NuB9T|=yF3FB9M0.`NV 9T g$ 9Gg.T/<NAVXOpN^Nup`NqNVH <$. ,"|F$q "|GfA4"|G""""BGJyGf .N,G*g9THx9TH`69G89G:9G+gp`pG g03G.?9GBg?Bg?Bg?BgNOL 5@@*g5j4|B`6*g5j4`& *r 5@4*gB*B`|B *%@8.HUHSHRN O `TNVH< $n&n (n$.N d&J fJ'y 'J 'JBJGlf#Gl` yGp!K#GpN.N L< N^Nu*k `Fp0-rfPN L-@3 TJ9 f$p.B/<hNbhPO `N` .N Jl0n . yN`T yN&@ gDp f+=fJSf.Jk f&Jo*HHS"|$qg"HH.HSN2XO` .f yN.HH.HSNXO.N`NVH$n*6gR.*>g g*6g$p.HR j.NXO` fp.HR j.NXO gB gp./.N9@XON^NuN D=@ y("n)f23N:By yB( yB y|0n.N nB( nh n h0 n(   ?g n(?g@p. n0h@/NXO nBh@9& nh>p./.N9@XO nh>`, n h 0J9gJyf nN D=@.NJ n h0@ n h0@ nB( n| 0n.N `NVH$n*09`.1HRNXOp9r2fp2.NdLN^NuNVH$nJ*0g$ j0@S*0J*0f3xLN^NuJyxg j0@N(ByxJ*1g j0S*1`J*f$ j0@p*F9.NV`|0|1S*`NVp0. @HЀ"|KB1p0. "|KB1NH$y&j*HHrb^@0; NJ >Zj~@|+/g <` <@"k2 k0|`: kBPBy|LN^Nu|3`3|B*`p09 r3fZp09 r fp ` 9 g6p .N|B*(j,?fA .NV?`np`R* *xo\.N`Rp09 rg@|`6p09 rg .N`|`9g90g0+ F@3`.NN3$|`p09 rf9fp09rf3 y|`NVH$^NuNV np(Ѐ"|F01@ 0=@=|(g n n p0..Np.Ndp0..Nlp.NdN^NuNVB/.NXO nr2( .Nd n h0@p.Nd n h0N^NuNVH$n 9g9ܰ*g pLN^Nu.Np`NVH$n3I3 I j0.N" j0@ j0@Jyf| LN^NuNVH $n&j( jBP3p0+:r.Nvp0+:.N  nf y|L N^Nut`$p.Nd9g 90f 0V@4 Be Bdr0* F@3`p(.Nd.N3y*?@ j0 . e` y30 . f yBf3 j.AH0Lh3LhJLN^Nu. y3 `NVH4. 0@06 C0fx ` C fx ` Cfx`xgRDgRD D cHx 9p0r"|19B@93@B@93PLN^Nu Ddx`NVH$y&y(kJyMf NYRyMN X(8N:8.N*8p@H888.N LN^NuNVH $n&y(k0*:t4*6f*6g .`9.8+HH@H&$t`p09rf`00V@4 B,d$p.Ndp09 rf9g B,e  `F3 y|?`(NVH$n|Jyf.N LN^Nu. N`NVH$yzBBjBjB*B*Bj np(5@ %n LN^NuNVH$n.Nj|`.1/( NXO yzJhg yz0(j0*g|pLN^Nu|p`NVH $|^&y09E@4@Hrb6@0; NJ>2+R+JggR+`R+L N^NuggR+`R+gC fCgC `C @H88vgvp0JgrgXr gXr0fC.N< @H88CH &C+HH@H @H8L N^NuC`C@`NVJ9g(9g .^NZ9g .ِNFN^NuNVJ9gpfNJ9gNpf yJ(gNNNJ9gR9 9f B9N&J9g S9fNN^Nu 9cN`NV.LNdL.҄NeN^NuNVH yxg3xt l&R`ByxL N^NuNqf`+R++eJ+gJ+f +fLB+j`"9f6J+f0J*f*|g*/gp./*$NPXO9p@@@`DNVH$ng */g.NLN^Nu.N` 9f.NJ* f | B*`| `NVH $n$. J*g * e<* p09E@ p* AHg, * g * fB*L N^NuJ*f| ` * f B*.N*/gg * g.N`B*`*/g * fJ9g*R* cB*.N`rNVH$n9ܰ*fEPJR ,KԶ0jPP d,dK d,dK 1(Korw&לnnvByI.N:LN^NuNVH$n y(*f.NLN^NuNVH$n y(*f| yBNPLN^NuNVH$nR* *eJ*f|*/gNFLN^NuB*`NVH $n*gN y(*g$ yfl y yjJ* f p0*`p.N`:9ܰ*g f(9*f.Nl yfB*`J* f| B*0*@`| 0*@5@p./*$NPXOL N^NuNVH$n j0@ j0@ j0B*B*3N: yB(LN^NuNVp0&b\0DefltWIND?(6x5@WIN1D?(6x;dCFDP<t    K.~GGGJ   @q@I I`I@%x, BSR0 = %x, BSR1 = %x PHYSPF = %x D0=%x, D1=%x, D2=%x, D3=%x D4=%x, D5=%x, D6=%x, D7=%x A0=%x, A1=%x, A2=%x, A3=%x A4=%x, A5=%x, A6=%x, A7=%x (2h688&:<4:=L)N Jt>NOB7B@=LEHJKrJR@R@RERE~?L(LzPT(L4(AQQ}pKKO(SDl((t(*qPI0IpIPjjjjjjjjjjjjRjjjjjh88 2^24 iaddress > 2^24  Version %s Real memory = %d Available memory = %d Main board is %sP5.1P3...PcdZdhZZZZZtZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ@d_stropend_strclosed_stropend_strwrited_strioctld_strsched#@##$0&."jZZZZ5sendsig bad usp: %x no memorykernel too largetuning parameters exceed system limituse the what to get slist ID0123456789ABCDEF Double panic: %s panic: %s Please record panic message. Press hardware reset to reboot. %s on bad dev %o(8) Bad address at %x, from %x, count %d  coresleepwakeupproc on q setrunno procsxfree rssize#out of textxalloctext rssizelost text/lib/shlibvsexpand1vsexpandvmdrum NDMAPvsxallocvsswap hptevschunk: uneZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ 'nofile'=%d. reduced: &u+1=%xx, u.u_pofile+nofile=%xx>%xx) Floppy Unix Please insert Floppy File System disk - disk 3 of 12 Press any key when ready Floppy File System disk 3 of 12 isn't ready - reinsert and close door. Press any key to retry iinitiinitxpected page type %d vstodbvstodb *ipvrelvm rssvinifod filenowvinit: kernel vm swap spaceswapoutswapout rssizeswapoutvmemall sizedup mem allocbad mem allocmemall intrans|wantbad mem freedup mem freeMemory frames %d to %d omitted meminitdup page unlockvsmap:page not validgdsetmap: Memory request too large gdsetmap: v=%x, mpte=%x, *mpte=%x, b_flags=%x b_paddr=%x,%x gdsetmap:Invalid pagevadmapvmsetvalprotectionpageinpagein: pg_page: Bad System disk! bswinitpanic trap vector %D traprepeated addr erroraddr fault in kernelrepeated bus errorNo swap space for stack expansionpage fault in kernelUnknown Bus Errorrepeated NMI error#NMI (parity error in unmapped page) at 0x%x (*hpte: 0x%x)#NMI (parity error) at 0x%x (*hpte: 0x%x) *hpte: 0x%x NMI (kernel parity error)NMI (DMA page fault)#Spurious NMI (ignored)*** TRAP: out1: signal pending: u.u_ar0 = 0x%x *** type = 0x%x, pid = %d, pc = 0x%x, rps = 0x%x, p = 0x%x GSR = opagein: nonzero pfnumpagein pg_filenopagein PG_FTEXTpagein PG_LTEXT u.u_ofile[%d]==%x @ %x pagein u.u_ofilepagein pfnumvmpagout fod1bad c_page[DP %d %x]large cleanupcleanup 0 pfnumcleanup CSYSxptohptegethpte*XIN %dvgetupteexpand shrink ss.|T/</<Jg/</<NPN/</<N P/NN /<W /N4P/</<NP`/etc/init/dev/console/bin/sh-shNq0<)N@dNDNuNqNVA -H`X nJfpѮ n.Hn /.NPON^NuNqN   Vp.N N^NuNq0<'N@Nu0<;N@ND0<N@dNDNuNq0<6N@dNDNu#~p |NuTrmalloc%s: rmap ovflo, lost [%d,%d] bad rmfreedevtabIO err in pushswap: odd upage transferbig pageoutproc 2 swappinghard IO err in swapbflush: bad free list :S:D::pid %d: killed due to no swap space#pid %d: killed on swap error({)}!|^~'`\<<<<<<xx((<<PPPPP@luUUvVVz aJJUVV9BBHMM0NN[{\|]}`~aAbBcCdDeEfFgGhHiI jJ kK lL mM nNoOpPqQrRsStTuUvVwWxXyYzZ|`{}~ABCDEFGHIJKLMNOPQRSTUVWXYZ%s --More--\@ ?@GOf:S:D::Parallel printer not connected:S:D::Parallel printer paper out:S:D::Parallel printer errorswap|*`{gdstrategy: DMA controller busy:S:D::The preeEE*,/254[ONPbad keymapTtUUUUUUUUUUUUUUUU\T2zX$nHlBBvious operation on this floppy disk was incomplete. Please run Floppy Disk Repair or remove all files and reformat the floppy disk.:S:D::Bad block table overflow:S:D::Mounted floppy disk removedgdstrategy: DMA controller in use#FD:Spurious interrupt#HD:Spurious interrupt#FDERR:timeoutDrive: %d, cmd: %d Hard disk timeout#drv:%d part:%d blk:%d rpts:%d#baddma:%xFloppy disk zero transferInvalid floppy disk command#FDERR ST:%x TR:%x SR:%x DR:%x DMACNT:%x DCRREG:%x MCRREG:%x:S:D::Floppy disk no((L$zZ??Tx~ 0              &  0 :  :  F R T Z Z T  P  \  f  p  z          t inserted or door open:S:D::Unrecoverable floppy disk error:P:D::Please re-insert the floppy disk and close the disk drive door. Always close the floppy disk folder before removing the disk.gfpwrite: F_HD_DMA setgfpwrite: cannot verify write to WD2797gfpread: F_HD_DMA setHard disk zero transferFormat hard drive other than 1 ghdintr: F_FD_DMA set#HDERR ST:%x EF:%x CL:%x CH:%x SN:%x SC:%x SDH:%x DMACNT:%x DCRREG:%x MCRREG:%x:S:D::Unrecoverable hard disk errorHard disk invalid sector sizeInvalid h                         $  .  8  B  L  V  `  j  t  ~                                    $  ( 2  6 @  H  R  \  j  t ~           ard disk commandATTaAAbBBkKKgGGwWW ZZ BSShHH DKKCLLnNNoOOcCCrRRdDDcdefghij sSStTTxXXyYYfFF'"iIIjJJmMM,<-_k.>/?0)j1!a2@b3#c4$d5%e6^f7&g8*h9(i;:=+          """""">k >hk>i6l`33[3c   ""00 >ccskgcc>  ?>cc`0>c``<``c>`pXlfc``?```c>8 ?ccc>``0 >ccc>ccc>>ccc~`00  0     0 >cc0!9%%%y6cccccc333?ccc?>cccc>3ccccc3???>ccscc^cccccccc`````ccc>c33c?Acwkkkccccgm[scccc>ccccccc>?cccc?>ccccco;>`?ccc?3c>cc0cc>cccccccc>cccccc6ccckkwcAccc66cccf<e2 6Byte1 4Word2 DWord1 BLong2 RLong1 PPP1 nPP2 ppanicmssetmap QQ56 QQ1 QQ10 QQ11 QQ12 QQ15 0pclr QQ16 6QQ17 \QQ19 QQ18 pclrlo pclrhi pclr30 testpe QQ21 QQ23 QQ22 QQ24 `0  006c >`~cc;gccc?>cc>```~cccsn>cc><f?~ccsn`c>;gcccc00<000003c33c7kkkkk;gcccc>cccc>;gccc?~cccsn``7nf>c8c>?f<ccccsnccc6cckkwcc66ccccc6 ? 8  8 QQ25 *setfhole QQ29 VQQ26 DQQ27 NQQ2 trapend , "badint $perend *RR2 LRR3 LRRR1 tRR5 pernext noint SL1SS1$SS3TSS2RTL1TT1TT4TT2TT3usuccessufailuwhilep 8 sUNIXUNIXPCSYSTEM53.51mc68k@(#) uts:uts.sl 1.221 .text.datat.bss0.textu.datat(.bss0AA1AA2"AA3@AA5tAA4rAA6zBB1BB2BB3ZZ1p3stat`exstat`",fifojoinSR1SR2SR3srjoinRX9@notixonvstdx^xonseen8xoffseen RX3RX1RX2goawayxoncnt|ST1ST9ST2ST3ST4ST5ST6CC1CC2CC3CC6:CC4CC56CC7@DD1|DD3DD2EE1EE4PEE2EE3Loptimloptimwbyte2byte1word2word1long2long1YY1L13spin2spin1looplloop$ ST7ST8TX16TX9RTX3lnoldatnodtak1k4k2k3nostk`k10k40Zk20Hk30Nul1rul4ul2ul3nokvv1v4v2v3:ԔNN101:NN102Flok*KK100XKL2KK1zKK3KK5KK4KK6MM0ML2MM1 MM2MM34OO0NOL2xOO1nOO2xOO3OO6OO4OO5OO7L1L2L3L4 Optiml JOptimw <BytNN1pDtextdonej1xj3nolibsetlibsetlibtlibdoneclrlibnodata:j42nofill`j7Zs2nofill2j2nodata2j8.filegconf.c.text .dataԜ.bss0.fileglinesw.   c.textL.datal$@.bss0.filegmain.c.textL.dataސ,.bss0.filegtrap.c.text< .data߼x.bss0.filegsysent.c.text).data4Vrwrite~.filesgnami.c.text C.data.bss.file{gpipe.c.text.data.bss.filegprf.c.textt.data.bss.filegrdwri.c.text .bss0.filegsys1.c.text)$ .data<.bss0.file gsys2.c.text8x.dataX.bss0.filegsys3.c.text@ q.dataX.bss0.filegsys4.c.textX.data(.bss.texth.data.bsscommon.filegsig.c.textx.data.bss.filegslp.c.textk.data(.bss.fileJt |.dataX.bss0.file"gacct.c.textS?.dataX.bss0.file*galloc.c.textV|E.dataX@.bss4`.file2gclock.c.text]X`.data<.bssgsubr.c.text%.data.bss.filegutssys.c.textt$ .data.bss.filegcopy.c.text.data.bss.filegtext.c.text8:.data.file:gdrv.c.texte }.data .bss.fileBgfio.c.textpE.data .bss.fileJgiget.c.textv;.data@.bss.fileRglock.c.text}p8.bss.filegshlib.c.texth4.dataL.bss.filegvmdrum.c.text( T3.data\l.bss.filegvmproc.c.text| @.data.bss.filegvmsched.data@.bss.fileZgmachdep.c.text~ .data@.bss.filebgflock.c.text ,.data.bss.filekglocsys.c.textld(.data .bss.c.textלlu.data .bss.filegvmsubr.c.text,.data,.bss.filegvmswap.c.text4(9.data((.bss.filegvmmem.c.text\t.dataP$    .bss.filegvmpage.c.text.datat.bss.file gvmpt.c.text g.datal8.bss.filegic.c.textl.dataX.bss.filegrmap.c.textpintr|*.fileggdfp.c.textt.data.bss.fileggdhd.c.text0|.data.bss.fileqgkbd.c.text4 PY.data.bss.textH.dataD4Tl.data4.bss.file"gbio.c.textp.data0.bss.file*gtt1.c.text#@.data .bss.file2gtty.c.text3 @0.data.bss.bssXOpTableRastErrBOpTabletbm6xVRastRetForwardBackward NoSrcTXX1Rast18XX2(NotFastFastZZ1ZZ3ZZ2FFZ1 FFZ42FFZ30FFZ2*BFZ1R.file:gclist.c.text.data.bsserrptr.fileKgconsole.c.textBt_.data  .bss.fileVgi8274.c.teBFZ4|BFZ3zBFZ2tR11R12R14R13R21R24@R25:R31\R32R34R33R41R42R446R43 R51TR52xR54R53R61R62R64R63R712R74fR73xtK.data,4.bssNLser_xonTser_xoffV.file^gmem.c.text^0$6.data`.bss.filefgsys.c.textaTL.data`.bss.filengpartab.c.textb\R81R82R84R83R91R92"R94\R93FR101zR102R104R103R111R112R114:R113&R121XR124R123R131R132R134R133R141$R142HR144R143lR151.data`.bss.filevglp.c.textbI.datat.bss.file~gsw.c.texti h.dataT.bss.fileggd.c.texti .data\.bsslR152R154R153R161R162*R164XR163DR171nR174R173R181R182R184R183R191R192>R194pR193ZR201R202R204R203R211R212R2140R213R221HR224vR223   jR231R232R234R233R241R242 R244TR243<R251lR252R254R253R261R262R264"R263R271BR272fR274R273R281R282R284"R283 R291BR292fR294R293start tvectorsaldivulmul\almulalremauldivJaulmulaulrembcopyZsaveresumesetjmplongjmppdelay ldelay sdelay:ldivfldiv__Flmullmul__lremZlrem__<minmaximinimaxmclear R301R302R304R303R311(R312LR314R313rR321R322R324R323R331(R332LR334R333rR341R342R344R343R351R3522R354nR353XR361R362R364R363R37mcount Xcntbasetop1Ԁbase2Ԅtop2Ԉfholetfholesz|upglbolttimemainLvidinitGdbmainB traprunrunqrunflagsi_schedidleflagclock]XDrv_Int6eprintfAVcommon 6splhi Lspl7 Dspl61R3722R374nR373XR381R382R384R383R391R392R3946R393 R401LR402pR404R403R411R412R414R413R421$R4222R424bR423LR431zR432R434R433R441 Lspl5 Xspl4 dspl3 pspl2 |spl1 spl0 splx eretDbaduio ffault߼uldiv uldiv__ ulremulrem__beginuioenduiofuwordfubyte suwordsuiword&subyte4useraccHserrintSTsertintYserxintTinptroutptrR442R444BR443*R451ZR452~R454R453.fileygph.c.text p.datax.bss.filegphsub.c.text.datax@.bss.filegsysfont.c.textt.data"&(serixon.sercd*sercts,serbpend2bserbuf4eserbuf8rx8274tx82740st8274sr8274ser_addrrevlevBnulldevjtab8274Ap2lpinttx8274ast8274arx8274asr8274altx8274bst8274brx8274bxsr8274bserix 0.bss.filegname.c.textt.data0.bss.filegid.c.textt.data.bssSCCS_IDUSIGN,T_etextt_edata0_endTfault CDTttickint perint Int8274Aany0 ~ptemutlcurrentulkv_pagestkv_mptecmapusrcorechunk1ԘprevsizeԌ Ԑloadmapmutlsl_mptesl_tbaseLupageu tmputl1 tmputl20dmamutlsdmamutlmmvadswp1utl@swp2utl`forkputlcleanutlpgutlforkutl   umutlupgutlacctbufacctp*4 0swbuf 8swpf hswsize nswbufԜbswlist bclnlist hbuf flckinfoԠflox swapmap.nswapmap԰mount0errbuf1(err_cntԴsysinfo5(syswait5syserr5>ԶipcnosysipcnullipcfuncIconwriteHconioctlIsyopenaTsyreadasywriteasyioctlbmmread^0mmwrite_gdread}bgdwrite}gdioctljberrread@<errwrite?dlpopenclpclosedlpwritedlpioctlhphopenphclosetphreadphwritephioctlbdevcntcdevcnt rootdevpipedevswapdevswdevtswploSpanic,^hs~0si_opensi_closesi_readsi_writesi_ioctlsi_tracetulotuhideftuhi"v2init_tbl~slotinitorinoinitwcinitbinit&לclkstartgdinitnnfinitvpiinit0flckinitbswinit&lpinitb"nswap&lineswlttopen#@ttclose#ttread#ttwrite$ttioctl0ttin&ttout."linecntތavefreeLD4LHdeficitLLnscanLPdesscanLTrootdirLXmaxmemL\physmemL`sbufLdetcinitސpreinitޔ>ޘprintftchipinitmcr_saveLhstartup~procLlshminitwvinitinitkbd\0prfintrDprfstat5gdhdbbq5gdsybbq;dgdhdbb@gdsybbCպgdswghdintr6ghdstartgfpintrgfpstarttgdutabFgdtabG`gdrealGgd_cntsertty0sermod0ser_tty.pser_ttyserbufGnttyhogserxoff$<ser_cntDDmsginitseminitigetvmpidLpnewprocpageoutsleepszicodeexpandVH(icodecopyoutscheddgetcharGgeteblkreadi clksetRLtnswdevLswfreeiPcfreeLbufLbuffersLbrelsepbufL\<sl_lsizeLsl_textLnosysTMFpadFphndef^moddefdnwdefmdptrdnptrtelelinetelestatmsgstatldmisckbinitkhighmscoordRslotsJDrv_tblK Drv_max4dskdrvhkbddrvdlpoolNmaxdlRpxmemTXfontmem\fmemsize`wtxtdaltvmemholheaplol_cnt(showbus(swkill"pageinrvtopte0fvtohpte @s8sysent4JTpsignalPissigkpflgpsigsetrqswtchaddupccurpriLrexit2hfork6read8write8&open:close<wait4creat:link=unlinkLexec)pkv_swapL@nofilexnofilmax|ڀnodevZڄڈڌڐnullsys(ڔnetbusyږژڜڠbdevswڤgdopens(gdclosevZ)wBcdevswseropenKsercloseM\serreadNserwriteNRserioctlNconopenGconcloseHconreadHchdirN gtimeJtmknod>chmodNchownOBsbreak7Bstat@seek=getpidLsmountEsumountHsetuidJgetuidKrstimeJptracealarmRfstat@pauseR@utimeRsttyERgttyE~saccess?niceLsyncLzkillPTsetpgrpL4dupApipetim   esQprofilQlock}psetgidKgetgidKssigOmsgsyssysacctSshmsyssemsysioctlDlutssystexece*umaskRXchrootNfcntlB8ulimitSRlockinglocsyslino_open@ngethead,Bvmemall\vadallocgetxfile.setregs1vadfreeumapinplvmemfree&iputxk~*datalock~|proclock~dunlock~tunlock~NnofaultOOfmodem@freememOexpect0D OOmmpteOupteOptetmp1Optetmp2Opteswp1Opteswp2OpteforkO#OptepgutlOtextOutsnamememinitsendsigourgcrOidleinit8274l/ucharnameiaccesst<shloadfileLchksizejshmexecpunlock~vrelvmvgetvm|xallocxvinifodshlinkȎclosefpexit2signalplocksemexitshmexitacctTvrelumultprognoprocLsetrun8freeproc5fsigvsexpandɮrdwr8<g:hpgtocmtblallocncmapOcmtopgvalidpgfrlockOFOinsflck^delflckregflckflckadjblockedconvofffdeadflckrebootrtc_read&gdquietscharbmapprintn.putcharBdsabldbgerrdump@breadaiomovebawriteshmforksetupetfpreclockprele@writeicopen:maknode|fallocuitrunc{RopenirLsuseruiupdatywdir}"vrdwr@Nstat1AbreadpufallocurlfcntlCcopyingetmdevIxumount*update\inodeLbinval"^JdxrelezchdirecN8ownerucompressshmPipcbusyipcOstoprprocxmtcoreipcreg[slpqueOrunoutPrunqPhPunsleepremrqwantinPdesfreesprocdup6cpass copyseg xfreexlockVxunlink\vsxfree*xccdecþxwait2xlink&vsxallocrV0allocV|freeWgetfs[badblockXwakeupVprdevdelaydgetblk clrbufbwriteiallocYifree[2bflushFscan_aryavenrunLpgilastLpgolastLpgirateLpgorateLtimeidLtimeoutbhpanicstrLcalloutMtimeinc|setpri4dbctlbxunlockÐvsswap̸swapxuntextźvinitpt sl_dsizeP~|rmallocrmfree$vschunk΄xptohptemwaitvstodb4vtodZpinforkZQvmdup֦vgetu munlockmaxslpsaferssmaxpgiominfreelotsfreenbigbigpQbplser_scanMfserscanMserscanYruninMvmpagoިvmmeterݸcdLdeeZk_mpteMdrvallocedrvbindi>set_intnecmapMmapinp clearseg\clr_intogetslotorclosepJopenphinodeMOireadx2bdwritetloop|textlocistQ|swapoutswapin4uaccessptetov\vadinit(,memall vrelswuLmap(vgetswuxtotfreeQneedumemQmunlink8distpte 4memfreehandQmlockvsmapNvsunmapvsfreegdsetmap0vadmapQrminitlgethpte incorecleanupresetpte   8vusize iowaitiodone physiophysck!baddr"canon:4getcb>putcf>ngetc"ttxput*<putc<putcb?ttyflush9@tttimeo0sputc=jpartab`ttrstrt<ttlowat<gettty2XttnulqR8ttywait8ttcchar|canonbRDmaptabtkeymapkprefixklow4msinfokstatekeyoldkeynewknumlockkcaplockkshiftkctrl kreptkbdTTktimeTscrticksTscrsav"mscan kscan killreptkupdnkxlatDkoutkrepthkplunkkwakeupNsyspatDpatwhitetpatbltiocom3ttinit8SDerr_puterr_geteputcharBdbkbufSHdbkput dbkgetdbuseconuseconxconlinesEwsysfontrastopgetcharG$conttyShcononceconprocI:conmiscJJconoutIconansiJ4consvScgetttyK&ackTpatgrayFSrcSrcFPatSrcFAndSrc\FOrSrcFXorSrcTFSrcAndFPatAnd2FAndAndFOrAndFXorAndzFSrcOrFPatOrXFAndOrFOrOr$FXorOrFSrcXorFPatXornFAndXorFOrXorFXorXorFSrcCandFPatCandHFAndCandFOrCandFXorCandlBSrcSrcBAndSrcB,fserlockScsizevalXser_workSTT TT(T3T>KsergetcK^serprocUserparamPsermodemXsetrtsP(HZclksel]sersend[serxsend[|sendhup[R\d\]Bsycheckbblp_addrlp_dtT<lpdrvlpintrfsplpT`BOrSrcBXorSrcBBSrcAndBAndAnd(BOrAndBXorAnd(BSrcOrBAndOrBOrOrBXorOrBSrcXorBAndXorBOrXorLBXorXorBSrcCand$BAndCandzBOrCandBXorCandZ4FFastBFastNFZerSrcgetmodemTmodparamˀphinit"8hangupfmslpstartblppushfhc,lpcheckglpoutputelpflushd`rTd}i swreadi8swwritei@vswaponiHftintexpThgdopflgTlgdmflgTtdcr_saveTzdma_flagT|dmacntTrqTgdtim\gdqrdblkigdrdblkigdcsumpgdformatjgdspecj>pXgdbiurstgfpchkgdnsecgwaitgetresrcpmsgwaitȖr)Š3 =Jholdline\WbƒlwpreflineSCM4WSCM5WsetchipH˸extpulsexcallprogTpcallzmsgdetc~mdcharszoffcondoncondholdcondfpulsep6dfselect>gfpwritebgfpreadgdwrprotTsgdtimer~.gdfprmvdvgddoxfrzxdfmtronrgdstart{`lpdummy`gdlpintr{gdintr|Bkilldmagdendit(dfmtroffdsetheadsetdmadfresetdhresetchkdma2fpstatTfponcef`dhselectbeepcntcmsgwaitpulsephTbeepbeeponbeepoffHsetstathnlineringʔpulseswpulse6XsetbaudϒPmsgwaitring6$f-͚   7JchkpulseLchkscan҄sysfontetexttedata0endTAtrapagainfuregbytesuregbytewrite_eoiExtraneousIntprevlsizeendoftextcsizemaskpatltgrayFstMaskTabLstMaskTabReverseMaskSlowForwardSlowBackwardinit_machreturnfromintqueueflagStray_fmtserbufcntserinprogressserinxoffsertxblkdserbuffulPortBStatusunloadmapprevtxtptrprevssizebfreelistpfreelistipcdefaultd_stropend_strclosed_strreadd_strwrited_strioctld_strschedsetupclockgddefaultgdourunflgser_portsfcallprogpxmemsizesock_writesock_readsock_ioctlsock_closesock_semasoftnetintnet_mbsizenet_tcpdebugvt_defcntgdstrategyavefree30iinitdoneswpexpandcfreelistvalidaddrvmsetvalprotsizeofsysentstereintrffreeliststerenxiopulse_aryclocknestinguntimeoutadd_hi_scanrm_hi_scanadd_lo_scanrm_lo_scancleanlocksifreelistmcr2_saveptedmamutlptesdmamutlptecleanutlinitphscanwritedialersleeplcksfreeshmsegsizeofipcregcurmapprocgetcontextupdat/< N1X OQ./HJf/H#0N/dev/null | grep Partition` if [ $? != 0 ] then dismount -f > /dev/null 2>&1 clear message -cu "Cannot backup to the floppy disk. Possible reasons include: disk has silver write-protect tab on it (remove tab); the floppy is not formatted; disk is not inserted or is inserted improperly; latchbin/Funlock.sh if [ $? != 0 ] then message -u "$ERRINUSE" exit fi fi ## CHECK THAT THE FLOPPY IS NOT MOUNTED. DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu "$ERROR4" exit fi while true do RET=`shform -u $UA/Backup.menu` if [ $? != 0 ] then clear message -u "$ERROR1" exit fi set $RET if [ "$1" = "'Cancel'" ] then exit elif [ "$1" = "'Enter'" ] then break elif [ "$1" = "'Help'" ] then HELP="Backup" case "$2" in "'Complete" ) HE is not closed. Please check the floppy disk." if [ $? != 0 ] ; then exit ; fi else set $FLOP ; FLOP1=$1 if [ $FLOP1 != Partition ] then clear message -cu "Floppy is not formatted. Please use a formatted floppy disk and try again." if [ $? != 0 ] ; then exit; fi else break fi fi done # use find with -newer option if [ "$RET2" = "one" ] then NEWER= else # set up for an incremental update # assumption: date IN the file is the same as date OF the file NEWER="-newer $filename" fi clLP="Complete Backup" ;; "'Partial" ) HELP="Partial Backup" ;; "'Backup" ) HELP="User Backup" ;; esac /usr/bin/uahelp -h $UA/admin.hlp -t "$HELP" clear fi done shift RET1=$1 RET2=$2 RET3=$3 if [ \( "$RET1" = "'Complete" \) -o \( ! -s /etc/.lastbackup \) ] then filename=/etc/.installdate file2=/etc/.lastbackup else filename=/etc/.lastbackup file2=/etc/.lastpartial fi if [ "$RET3" != "user'" ] then DIR=/ else cp $UA/Backuser.menu /tmp/umenu$$ pwdmenu >> /tmp/umenu$$ while truear newwind clear echo " \n\n\n\n\n\n Backup in progress\n\n\n" echo "$$ Backup.sh" > $LOCKFILE trap "" 2 find $DIR $NEWER -print | cpio -oBc > /dev/rfp021 2>/tmp/cplog$$ if [ $? != 0 ] then trap 2 dismount -f > /dev/null 2>&1 clear message -cu "$ERRORWRITE" if [ $? != 0 ] ; then break; fi else trap 2 clear message -cu "Do you wish to check the information that was written on the floppy disk(s)?" CONFIRM=$? if [ $CONFIRM = 0 ] then clear message -iu "Please inserte do clear URET=`shform -u /tmp/umenu$$` if [ $? != 0 ] then clear message -u "$ERROR2" rm /tmp/umenu$$ exit fi set $URET if [ "$1" = "'Cancel'" ] then rm /tmp/umenu$$ exit elif [ "$1" = "'Enter'" ] then break elif [ "$1" = "'Help'" ] then /usr/bin/uahelp -h $UA/admin.hlp -t "Backup" fi done rm /tmp/umenu$$ eval USER=$2 DIR=`pwdlogdir $USER` fi while true do clear if [ \( "$DIR" = "/" \) -a \( "$filename" = "/etc/.installdate" \) ] then set `df the first disk from this backup.\n\n Touch ENTER to continue." clear newwind echo "\n\n\n\n\ Checking data written to the floppy disk\n\n" cpio -ictB < /dev/rfp021 > /dev/null 2>&1 if [ $? = 0 ] then echo "\n\n\ Data written to the floppy disk is readable." sleep 3 else dismount -f > /dev/null 2>&1 clear message -cu "$ERRORWRITE" if [ $? != 0 ] ; then break; fi fi fi if [ \( "$NEWER" = "-newer /etc/.lastbackup" \) -a \( $DIR = "/" \) -a \( -s /etc   /.lastbackup \) ] then set `cat -s /etc/.lastbackup` clear message -iu "The partial backup of the files which have changed since the last complete backup, on $2 $3, is now finished. In order to restore the system totally, \ first restore the last complete backup, and then restore the partial backup which you just finished.\n\n Please touch Enter to continue." else clear message -iu "Backup is now complete.\n\n Please touch Enter to continue." fi if [ "$DIR" = "/" ] then date > $file2 f-------------------------------- ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." TERMCAP= export TERMCAP umask 022 DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi GO=1 while [ "$GO" = 1 ] do GO=0 ## wfc creates iti # setup Backup.menu with last backup dates BDATE=`cat -s /etc/.lastbackup` UDATE=`cat -s /etc/.lastpartial` if [ -z "$BDATE" ] then COM="has not been done yet." PAR="has not been done yet." set `cat -s /etc/.installdate` elif [ -z "$UDATE" ] then set $BDATE COM="last done on $2 $3" PAR="has not been done yet." else set $BDATE $UDATE COM="last done on $2 $3" PAR="last done on $8 $9" fi cat > $UA/Backup.menu << END Menu = Partial Backup includes files changed since $2 $3 Labes own windows for input/output /usr/bin/wfc if [ "$?" != "0" ] then message -c "Cannot copy floppy disk. Possible reasons include: destination disk has silver write-protect tab on it (remove tab);the floppy is unformatted; a disk is not inserted or is inserted improperly; latch is not closed; or the source disk is unreadable. Please remove the floppy diskette and start over." if [ $? != "0" ] then dismount -f > /dev/null 2>&1 exit fi clear GO=1 fi done # -------------------------l = Backup Prompt =Complete Backup saves whole system, Partial Backup saves changed items. Name = Complete Backup - $COM Name = Partial Backup - $PAR Name = Backup one user END break fi done rm -f $LOCKFILE rm -f /tmp/cplog$$ # ------------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE Backup.sh # ========================================================================= 07070700000202632610075500000200000200000316221000000------------------------------------------------ # EXECUTABLE PROGRAM ENDS HERE Fcopy.sh # ========================================================================= 0707070000020263301007550000020000020000031622220000017757000002300000004341usr/bin/Fformat.sh#sccs "@(#)adminbin:Fformat.sh 1.4" # Fformat.sh # PURPOSE: Format a Floppy disk using the iv function # CALLED BY: Floppy object file in /usr/lib/ua # REQ17757000002300000001061usr/bin/Diagnos.sh#sccs "@(#)adminbin:Diagnos.sh 1.1" # Diagnos.sh # PURPOSE: Run user accessible diagnostics # ------------------------------------------------------------------------- TERMCAP= ; export TERMCAP umask 022 message -iu "Performing diagnostics will restart the machine. If you are sure, put the Diagnostic Floppy in the drive, and then use the Office Shutdown command. When the system prompts you to press RUIRED FILES: /etc/iv, /usr/lib/ua/FD files # ------------------------------------------------------------------------- ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." LOCKFILE=/tmp/FinUse.lock ERRINUSE="The floppy disk is already in use by another application. Please wait fETURN to reboot, do so, and the Diagnostic Floppy will take over.\n Hit ENTER when ready." 0707070000020263271007550000020000020000031622110000017757000002100000003017usr/bin/Fcopy.sh#sccs "@(#)adminbin:Fcopy.sh 1.5" # ------------------------------------------------------------------------- # Fcopy.sh # PURPOSE: Copy a floppy disk using the fc function # CALLED BY: Floppy object file in /usr/lib/ua # -----------------------------------------or the disk to finish before starting again." MUSTBECON="You may not format floppy disks from a remote terminal." TERMCAP= export TERMCAP umask 022 ## LIMIT FORMATTING TO CONSOLE USERS TTY=`tty` expr "$TTY" : "/dev/w." > /dev/null 2>&1 if [ $? != 0 ] then message -u "$MUSTBECON" exit 1 fi ## CHECK THAT FLOPPY IS NOT IN USE BY OTHER OPERATIONS. if [ -s $LOCKFILE ] then sh /usr/bin/Funlock.sh if [ $? != 0 ] then message -u "$ERRINUSE" exit fi fi ## CHECK THAT THE FLOPPY IS NOT MOUNTED. DE   VNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi message -cu "Please insert the floppy disk for formatting.\n\nWARNING: this will erase whatever is currently on the floppy disk!" if [ $? != "0" ] then exit fi clear echo "\n\n\n\n\n Floppy format in progress\n\n\n\n" echo "$$ Fformat.sh" > $LOCKFILE GO=1 while [ "$GO" = 1 ] do GO=0 iv -i /dev/rfp020 /usr/lib/iv/FDnl > /dev/null 2>&1 if [ "$?" != "0" ] then clear message -cu "C.\n\nWARNING: this will erase whatever is currently on the floppy disk!" if [ $? != "0" ] then exit fi clear echo "\n\n\n\n\n Floppy format in progress\n\n\n\n" echo "$$ Fformat10.sh" > $LOCKFILE GO=1 while [ "$GO" = 1 ] do GO=0 iv -i /dev/rfp020 /usr/lib/iv/FD10nl > /dev/null 2>&1 if [ "$?" != "0" ] then clear message -cu "Cannot format floppy disk. Possible reasons include: disk has silver write-protect tab on it (remove tab); disk is not inserted or is inserted improperly; latch is annot format floppy disk. Possible reasons include: disk has silver write-protect tab on it (remove tab); disk is not inserted or is inserted improperly; latch is not closed or disk is bad. Please check floppy disk." if [ $? != "0" ] then dismount -f > /dev/null 2>&1 rm -f $LOCKFILE exit fi GO=1 else mkfs /dev/rfp021 632:100 > /dev/null 2>&1 dismount -f > /dev/null 2>&1 clear message -iu "The floppy diskette is now formatted.\n\nPlease press Enter to continue." fi done rm -f $LOnot closed or disk is bad. Please check floppy disk." if [ $? != "0" ] then dismount -f > /dev/null 2>&1 rm -f $LOCKFILE exit fi GO=1 else mkfs /dev/rfp021 > /dev/null 2>&1 dismount -f > /dev/null 2>&1 clear message -iu "The floppy diskette is now formatted.\n\nPlease press Enter to continue." fi done rm -f $LOCKFILE 0707070000020263321007550000020000020000031622400000017757000002300000002257usr/bin/FlpyChk.sh#sccs "@(#)adminbin:FlpyChk.sh 1.9" #Repair Floppy Disk ERROR1="You CKFILE 0707070000020263311007550000020000020000031622300000017757000002500000004363usr/bin/Fformat10.sh#sccs "@(#)adminbin:Fformat10.sh 1.1" # Fformat10.sh # PURPOSE: Format a 10 sector/track Floppy disk using the iv function # CALLED BY: Floppy object file in /usr/lib/ua # REQUIRED FILES: /etc/iv, /usr/lib/iv/FD10 files # ------------------------------------------------------------------------- ERROR1="You have a disk mounted already!\n\nPosshave a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." TERMCAP= export TERMCAP umask 022 DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi message -cu "\nPlease insert the floppy disk for repair.\n" if [ $? != "0" ] then exit fi if ible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." LOCKFILE=/tmp/FinUse.lock ERRINUSE="The floppy disk is already in use by another application. Please wait for the disk to finish before starting again." MUSTBECON="You may not format floppy disks from a remote terminal." TERMCAP= export TERMCAP umask 022 ## LIMIT FORMATTmount /dev/fp021 /mnt > /dev/null 2>&1 then clear echo "\n\n\ Floppy disk files are being checked.\n\n Please stand by ..." umount /dev/fp021 > /dev/null else clear message -u "This floppy disk does not have a UNIX file system. Only floppy disks with a UNIX file system can be repaired." exit fi if /etc/fsck -yq -a /dev/rfp021 > /dev/null then clear echo "\n\n No stored files were damaged.\n\n The floppy disk is consistent.\n" else # THIS CODE IS EXECUTED IF THE FSCK FAILS clear ecING TO CONSOLE USERS TTY=`tty` expr "$TTY" : "/dev/w." > /dev/null 2>&1 if [ $? != 0 ] then message -u "$MUSTBECON" exit 1 fi ## CHECK THAT FLOPPY IS NOT IN USE BY OTHER OPERATIONS. if [ -s $LOCKFILE ] then sh /usr/bin/Funlock.sh if [ $? != 0 ] then message -u "$ERRINUSE" exit fi fi ## CHECK THAT THE FLOPPY IS NOT MOUNTED. DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi message -cu "Please insert the floppy disk for formattingho "\n\n Some stored files were damaged.\n\n The damage has been repaired.\n" fi dismount -f sleep 2 0707070000020263331007550000020000020000031162140000017757000002300000000621usr/bin/Funlock.sh#sccs "@(#)adminbin:Funlock.sh 1.1" ## ## FILE: Qunlock.sh DATE: April 21, 1986 ## ## This program checks to see that the process that created ## the lock file /tmp/QinUse.lock is still active. If not, ## then delete it. ## LOCKFILE=/tmp/FinUse.lock exec < $LOCKFILE read PID PROGRAM FOUND   =`ps -e | grep " $PID "` if [ "$FOUND" ] then exit 45 else rm -f $LOCKFILE exit 0 fi 0707070000020263341007550000020000020000031162200000017757000002300000016271usr/bin/Install.sh#sccs "@(#)adminbin:Install.sh 1.18" # ---------------------------------------------------------------------- # Install.sh # PURPOSE: Install application software # CALLED BY: Software Setup object in Admin-kit # REQUIRED FILES: /etc/iv, # ------------------------- if [ \( `expr $KEY \< $LOW` = "1" \) -o \( `expr $KEY \> $HIGH` = "1" \) ] then message -ui "Invalid entry! Please type in the number of diskettes to be installed again.\n\nPlease hit ENTER to continue." NUMERIC=0 else NUMBER=`expr ${2}00 \* 6 ` break fi fi done fi if [ "NUMERIC" !--------------------------------------------- CONTENTS=/usr/installed/CONTENTS INDIR=/usr/installed TERMCAP= export TERMCAP # Lower and Upper bound for the number of diskettes to be installed LOW=1 HIGH=99999 # Trap the delete key trap "rm -rf /tmp/SAVE$$" 2 rm -rf /tmp/installed umask 022 mkdir /tmp/installed cd /tmp/installed SAVELIBS=true while true do if [ "$SAVELIBS" = "false" ] then clear fi message -cu "To install programs from floppy disks,\nyou must insert them one by one,\nas you are pr= "0" ] then break fi done # WARNING: # The following programs may be overwritten by some foreign # install program. To prevent this, each must be saved and # then restored. The restore portion is at the end of this # program. Change both or neither. if $SAVELIBS then SAVELIBS=false mkdir /tmp/SAVE$$ cpio -pud /tmp/SAVE$$ << -END- 2> /dev/null /bin/ld /lib/crt0.o /lib/ifile.0413 /lib/libc.a /lib/libm.a /usr/lib/libmath.a -END- fi set `df -t /` FREE=$3 if [ `expr $NUMBEompted, in order.\n\nPlease insert the first floppy.\n" if [ $? != "0" ] then exit fi while true do clear newwind if [ -r Size ] then rm -f Size fi echo "\n\n Checking for Size file.\n\n" cpio -icBuK Size < /dev/rfp021 2>&1 >/dev/null err=$? if [ $err != "0" ] then clear message -cu "An error was encountered while reading in the floppy disk.\nPlease be sure to insert them properly. If this problem reoccurs at the same floppy, the disk may be bad." R \> $FREE` = "1" ] then clear message -iu "There is not enough room on the system to install the package. Please remove some files and try again.\n\nPress Enter to continue." break fi FLOP=`iv -t /dev/rfp020 2>/dev/null | grep Partition` if [ "$?" != "0" ] then dismount -f > /dev/null 2>&1 clear message -cu "Either the floppy disk is not inserted correctly, the disk has an error, or the door is not closed. Please check the floppy disk.\n" if [ $? != "0" ] then break fi else cl exit fi if [ -r Size ] then NUMBER=`cat Size` break else # # repeat the loop for number of diskettes until a # valid entry is made # NUMERIC=0 while [ "$NUMERIC" != "1" ] do NUMERIC=1 clear RET=`shform -u $UA/Installn.form` if [ "$?" != "0" ] then message $ERROR1 exit fi clear eval set $RETear newwind echo "\n\n Install in progress\n\n\n" cpio -icBdu < /dev/rfp021 2>/tmp/cplog$$ err=$? if [ "`grep \"Out of phase\" /tmp/cplog$$`" ] then clear message -cu "The floppy diskette you inserted is either not the correct floppy, or you inserted it in the wrong order. Please re-insert the first floppy diskette and start over. If this problem reoccurs at the same floppy, the disk may be bad." if [ $? != "0" ] then break fi elif [ "`grep \"annot cre if [ "$1" = "Cancel" ] then cd /tmp rm -rf /tmp/installed /tmp/cplog$$ exit fi if [ "$1" = "Help" ] then /usr/bin/uahelp -h /usr/lib/ua/admin.hlp -t "Install Software" NUMERIC=0 elif [ "$1" = "Enter" ] then clear # KEY is the number of diskettes entered KEY=$2 ate\" /tmp/cplog$$`" ] then clear message -u "Your system is out of space. Please remove some files and try again." break elif [ "$err" != "0" ] then clear message -cu "An error was encountered while reading in the floppy disk(s).\nPlease be sure to insert them in the proper order,\nand wait for the notification before removing them. If this problem reoccurs at the same floppy, the disk may be bad." if [ $? != "0" ] then break fi elif [ -f ./Install ] then if [ -f "Na   me" ] then NAME=`cat -s Name` FNAME=`date '+%y%m%d' `$$ if [ -r ./Remove ] then clear chmod +x ./Install ./Install if [ "$?" = "64" ] then break fi echo $FNAME $NAME >> $CONTENTS mv ./Remove ${INDIR}/${FNAME}.un # add item to Uninstall.menu if [ ! "`grep Name=$NAME $UA/Uninstall.menu>/dev/null 2>&1`" ] then echo "Name="$NAME >>$UA/Uninstall.menu echo "Name="$NAME >>$UA/Showsoft.menu fi I=`ps -e | grep ua | c------------------------------------------------------------------ # Instcpio.sh # PURPOSE: Install application software which resides in cpio files # - these files are defined in Suffixes with suffix "+IN" # CALLED BY: Click on a file with the "+IN" suffix # REQUIRED FILES: /etc/iv, # ------------------------------------------------------------------------- GOOD="" CONTENTS=/usr/installed/CONTENTS INDIR=/usr/installed SOURCEDIR=/usr/spool/uuut -c1-6` for i in $I do kill -16 $i done clear message -iu "The installation of the $NAME package is now complete.\n\nPlease press Enter to continue." break else clear message -cu "The install floppy is missing the 'Remove' program.\nPlease check to make sure you have the right floppy." if [ $? != "0" ] then break fi fi else clear message -cu "The install floppy is missing the 'Name' program.\nPlease check to make sure you havecppublic STARTDIR=`pwd` TERMCAP= export TERMCAP umask 022 ARG="$1" rm -rf /tmp/installed mkdir /tmp/installed cd /tmp/installed while true do # ----------------------------------------- newwind # This is the stuff that takes the correct cpio file and moves it # If there is an argument to Instcpio.sh, then it is taken as the # installable cpio file, otherwise it looks in the directory $SOURCEDIR # At the present time, any execution from the UA will provide an argument if [ -z "$ARG" ] then if the right floppy." if [ $? != "0" ] then break fi fi else clear message -cu "The install floppy is missing the 'Install' program.\nPlease check to make sure you have the right floppy." if [ $? != "0" ] then break fi fi fi clear done cd /tmp rm -rf /tmp/installed /tmp/cplog$$ ## PROTECT UPDATED VERSIONS OF THE SOFTWARE while read FILE CHKSUM do if [ ! "$FILE" ] then continue fi if expr "$FILE" : "#" > /dev/null 2>&1 then continue fi if [ -s "$FILE" ] then C [ ! -d $SOURCEDIR ] then message -cu "There are no installable files stored in the public folder. If the source of the files is electronic mail, check with the sender to insure correct addressing." exit fi cd $SOURCEDIR TEM=`ls` if [ -z "$TEM" ] then message -cu "There are no installable files stored in the public folder. If the source of the files is electronic mail, check with the sender to insure correct addressing." exit fi cat <> /etc/.fixedfiles fi fi done < /etc/fixes/.fixedlist # WARNING: # The following programs may have been overwritten by some foreign # install program. To cure this, each must be restored. expr "$NAME" : ".*[Dd][Ee][Vv][Ee][Ll][Oo][Pp]" > /dev/null fDEVSET=$? if [ $fDEVSET != 0 ] then cd /tmp/SAVE$$ cpio -pud / << -END- 2> /devages are available in a public file folder: `ls *+IN | sed s/+IN//gp ` END while true do echo "Please type one of these names and touch Return:\c" read FILENAME FILENAME=${SOURCEDIR}/${FILENAME}+IN if [ -f "$FILENAME" ] then break else message "You have not entered the file name correctly. Please retype one of the valid choices.\n\n" fi done else FILENAME=${STARTDIR}/$ARG fi cd /tmp/installed clear # ~~~~~~~~~~~~~~~~~~~~~~~~~~ # LOCAL MODIFICATION - CHECK FOR SIZE HERE R/null ./bin/ld ./lib/crt0.o ./lib/ifile.0413 ./lib/libc.a ./lib/libm.a ./usr/lib/libmath.a -END- cd .. rm -rf /tmp/SAVE$$ fi rm -rf /tmp/SAVE$$ # ----------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE Install.sh # ======================================================================= 0707070000020263351007550000020000020000031164400000017757000002400000015141usr/bin/Instcpio.sh#sccs "@(#)adminbin:Instcpio.sh 1.2" # -------ATHER THAN THE SINGLE FLOPPY CHECK # Check to see if there is room to un-cpio the file NUMBER=` ls -s $FILENAME | awk ' { print $1 } ' ` set `df -f /` FREE=$3 if [ `expr $NUMBER \> $FREE` = "1" ] then message -iu "There is insufficient space left on your system. Please remove some files and try again.\n\nPress Enter to continue." break fi # ~~~~~~~~~~~~~~~~~~~~~~~~~~ echo "\n\n\n\n\n\n Preparing for installation\n\n\n\n\n\n" cpio -icBdu < $FILENAME 2>/tmp/cplog$$     err=$? if [ "`grep \"Out of phase\" /tmp/cplog$$`" ] then clear message -cu "The file you are trying to install cannot be used. Please arrange for another copy." if [ $? != "0" ] then break fi elif [ "`grep \"annot create\" /tmp/cplog$$`" ] then clear message -u "Your system is out of space. Please remove some files and try again." break elif [ "$err" != "0" ] then clear message -cu "The file you are trying to install cannot be used. Please arrange for another--- mv ./Remove ${INDIR}/${FNAME}.un clear chmod +x ./Install ./Install ERR=$? if [ $? != 64 ] then GOOD="yes" fi # add item to Uninstall.menu if [ ! "`grep \"^Name=$NAME$\" $UA/Uninstall.menu`" ] then echo "Name="$NAME >>$UA/Uninstall.menu echo "Name="$NAME >>$UA/Showsoft.menu fi clear message -iu "The installation of the $NAME package is now complete.\n\nPlease press Enter to continue." I=`ps -e | grep ua | cut -c1-6`  copy." if [ $? != "0" ] then break fi elif [ -f ./Install ] then if [ -f "Name" ] then NAME=`cat -s Name` FNAME=`date '+%y%m%d' `$$ echo $FNAME $NAME >> $CONTENTS if [ -r ./Remove ] then # --------------------------------- cat </dev/null | grep Partition` if [ "$?" != "0" ] then clear message -c "Cannot copy to the floppy disk. Possible reasons include: disk is not inserted or is inserted improperly; latch is not closed. Please check the floppy disk and we'll try again." if [ $? != "0" ] ; then break ; fi continue else set $FLOP ; FLOP1=$1 if test $FLOP1 != Partition then clear message -c "Floppy is not formatted. Please use a formatted floppy disk and try again.================================================= 0707070000020262661007550000020000020000031621660000017757000002000000043110usr/bin/LdriverR - 3H .text3 .data H8@.bss H H.lib "8 "8" if [ $? != "0" ] then dismount -f > /dev/null 2>&1 break 2 fi dismount -f > /dev/null 2>&1 fi clear echo " Creation of Floppy in progress\n\n\n\n\n\n" find . -print | cpio -ocB > /dev/rfp021 2>/dev/null if [ "$?" != "0" ] then dismount -f > /dev/null 2>&1 clear if [ $? != "0" ] then break fi else break fi fi done fi # +++++++++++++++++++++++ END FLOPPY CHECKER else echo "\n\n O.K. - no backup will be created.\n\n\n" fi # ---------------------------   /< "8N1X OQ./HJf/H#0N`/N1x0<N@NVp.0y0 /N1XON^NuNVN^NuNVHN1$p.BN1 XO.p/N1nXO.Xp/N1nXO. /< !N1XOp-@. /< !N1RXO# !Jg`. /N(XOrb@0; NJxxRp .p1/p2/ .N1XO"| AHP/< NpO .N)-@p .p/p2/ .N1XO"| Ag$p0g9  gn.0/< `F9  g n=h Hnp/p/N1O Jg:9  g$.0/< BBp/N14O# !@pLN^Nu.NB` .RCB1pnB`@ ."Ё"| AJg, ."ЁACRpn` .C  .C 1 gRA p.HnN(XOp .p/p2/ .N1XO"| AHP/< +NO ."Ё"| B1p .p/p2/ .N1XO"|  AHP/< -NO ."Ё"| A./< /BBp/N14O# !@p`9  HP/.N2O Bp/ ."Ё"| AHP/.NO p2. .N1"| A$H .Ѐ"Ё"| # .Ѐ"Ё"| B1 .Ѐ"Ё"| A"9 !. "ЁCAHPN1XO` "ЁCB1Rp mJjg|t`n0*HgNA. "ЁCbAHPN1XO "| . "ЁCbAHPN1XO` "ЁCbB1Rpm.N/rg&9  gd. BBp/N14O `Bt`Hn//N/O rg69  g ./< BBp/N14O# !@pL N^Nu .f ng* ng"J.gPRHn//.N/O `6Hn/.N0PO&@v` "ЁCJ1g "| B 12.Hf.N1 .HS "ЁC   AHPN1POJfp稁n` r b@0; NJ ".8J\blv# h`h# d`\# ``P# \# L`># X# H`, n`# T`# P` n `# pRp mJjgv` "ЁCbJ1g "|  12.Hfp.Hn "ЁCbAHPN1POJfp稁n^ rbn@0; NJ$.8BLV# t`D# x`:# |`0# `&# `# `# `# Rpm J.gRHn//.N/O R nm80.`jg9  gN0j.0@/NXO`.HSHn/< HnN1OHnN1bXOJgp`p&f. N z | `RNVH$n&n jPg9  gp0*./< m`b.NJg29  g. BBp/N14O -@pLN^NuBN1$-@ n=h xt`.Hn/HRN.O rg9  g.0//< `Jgخ.N1$(@f29  g".//< BBp/N14O-@`pg.HRN.XOrg49  g$.0//< !BBp/N14O-@p`.p//.HTN1dO rg89  g./< IBBp/N14/< `$0.^jg89  g(0j.0@//< `f.N0|-@XHnF/HTN/O JgB. HnFN1XOJfxJg .N29 Hf .`f .N+` g.N+. HnN1XO.HnN1XOHnHn\NPOJgB`09  g&.0//< GBBp/N14O# !@Hn\ N8O ."Ё"| Y`R . !8mvBp o ."| !DB1R`.N1FN^NuNVB. /9 6N1RXO @-HgBB` .R"| !B1 m.pP//< !DN1PO @ gbp./< !D/.N1POJf0p f(p-@Bp o .R"| !DB1`. !D/< !N1XO`Jfp f./< !N1XOJg .N1F. /9 :N1RXO @-Hg./< !N1XO.N1F. 6N1Jf . 6/9 :N1XO. :N1N^NuNVH $n.Hx/9 2N1PO&m&t`J.g&Rp    .Hn/N1,POr g` L N^Nup .HRHnN1PO|=j B "ЀЁ//N1POp .Hn/N1PO.N1B`NVH $np./9 2N1XO&mTt`ZJ.gPp .HRHnN1POJf:B.B "ЀЁ//N1POp .Hn/N1PO`&L N^NuRp .Hn/N1,POr g.N1B`NVH $n&n `RJ  g  g  gtHH"|0 1HHr€f _f RCpmJgpm pL N^NuAB0(`Hn/N1POJgPKJf +`NVH$n`RJ  g  g  gtHH"|0 1HHr€f _f N1POJf~.p/p//< N1dO rf\. N1B @# 4gD. 9 Y/p/HhN1dO "9 YfB/./N1POJf 9 S"y 4J1f# 8# < 9 ఫn L N^Nu y 4./< N1XO @`p.HS/< N1POB9  | `NVJg^ y @f #" @`&-y @`6 n h"f n"n!i"".N1HpN^Nu n-h"Jfp`NV-y @` nfpN^Nu n-h"Jfp`NqNVp&.p/N1TXO @-Hf N^Nu nB"J @f # @`(-y @` n-h" nR"| pm | B0( LN^NuNVH$n`RJ  g  g  gHH"|0 1HHr€f _fRJ`RJ  g  g  gt =f,RJ  g  g  gJg R"| pom | B0( LN^NuNVH `N`xt`PpgP l R"| LA" y !Sm y !"hR@H` . !N1&p f | LB0(Jn L N^Nu y !Sm y !"hR@H` . !N1&p gp gp gp#fB`6NVH y !Sm y !"hR@H` . !N1$p g6 y !Sm y !"hRJ"f n!n"R D n!y D n`     + ; I i ~ ~ INSTALL REMOVE DRIVER @H` . !N1$pfLN^NuNqNV.N2Jg n hefB (r in <%s> Device Drivers Driver <%s> not loaded Device Drivers UNBIND failed, error code= %d Device Drivers UNALLOC failed, error code =2d Device Drivers Driver %s removed from system Device Drivers Cannot open %s Device Drivers Driver <%s> not allocated Device Drivers Cannot open %s /etc/lddrv/%s.rc >/dev/null 2>&1 Initialization failed for this Driver Driver will be removed Init error : %d, System error : %d Loaded YESDevice Drivers cmpb:ldtbseek    failed Device Drivers cmpb:ldtbread failed:%d w+Device Drivers cannot open <%s> MEMORY { user_mem : origin = %#x , length = %#x } SECTIONS { .text : {} .data : {} .bss : {} } DFLT_ID = %d; ioctlwritereadcloseopenpwrinitprintstrategyreleaseinfoopenclosereadwriteioctlinoutmdmintDevice Drivers setsw:ldtbseek failed Device Drivers setsw:ldtbread failed:%d Device Drivers Didn't find all entry points:found:%x needed:%x Device Drivers Didn't find all entry points for lineswROR1" exit fi eval set $RET case $1 in Enter) shift 1 # update the files cat > /etc/.modem << END IAT=$1 IGT=$2 END /etc/.modeminit break ;; # This is the Exit code if command is cancelled Cancel) exit ;; # Help screen Help) /usr/bin/uahelp -h $UA/admin.hlp -t "Modem Setup" ;; # Unrecognizable return form action key *) message "$ERROR2" ;; esac clear done # ------------------------------------------------------------------------ # EXECUTABLE PROGRAM ENDS HERE Mod:found:%x needed:%x Device Drivers could not de-allocate:%d rDevice Drivers Open error for file -- %s %8s%ho%ho%ho%4s%hd%hd%hdDevice Drivers%s Device parameter count Device Drivers chksig:ldtbseek failed Device Drivers chksig:ldtbread failed:%d USIGNDrivers %s already allocated Device Drivers Bad magic:%o Device Drivers Driver must be relocatable ldshread failed : bss err:%d Device Drivers ldshread failed:text err:%d Device Drivers ldshread failed:data err:%d Device Drivers DRV ALLOC failedem.sh # ------------------------------------------------------------------------ 0707070000020263371007550000020000020000031162330000017757000002200000002364usr/bin/MsdosF.sh#sccs "@(#)adminbin:MsdosF.sh 1.3" # Users.sh # PURPOSE: Format a Msdos disk # CALLED BY: Floppy # ------------------------------------------------------------------------- ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount, error code = %d Driver Load Status allocated: %#x bytes starting at %#x for device %s, B:%d C:%d L:%d id:%d /etc/lddrv/unix.symDFLT_ID/etc/lddrv/ifile.ld -N %s -o %s %s /etc/lddrv/unix.sym >/dev/null 2>&1Device Drivers ld failed:%x errno:%d Device Drivers Bad magic:%o Device Drivers unix.sym and currently running UNIX signitures do not match Device Drivers ldshread failed:%d err:%d Device Drivers no mem for %d:%x Device Drivers ldseek failed:%d err:%d bad read of %d cannot set devsw entrie the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." LOCKFILE=/tmp/FinUse.lock ERRINUSE="The floppy disk is already in use by another application. Please wait for the disk to finish before starting again." MUSTBECON="You may not format floppy disks from a remote terminal." TERMCAP= export TERMCAP umask 022 ## LIMIT FORMATTING TO CONSOLE USERS TTY=`tty` expr "$TTY" : "/dev/w." > /dev/null 2>&1 if [ $? != 0 ] then message s BIND failed Driver is not loaded BIND failed, error code = %d drvid: %d: DRVSTAT failed LoadedAlloc r YESrw+@(#) adminbin:adminbin.sl 1.137 ` %ldr! ` %ld0707070000020263361007550000020000020000031162300000017757000002100000002443usr/bin/Modem.sh#sccs "@(#)adminbin:Modem.sh 1.1" # Modem.sh # PURPOSE: Control of /etc/.modem # CALLED BY: Admin-Kit # REQUIRED FILES: Modem.form, /etc/.modem, /etc/.modeminit # MODIFIED FILES: /etc/.modem # -----u "$MUSTBECON" exit 1 fi ## CHECK THAT FLOPPY IS NOT IN USE BY OTHER OPERATIONS. if [ -s $LOCKFILE ] then sh /usr/bin/Funlock.sh if [ $? != 0 ] then message -u "$ERRINUSE" exit fi fi ## CHECK THAT THE FLOPPY IS NOT MOUNTED. DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi echo "$$ MsdosF.sh" > $LOCKFILE /usr/bin/md_format /dev/rfp020 rm -f $LOCKFILE 0707070000020263401007550000020000020000031622410000017757000002200000001166usr/bin/Msdo-------------------------------------------------------------------- ERROR1="An error has been encountered in the form file Modem.form\n Please notify AT&T User Support. Thank you." ERROR2="The command provided was not recognized.\nPlease use Enter or Cancl." umask 022 # Get the information from /etc files if [ -s /etc/.modem ] then . /etc/.modem else IAT="NO" IGT="NO" fi export IAT IGT # Execute the modem form while true do RET=`shform -u $UA/Modem.form` if [ "$?" != "0" ] then message "$ERsR.sh#sccs "@(#)adminbin:MsdosR.sh 1.1" # Users.sh # PURPOSE: read a Msdos disk # CALLED BY: Floppy # ------------------------------------------------------------------------- ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." TERMCAP= export TERMCAP umask 022 DEVNU   M=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi /usr/bin/msdos /dev/rfp020 0707070000020263411007550000020000020000031622420000017757000002200000001172usr/bin/MsdosW.sh#sccs "@(#)adminbin:MsdosW.sh 1.1" # Users.sh # PURPOSE: write a Msdos disk # CALLED BY: Floppy # ------------------------------------------------------------------------- ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a  continue ;; "," ) message $ERROR3 continue ;; *,* ) message $ERROR3 continue ;; esac word=`echo $newname | wc -w` if [ \( -n "$newname" \) -a \( $word = 0 \) ] then message -i "No change to the Electronic Mail name due to invalid entry!\n\nPlease hit Enter to continue" exit fi if [ \( -z "$newname" \) -a \( "$UNAME" != "UNIXPC" \) ] then message -i "No change to the Electronic Mail name was made.\n\nPlease hit Enter to continue" exit fi if [ \( "$oldpasswd"'mount' on the system.Please dismount the floppy disk by closing the 'Floppydisk' window or issue a 'dismount -f' in the 'Unix' window before attempting this operation." TERMCAP= export TERMCAP umask 022 DEVNUM=`mount | wc -l | cut -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu $ERROR1 exit fi /usr/bin/md_write /dev/rfp020 0707070000020263421007550000020000020000031622430000017757000002300000007560usr/bin/Namesys.sh#sccs "@(#)adminbin:Namesys.sh 1.8" #  = "$passwd" \) -a \( "$UNAME" = "$newname" \) ] then message -i "No change to the Electronic Mail name was made.\n\nPlease hit Enter to continue" exit fi if [ \( -z "$newname" \) -o \( "$newname" = "UNIXPC" \) ] then message "The Electronic Mail name \"UNIXPC\" is supplied on all delivered systems. It must be changed in order to allow data communications with other computers." else LENGTH=`expr "$newname" : '.*'` MATCH=`expr "$newname" : '[a-z,A-Z,0-9,_]\{1,8\}'` if [ "$LENGTH" != " Namesys.sh # PURPOSE: change uname of system # CALLED BY: Admin-kit # REQUIRED FILES: Namesys.form # ------------------------------------------------------------------------- ERROR1="An error has been encountered in the form file Namesys.form\n Please notify AT&T User Support. Thank you." ERROR2="The command provided was not recognized.\nPlease use Enter, Cancel, or a defined function key." ERROR3="System name may contain between one and eight characters consisting of letters, num$MATCH" ] then message $ERROR3 else break fi fi ;; # This is the Exit code if command is cancelled Cancel) exit ;; # This is the Help code Help) /usr/bin/uahelp -h $UA/admin.hlp -t "System Name" ;; # Unrecognizable return from action key *) message $ERROR2 ;; esac clear done if [ -x /usr/net/netname ] then /usr/net/netname -r $newname if [ "$?" != 0 ] then exit else echo "/usr/net/netname -n $newname" >/etc/namesys fi else setuname -n $newname echo "setuname -n $nebers and underscore." TERMCAP= export TERMCAP umask 022 USEWIN="-u" USEWIN2="-iu" UNAME=`uname -n` PASS=`grep "^uucp::" /etc/passwd` if [ -n "$PASS" ] then oldpasswd=NO else oldpasswd=YES fi export UNAME oldpasswd while true do RET=`shform $USEWIN $UA/Namesys.form` if [ "$?" != "0" ] then message $ERROR1 exit fi eval set $RET newname=$2 passwd=$3 case $1 in Enter) if [ -z "$newname" ] then message $ERROR3 continue fi case "$newname" in "!" ) message $ERROR3 continue ;; "+" ) wname" >/etc/namesys fi clear message ${USEWIN2} "The Electronic Mail name of the system is now "$newname". \ If there are systems which have communicated \ electronically with this system in the past, \ you should notify their system administrators \ that a change has been made to your system.\n\nPlease hit Enter to continue" if [ \( "$passwd" = "YES" \) -o \( "$passwd" = "yes" \) -o \( "$passwd" = "Yes" \) -o \( "$passwd" = "y" \) -o \( "$passwd" = "Y" \) ] then if [ "$oldpasswd" = NO ] then /u message $ERROR3 continue ;; "-" ) message $ERROR3 continue ;; "=" ) message $ERROR3 continue ;; "&" ) message $ERROR3 continue ;; "%" ) message $ERROR3 continue ;; "*" ) message $ERROR3 continue ;; "(" ) message $ERROR3 continue ;; ")" ) message $ERROR3 continue ;; "|" ) message $ERROR3 continue ;; "<" ) message $ERROR3 continue ;; ">" ) message $ERROR3 continue ;; ":" ) message $ERROR3 sr/bin/password uucp 1 /usr/bin/uucppwd fi else if [ "$oldpasswd" = YES ] then /usr/bin/password uucp 0 /usr/bin/uucppwd fi fi # ------------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE Namesys.sh 0707070000020263431007550000020000020000031622560000017757000002200000001554usr/bin/Pclear.sh#sccs "@(#)adminbin:Pclear.sh 1.3" # Pclear.sh # PURPOSE: enable    the printer in case it was disabled # CALLED BY: Printers # ------------------------------------------------------------------------ TERMCAP=; export TERMCAP umask 022 num=0 /usr/lib/lpshut >/dev/null 2>&1 for i in Serial Serial1 Serial2 Serial3 Serial4 Serial5 Serial6 Parallel Remote Remote2 do if [ -s /usr/spool/lp/class/$i ] then printer=`head -1 /usr/spool/lp/class/$i` enable $printer ${printer}_R >/dev/null 2>&1 num=`expr $num + 1` fi done /usr/lib/lpsched >/dev/null 2>&1 if [ $num = 0 ] t "no" \) -o \( "$6" = "No" \) -o \( -z "$1" \) ] then NOLINE2=1 fi if [ \( "$NOLINE1" = "1" \) -a \( "$NOLINE2" != "1" \) ] then message $ERROR3 NOCHANGE=1 elif [ \( "$7" = "VOICE" \) -a \( "$NOLINE2" != "1" \) ] then message $ERROR5 NOCHANGE=1 elif [ \( "$2" = "DATA" \) -a \( "$NOLINE2" != "1" \) ] then hen message -iu "No printers are setup !!\n\nPlease press Enter to continue." exit else if [ $num = 1 ] then PLURAL=" is" else PLURAL="s are" fi fi message -iu "The printer$PLURAL now reset.\n\nPlease press Enter to continue." 0707070000020263441007550000020000020000031622570000017757000002200000012310usr/bin/Phones.sh#sccs "@(#)adminbin:Phones.sh 1.5" # Phones.sh # PURPOSE: Control of /etc/.lineone and /etc/.linetwo # CALLED BY: A message $ERROR4 NOCHANGE=1 else if [ "$NOLINE1" = "1" ] then rm -f /etc/.lineone getoff.sh ph0 else if [ "$2" = "DATA" ] then geton.sh ph0 else getoff.sh ph0 fi cat > /etc/.lineone </tmp/L-dev$$ echo "OBM ph0 UNIXPC 1200" >> /tmp/L-dev$$ mv /tmp/L-dev$$ /usr/lib/uucp/L-devices sed < /usr/lib/uucp/L.sys "s/ph1/ph0/p" > /tmp/L.sys$$ mv /tmp/L.sys$$ /usr/lib/uucp/L.sys hone line 2 is set up, line 1 cannot be the DATA line.\n THE SETUP HAS NOT BEEN CHANGED!" ERROR5="If telephone line 2 is set up, it must be the DATA line. It cannot be the VOICE line.\n THIS SETUP HAS NOT BEEN CHANGED!" NOLINE1=0 NOLINE2=0 NOCHANGE=0 TERMCAP= export TERMCAP umask 022 # Get the information from /etc files if [ -s /etc/.lineone ] then . /etc/.lineone L1="YES" else L1="NO" MD1="VOICE" TT1="YES" KS1="NO" MS1="NO" fi if [ -s /etc/.linetwo ] then . /etc/.linetwo L2="YES" else L2=" fi else if [ "$2" = "DATA" ] then geton.sh ph1 else getoff.sh ph1 fi cat > /etc/.linetwo </tmp/L-dev$$ echo "OBM ph1 UNIXPC 1200" >> /tmp/L-dev$$ mv /tmp/L-dev$$ /usr/lib/uucp/L-devices sed < /usr/lib/uucp/L.sys "s/ph0/ph1/p" > /tmp/L.sys$$ mv /tmp/L.sys$$ /usr/libNO" MD2="DATA" TT2="YES" KS2="NO" fi export L1 MD1 TT1 KS1 L2 MD2 TT2 KS2 MS1 # Execute the telephone form while true do RET=`shform -u $UA/Phones.form` if [ "$?" != "0" ] then message "$ERROR1" exit fi eval set $RET case $1 in Enter) shift 1 # test the entries for LINE1 and LINE2 if [ \( "$1" = "NO" \) -o \( "$1" = "no" \) -o \( "$1" = "No" \) -o \( -z "$1" \) ] then NOLINE1=1 fi if [ \( "$6" = "NO" \) -o \( "$6" =/uucp/L.sys fi fi # If change, handle password # Or else, reset the flags and show the form again. if [ "$NOCHANGE" != "1" ] then grep "root::" /etc/passwd > /dev/null 2>&1 if [ "$?" = "0" ] then message -c "UNIX provides for a non-office login called \"root\". You should provide a password for this login in order to prevent unauthorized access via the phone lines. Touch Enter to provide a root password now, or Cancel to skip."     if [ "$?" = "0" ] then password root 1 fi fi break else NOLINE1=0 NOLINE2=0 fi ;; # This is the Exit code if command is cancelled Cancel) exit ;; # help screen Help) /usr/bin/uahelp -h $UA/admin.hlp -t "Phone Setup" NOCHANGE=1 ;; # Unrecognizable return from action key *) message "$ERROR2" NOCHANGE=1 ;; esac clear if [ "$NOCHANGE" != "1" ] then grep "root::" /etc/passwd > /dev/null 2>&1 if [ "$?" = "0" ] then message -c "UNIXer" option follows here Enter) shift RSfree.sh 000 noconfirm if [ "$?" != "0" ] ; then exit ; fi TYPE=$1 SPEED=$2 HFC=$3 case $TYPE in NONE) clear message -iu $MESS1 exit ;; COMPUTER) while true do clear RET=`shform -u $UA/RS232e.form` if [ "$?" != "0" ] then message $ERROR1 exit fi eval set $RET if [ "$1" = "Help" ] then /usr/bin/uahelp -h /usr/lib/ua/admin.hlp -t "RS232 Setup" elif [ "$1" != "Enter" ] then  provides for a non-office login called \"root\". You should provide a password for this login in order to prevent unauthorized access via the phone lines. Touch Enter to provide a root password now, or Cancel to skip." if [ "$?" = "0" ] then password root 1 fi fi else NOCHANGE=0 fi done # ------------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE Phones.sh # ======================================================= exit elif [ true ] then RET2=$2 set $2 if [ "$1" != "HOST" ] then echo "DIR tty000 0 $SPEED" >> /usr/lib/uucp/L-devices fi if [ "$1" != "CALLER" ] then grep -v "000:.*getty" /etc/inittab > /tmp/init$$ mv /tmp/init$$ /etc/inittab echo " 000:2:respawn:/etc/getty tty000 $SPEED" >> /etc/inittab ================== 0707070000020263451007550000020000020000031622730000017757000002100000013525usr/bin/RS232.sh#sccs "@(#)adminbin:RS232.sh 1.6" # RS232.sh # PURPOSE: Configure the software to a particular device type on RS232 # CALLED BY: RS232 # REQUIRED FILES: RS232.form # ------------------------------------------------------------------------- ERROR1="An error has been encountered in an RS232 form file.\n Please notify AT&T User Support.  telinit q fi INCOME=$RET2 break fi clear done ;; MODEM) while true do clear if [ -n "`find /usr/lib/uucp/modemcap -newer $UA/RS232d.form -print`" ] then grep -v Name= $UA/RS232d.form >/tmp/RS232d.form$$ mv /tmp/RS232d.form$$ $UA/RS232d.form echo "Name=Answer_only" >> $UA/RS232d.form grep '^#' /usr/lib/uucp/modemcap|grep Name=|cut -dN -f2-|sort|sed 's/ame/Name/' >> $UA/RS232d.form fi RET=`sh Thank you." ERROR2="The command provided was not recognized.\nPlease use Enter, Cancel, or a defined function key." MESS1="The RS232 port is now set up. \n\nPlease press Enter to continue." TERMCAP= export TERMCAP umask 022 # OLDTYPE is used to store the value of the type so that it can be # compared to the TYPE newly selected. OLDTYPE='NONE' SPEED=9600 INCOME='HOST only' TYPE='NONE' # get the data from /etc/.rs232 if [ -s /etc/.rs232 ] then . /etc/.rs232 if [ "$TYPE" = 'PRINTER' ] then RSfree.sform -u $UA/RS232d.form` if [ "$?" != "0" ] then message $ERROR1 exit fi eval set $RET if [ "$1" = "Help" ] then /usr/bin/uahelp -h /usr/lib/ua/admin.hlp -t "RS232 Setup" elif [ "$1" != "Enter" ] then exit elif [ true ] then if [ "$2" != "Answer_only" ] then echo "ACU tty000 $2 $SPEED" >> /usr/lib/uucp/L-devices INCOME="h 000 if [ "$?" != "0" ] then exit fi INCOME='HOST only' SPEED=9600 NAME= fi fi # store the value of TYPE before the user makes any new selection OLDTYPE="$TYPE" # check Hardware Flow Control configuration HFCINIT=/etc/daemons/tty000.init if [ -x $HFCINIT ] then HFC=Yes else HFC=No fi export TYPE NAME SPEED INCOME OLDTYPE HFC while true do RET=`shform -u $UA/RS232a.form` if [ "$?" != "0" ] then message $ERROR1 exit fi BAD= eval set $RET case $1 in # Executable code for the "entBOTH HOST and CALLER" else INCOME="HOST only" fi NAME=$2 grep -v "000:.*getty" /etc/inittab > /tmp/init$$ mv /tmp/init$$ /etc/inittab echo " 000:2:respawn:/etc/getty tty000 $SPEED" >> /etc/inittab telinit q break fi clear done ;; TERMINAL) NAME= INCOME="HOST only" grep -v "000:.*getty" /etc/inittab > /tmp/init$$     mv /tmp/init$$ /etc/inittab echo " 000:2:respawn:/etc/getty tty000 $SPEED" >> /etc/inittab telinit q clear ;; OTHER) while true do clear RET=`shform -u $UA/RS232b.form` if [ "$?" != "0" ] then message $ERROR1 exit fi RET2=$2 eval set $RET if [ "$1" = "Help" ] then /usr/bin/uahelp -h /usr/lib/ua/admin.hlp -t "RS232 Setup" elif [ "$1" != "Enter" ] then sr/lib/uucp/L-devices # ------------------------------------------------------------------------- ERROR3a="The RS232 Port is currently connected to a " ERROR4=".\nAre you sure you want to remove it?" TERMCAP= export TERMCAP umask 022 TTY=$1 CONF=$2 # get the data from /etc/.rs232 or /etc/.rs232_TTY if [ $TTY = "000" ] then if [ -s /etc/.rs232 ] then . /etc/.rs232 else TYPE="NONE" fi elif [ -s /etc/.rs232_$TTY ] then . /etc/.rs232_$TTY else TYPE="NONE" fi PTYPE="$TYPE" if [ "$TYPE" = "OTHER"  exit elif [ true ] then RET2=$TMP NAME=$2 RET3=$3 set $3 if [ "$1" != "HOST" ] then echo "DIR tty000 0 $SPEED" >> /usr/lib/uucp/L-devices fi if [ "$1" != "CALLER" ] then grep -v "000:.*getty" /etc/inittab > /tmp/init$$ mv /tmp/init$$ /etc/inittab echo " 000:2:respawn:/etc/getty tty000 $SPEED" >> /etc/ini] then TYPE=$NAME elif [ -z "$TYPE" ] then TYPE="unknown device" elif [ \( "$TYPE" = "NONE" \) -a \( -z "$CONF" \) ] then message -i The RS232 port is free.\\nPress Enter to continue if [ "$?" != "0" ] then exit 1 fi else if [ -z "$CONF" ] then message -c $ERROR3a ${TYPE}$ERROR4 if [ "$?" != "0" ] then exit 1 fi fi fi if [ -f /usr/spool/uucp/LCK..tty{$TTY} ] then message -i "Sorry, the RS232 port is being used right now.\n Please try again later." exit 1 fi # Turning port off in ttab telinit q fi INCOME=$RET3 break fi clear done ;; esac cat >/etc/.rs232 </dev/null 2>&1 echo "/etc/hfc_ctl +/dev/tty000" >$HFCINIT chmod +x $HFCINIT . $HFCINIT fi clear message -iu $MESS1 break ;; # This is the help screen Help) /usr/bin/uahelp -h /usr/lib/ua/acase it was on. No harm if it wasn't getoff.sh $TTY if [ "$?" = "0" ] then message -i "Sorry, the RS232 port is being used right now.\n Please try again later." exit 1 fi case $PTYPE in # Executable code for the "enter" option follows here MODEM) grep -v "$TTY" /usr/lib/uucp/L-devices > /tmp/L-dev$$ mv /tmp/L-dev$$ /usr/lib/uucp/L-devices ;; OTHER) grep -v "$TTY" /usr/lib/uucp/L-devices > /tmp/L-dev$$ mv /tmp/L-dev$$ /usr/lib/uucp/L-devices ;; COMPUTER) grep -v "$TTY" /usr/lib/uucp/L-devicdmin.hlp -t "RS232 Setup" ;; # This is the Exit code if command is cancelled Cancel) exit ;; # Unrecognizable return from action key *) message $ERROR2 ;; # End of main case based on the action key esac clear done # ------------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE RSdevice.sh # ========================================================================= 07070700000202634610075500000200000200000316230700000177570es > /tmp/L-dev$$ mv /tmp/L-dev$$ /usr/lib/uucp/L-devices ;; PRINTER) message -i "Removing printer\nPlease stand by ..." & mpid=$! /usr/lib/lpshut > /dev/null 2>&1 /usr/lib/lpadmin -x${NAME} 2> /dev/null /usr/lib/lpadmin -x${NAME}_R 2> /dev/null /usr/lib/lpsched 2> /dev/null kill $mpid > /dev/null 2>&1 ;; *) ;; # End of main case esac if [ "$TTY" = "000" ] then echo "TYPE='NONE'" > /etc/.rs232 else echo "TYPE='NONE'" > /etc/.rs232_$TTY fi # Turn Hardware Flow Control off in case it was on. No 00002200000005560usr/bin/RSfree.sh#sccs "@(#)adminbin:RSfree.sh 1.3" # ------------------------------------------------------------------------- # RSfree.sh # PURPOSE: Remove currently configured device from an RS232 port # This program can be invoked two ways: # RSfree.sh TTY (TTY must be one of 000 through 006) # RSfree.sh TTY noconfirm # CALLED BY: /usr/lib/ua/RS232 object file # MODIFIED FILES: /etc/.rs232, /etc/.rs232_$TTY, /uharm if it wasn't. rm -f /etc/daemons/tty$TTY.init #Directory removed only if empty else error will be ignored. rmdir /etc/daemons >/dev/null 2>&1 /etc/hfc_ctl -/dev/tty$TTY # ------------------------------------------------------------------------- # EXECUTABLE PROGRAM ENDS HERE RSfree.sh # ========================================================================= 0707070000020263471007550000020000020000031623120000017757000002300000023144usr/bin/Restore.sh#sccs "@(#)adm   inbin:Restore.sh 1.8" # Restore.sh # PURPOSE: Restore (cpio) files from floppy disk # CALLED BY: Administration # REQUIRED FILES: Restore.menu Restore.form # ------------------------------------------------------------------------ # ERROR1="You have a disk mounted already!\n\nPossible reasons: you have another Floppy window opened or you did a 'mount' on the system. Please dismount the floppy disk by closing the 'Floppydisk' window or issue a hen clear message -cu "Floppy is either not inserted, is incorrectly inserted, is not formatted or has a hard error." if [ "$?" != "0" ] ; then exit ; fi else break fi done clear echo "$$ Restore.sh" > $LOCKFILE if test "$RET2" = RESTORE then if test "$RET3" = All then clear newwind clear echo "\n\n\n\n\n Restore in progress\n\n" trap "" 2 cpio -iBdc$uflag < /dev/rfp021 2>/tmp/cplog$$ err=$? trap 2 if [ "`grep \"Out of phase\" /tmp/cplog$$`" ] th'dismount -f' in the 'Unix' window before attempting this operation." LOCKFILE=/tmp/FinUse.lock ERRINUSE="The floppy disk is already in use by another application. Please wait for the disk to finish before starting again." TERMCAP= export TERMCAP umask 022 trap "" 2 ## CHECK THAT FLOPPY IS NOT IN USE BY OTHER OPERATIONS. if [ -s $LOCKFILE ] then sh /usr/bin/Funlock.sh if [ $? != 0 ] then message -u "$ERRINUSE" exit fi fi ## CHECK THAT THE FLOPPY IS NOT MOUNTED. DEVNUM=`mount | wc -l | cuten dismount -f > /dev/null 2>&1 clear message -u "The floppy diskette you inserted is either not the correct floppy, or you inserted it in the wrong order. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad." elif [ "`grep \"annot create\" /tmp/cplog$$`" ] then clear OUTOFSPACE=true break elif [ "$err" = "4" ] then clear ABORT=true break elif [ "$err" != "0" ] then dismount -f > /dev/null 2>&1 clear -c7-7` if [ "$DEVNUM" != "1" ] then clear message -cu "$ERROR1" exit fi while true do RET=`shform -u $UA/Restore.menu` err=$? if [ "$err" != "0" ] then message "Error $err in menu: Restore.menu" exit fi eval set $RET ; RET1=$1 ; RET2=$2 ; SLCTN=$2 eval set $RET2 ; RET2=$1 ; RET3=$2 ; RET4=$3; RET5=$4 if test "$RET1" = Cancel then exit elif test "$RET1" = Enter then break elif test "$RET1" = Help then case $SLCTN in "RESTORE All" ) HELP="Restore All" ;; "RESTORE by UNI message -u "There was an error in the restore. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" else clear FINISHED=true break fi elif test "$RET3" = by then while true do # loop until user hits Enter or Cancel clear SRET=`shform -u $UA/Restore.form` err=$? if [ "$err" != "0" ] then message "Error $err in form: Restore.form" rm -f $LOCKFILE exit fi set $SRET eval SRET1=$1 iX Name" ) HELP="Restore by Name" ;; "SHOW and RESTORE Folders" ) HELP="Restore Folders" ;; "SHOW and RESTORE Files" ) HELP="Restore Files" ;; *) HELP="Restore" ;; esac /usr/bin/uahelp -h $UA/admin.hlp -t "$HELP" clear fi done YN=Yes while true do clear export YN RET=`shform -u $UA/Restyn.form` err=$? uflag="" if [ "$err" != "0" ] then message "Error $err in menu: Restyn.menu" exit fi eval set $RET YN="$2" SRET1=$1 if test "$SRET1" = Cancel then exit elif tf test "$SRET1" = Enter then shift break elif test "$SRET1" = Cancel then dismount -f > /dev/null 2>&1 rm -f $LOCKFILE exit elif test "$SRET1" = Help then /usr/bin/uahelp -h $UA/admin.hlp -t "Restore by Name" fi done PATTERNS= while test $# != 0 do eval fnm=$1 if test "$fnm" = "" then break fi eval fty=$2 if test "$fty" = Folder then FLDTAG="/* $fnm" else FLDTAG= fi PATTERNS="$PATTERNS $fnm$FLDTAG" # echo "PATTest "$SRET1" = Enter then break elif test "$SRET1" = Help then clear /usr/bin/uahelp -h $UA/admin.hlp -t "Uncond Overwrite" fi done if test "$YN" = Yes then uflag=u; fi while true do FINISHED=false OUTOFSPACE=false ABORT=false while true do clear message -cu "Insert floppy to restore from" if [ "$?" != "0" ] ; then exit ; fi # We have prompted user to insert floppy; determine whether it's formatted FLOP=`iv -t /dev/rfp020 2>/dev/null | grep Partition` if [ "$?" != "0" ] tERNS=$PATTERNS" shift shift done if test "$PATTERNS" = "" then clear message -u "No selections were made, therefore no restore was performed" else clear newwind clear echo "\n\n\n\n\n Restore in progress\n\n" trap "" 2 cpio -iBdc$uflag $PATTERNS < /dev/rfp021 2>/tmp/cplog$$ err=$? trap 2 if [ "`grep \"Out of phase\" /tmp/cplog$$`" ] then dismount -f > /dev/null 2>&1 clear message -u "The floppy diskette you inserted is eit   her not the correct floppy, or you inserted it in the wrong order. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" elif [ "`grep \"annot create\" /tmp/cplog$$`" ] then clear OUTOFSPACE=true break elif [ "$err" = "4" ] then clear ABORT=true break elif [ "$err" != "0" ] then dismount -f > /dev/null 2>&1 clear message -u "There was an error in the restore. Please start over again from  2>&1 rm -f $LOCKFILE exit elif test "$SRET1" = Help then /usr/bin/uahelp -h $UA/admin.hlp -t "Restore $RET5" fi done shift while test $# != 0 do eval fnm=$1 PATTERNS="$PATTERNS $fnm$FLDTAG" if [ -n "$FLDTAG" ] then PATTERNS="$PATTERNS $fnm" fi shift done # make sure PATTERNS isn't empty, or the whole cpio archive will be restored if test "$PATTERNS" = "" then clear message -iu "No selections were made, therefore no restore was performedthe first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" else clear FINISHED=true break fi fi fi elif test "$RET2" = SHOW then if test "$RET5" = Folders then FLFD=folder # in cpio -iBtvc output, "40" indicates a directory PARM=40 FLDTAG=/* elif test "$RET5" = Files then FLFD=file # in cpio -iBtvc output, "10" indicates a file PARM=10 FLDTAG= fi # construct menu echo "Menu = SHOW Contents--"$FLFD > rslist.menu echo "Prompt = Selec." else clear message -iu "If you are restoring from more than one floppy diskette, please reinsert the first diskette.\n\nPress Enter to continue" if [ $? != 0 ] then rm -f rslist.menu dismount -f > /dev/null 2>&1 rm -f $LOCKFILE exit fi clear rm -f rslist.menu newwind clear echo "\n\n\n\n\n Restore in progress\n\n" trap "" 2 cpio -iBdc$uflag $PATTERNS < /dev/rfp021 2>/tmp/cplog$$ err=$? trap 2 if [ "`grep \"Out of phast "$FLFD"(s), press Enter" >> rslist.menu echo "Multiple" >> rslist.menu clear newwind clear echo "\n\n\n\n\n\n Reading floppy diskette." echo " Please do not remove.\n\n\n\n" cpio -ivtBc < /dev/rfp021 2>/tmp/cplog$$ > /tmp/cplst$$ err=$? cut -c1-2,44-121 /tmp/cplst$$ | grep "^$PARM" | sed "s/"$PARM"/Name = /p" >> rslist.menu rm -f /tmp/cplst$$ if [ "`grep \"Out of phase\" /tmp/cplog$$`" ] then dismount -f > /dev/null 2>&1 clear message -u "The e\" /tmp/cplog$$`" ] then dismount -f > /dev/null 2>&1 clear message -u "The floppy diskette you inserted is either not the correct floppy, or you inserted it in the wrong order. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" elif [ "`grep \"annot create\" /tmp/cplog$$`" ] then clear OUTOFSPACE=true break elif [ "$err" = "4" ] then clear ABORT=true break elif [ "$err" != "0" ] thfloppy diskette you inserted is either not the correct floppy, or you inserted it in the wrong order. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" elif [ "`grep \"annot create\" /tmp/cplog$$`" ] then clear OUTOFSPACE=true break elif [ "$err" = "4" ] then clear ABORT=true break elif [ "$err" != "0" ] then dismount -f > /dev/null 2>&1 clear message -u "There was an error in reading the floppy diskette. Please sten dismount -f > /dev/null 2>&1 clear message -u "There was an error in the restore. Please start over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" else clear FINISHED=true break fi fi fi fi done rm -f $LOCKFILE rm -f /tmp/cplog$$ if $FINISHED then message -iu "The restore is now finished.\n\nPlease press Enter to continue." elif $OUTOFSPACE then message -u "Your system is out of space. Please remove some files and trart over again from the first floppy. If this problem reoccurs at the same floppy, the disk may be bad.\n" else PATTERNS= while true do # loop until user hits Enter or Cancel clear SRET=`shform -u rslist.menu` err=$? if [ "$err" != "0" ] then message "Error $err in menu: rslist.menu" rm -f $LOCKFILE exit fi set $SRET ; eval SRET1=$1 if test "$SRET1" = Enter then break elif test "$SRET1" = Cancel then rm -f rslist.menu dismount -f > /dev/nully again." elif $ABORT then message -u "This restore operation has been canceled." fi 0707070000020263501007550000020000020000031623250000017757000002400000002126usr/bin/Showsoft.sh#sccs "@(#)adminbin:Showsoft.sh 1.1" # Showsoft.sh # PURPOSE: List nstalled software # CALLED BY: /usr/lib/ua/Software # REQUIRED FILES: Showsoft.menu # ------------------------------------------------------------------------ ERROR1="An error has been encountered in t   he menu file Showsoft.menu\n Please notify AT&T User Support. Thank you." ERROR2="There are currently no software applications installed.\n\n Press Enter to continue." ERROR3="The command provided was not recognized.\nPlease use Enter, Cancel, or a defined function key." TERMCAP= export TERMCAP umask 022 CONTENTS=/usr/installed/CONTENTS INDIR=/usr/installed if [ \( ! -r $CONTENTS \) -o \( ! -s $CONTENTS \) ] then message -iu $ERROR2 exit fi # Execute the menu while true do RET=`shform -u $UA/ShowsoPB`T. .N1"| (vB. .N1"| (lB. .N1"| (jNRp@n`. .N1"| (l# X. .N1"| (v# X. .N1"| (z# X. .N1"| (j X. .N1"| (jJ1fT. .N1"| (jN`4R`T.N1FB XB`.N1"| ' dmp./< k/< .N1XO"| 'AHPN1POJgtp .p8/ 9 X"逐"| AHP/< qN,~O p .p / 9 X"逐"| AHP/< .N1XO"| 'AHft.menu` if [ "$?" != "0" ] then message $ERROR1 exit fi eval set $RET if [ "$1" = "Help" ] then /usr/bin/uahelp -h $UA/admin.hlp -t "Show Software" else exit fi clear done # ======================================================================== 0707070000020262641007550000020000020000031171660000017757000001700000055720usr/bin/UloginR  @`M, .text@` .data H@.bss  M,PN,6O p .p/ 9 X"逐"| AHP/< .N1XO"| 'AHPN+O . .N1"| (j 1Yf*p .p/ 9 X"逐"| AHP/< s`(p .p/ 9 X"逐"| AHP/< wN+vO . .N1"| (lJf,p .p/ 9 X"逐"| AHP/< {`b. .N1"| (l 1jDD`./< HnN1POp .p/ 9 X"逐"| AHPHnN*O . .N1"| (vA.N1# Xpѹ Xp .p/ 9 X"逐"| AHP/9 XN*fO pѹ X 9 X"逐"|  A"y X.lib ` `pѹ X 9 X"逐"|  A"y X. .N1"| (vJf0p .p / 9 X"逐"| AHP/< N)O 9 X"逐"| A$H 9 XЀ"Ё"| TP# 9 XЀ"Ё"| TTB1 9 XЀ"Ё"| TVA".R . .N1"| (~# XR XR .ܰ Xm*. D/< /< /< /<V/< N*O-@LN^Nu.p/p//< XN1dO rfB .ܰ Xlp./< X/< .N1XO"| 'AHPN1POJff`NVHp f y J-hS. .N1"| ' 1g/< `N1X OQ./HJf/H#0NX/N1x0<N@NVp.0y0 /N1XON^NuNVHN1$p.BN1 XO.4Zp/N1nXO`Bp//< 0. .N1"| (zA.N1# Xpѹ Xp .p/Hn/9 XN'O pѹ X y XPpѹ X y XPB.. .N1"| (vJfp .p /Hn/< N'O `p. .N1"| (vA.N1# Xpѹ Xp .p/Hn/9 XN'HO pѹ X y XPpѹ X y XPB.. .N1"| (l 1RJjDD`.HnHn/< .N1XO"| (t1HH//< .N1XO"| (j1HH//< /< WN1O. W/< .N1XO"| '/1/< .N1XO"| '/1/< .N1XO"|9 XN1XO"| 'AHP n/N0O Bp//< 9 XN1XO"| 'AHP n/(N/O Bp //< 9 XN1XO"| 'AHP n/(N/O . 9 XN1"| 'A"n . 9 XN1"| 'A"n Bp0//< 9 XN1XO"| ( AHP n/(N/.O Bp0//< 9 XN1XO"| (:AHP n/( N.O . 9 XN1"| (jN n hJg . 9 XN1"| (tY`. 9 XN1"| (tN n ( `o# `R XN1 @-HfR `. i/< ]N1RXO @-Hf (:AHP/< .N1XO"| ( AHP/< .N1XO"| 'AHP/< .N1XO"| 'AHP/< BBp/N14O(`# fFBBBBB/< N'JO-@ g%| g%r g%h y -h f` X f> y J-hS. .N1"| ' 1g%p./<  y J/N1POJf. ` y J.N3Jg. BBp/N14O `" y J./< 1/< %/< p/N14O-@ g$ y J./< JHnN1POB`R .C1HH"|0 1HHr€f .CB1. P/<0   /< N$PO-@ g$ g$ g# y :-hBB`.N1"| ' emp./< \/< .N1XO"| 'AHPN1POJgp.Hn/< .N1XO"| 'AHPN1POJgl. .N1"| 'A$H .Ѐ"Ё"| # .Ѐ"Ё"| B1 .Ѐ"Ё"| A".R RR .а Xm .Ѐ"Ё"| B .Ѐ"Ё"| B1 .Ѐ"Ё"| BpMf!B/<0/< jN"PO-@ g"r g"h g"^ y 6-hSHn/< .N1XO"| 'AHP/ .N1"| (lJf*p .p/ ."逐"| AHP/< Q`d. .N1"| (l 1RJjDD`./< VHnN1POp .p/ ."逐"| AHPHnNO RR .ذ XmJ `g\ 9 `RJjDD`./< [BBp/N14O` g g f .LN^Nup`B` .R"y B1pnB` .R"y B1pn# . /<0/< NPO-@p f y   gzJgtB`Rpo ."y J1fB`Rpo& ."y 1HH"|< bHn9N1OBp/HnHn`t fBB y J-hS. .N1"| ' 1g!Bp//9 >/< .N1XO"| 'AHPN!O Bp//9 T/< .N1XO"| 'AHPN!rO . .N1"| (j 1Yf # ` # . /<0/< N!~PO-@ g! g g p./9 >/< .N1XO"| 'AHPN1POJf`p./9 T/< .N1XO"| 'AHPN1POJf,p-@. .N1"| (j1"y jg \p./9 >/< .N1XO"| 'AHPN1POJ0 1HHr€f y HH"|0 1f. y  0m" zn .аf y  :o" Al. BBp/N14O `-y `-y X-y XB`p./< .N1XO"| 'AHP/9 N1POJf. .N1"| ' dmp./< /< .N1XO"| 'AHPN1POJf. .N1"| 'A./< BBp/N14O-@ g-n. .N1"| (~Jf 9 XR X-@`. .N1"| (~-q. .N1"| '-q y J(.N`. .N1"| ' g6B` p./< .N1XO"| 'AHP/9 >N1POJf. .N1"| ' dm`p./< $/< .N1XO"| 'AHPN1POJf,. .N1"| 'A./< *BBp`2. .N1"| ' dm4p./< a/< .N1XO"| 'AHPN1POJg. >/< g`R .а Xmp./9 >/< .N1XO"| 'AHPN1POJglB` .CB1Rpn. >/< HnN1POHn/< .N1XO"| ( AHPN1PO. .N1"| ( A.N1. >/< /<dm4p./< /< .N1XO"| 'AHPN1POJg&. /< BBp/N14O-@`R .а Xm"Bp//< .N1XO"| 'AHP/9 NO Bp//< .N1XO"| 'AHP/9 NfO B`&. .N1$ ."| 'B1Rp n. .N1"| (tN. .N1"| (lJf*p .p/ ."逐"| AHP/< `d. .N1"| (l 1RJjDD`./< HnN1POp .p/ ."逐"| AHPHnNfO y  yg Yf. .N1"| ( .N1XO"| ( AHPN1PO. .N1"| 'A./< HnN1POB`R .C1HH"|0 1HHr€f .CB1Hn/< HnN1O HnN1bXOHn/< HnN1O HnN1bXOp-@Bp//< .N1XO"| 'AHP/9 >N4O Bp//< .N1XO"| 'AHP/9 TNO . .N1"| (jq y jHH.N1. .N1"| (jB` .R"y >B1pnB` .R"y TB1pn. .N1"| (~-qp .p / ."逐"| AjY`. .N1"| (jN. .N1"| '#. .N1"| '#d. .N1"| 'B1. /< /< .N1XO"| ( AHPN1POB` .R"y B1pnB` .R"y B1pnp .p8/ ."逐"| AHP/< N&O p .p / ."逐"| AHP/< .N1XO"| 'AHPNO p .p/ ."逐"| AHP/< .N1XO"| 'AHPNO . .N1"| (j 1Yf(p .p/ ."逐"| AHP/< `&p .p/ ."逐"HP/< .N1XO"| 'AHPNO p .p/ ."逐"| AHP/< .N1XO"| 'AHPNO . .N1"| (j 1Yf(p .p/ ."逐"| AHP/< `&p .p/ ."逐"| AHP/< NZO . .N1"| (j1.g.N.N r y JJfN$fJg.N!` f. /< /< p/N14O -@ g / VB9 VB` .R.N1"| (lB .ذ XmB `. VN%-@BB`.N1"| ' dm.| AHP/< N&O p. ."逐"| AHP/< "NPO ."逐"| B1. .N1"| 'J1f ."逐"| A$H .Ѐ"Ё"| TP# .Ѐ"Ё"| TTB1 .Ѐ"Ё"| TVA".R . .N1"| (~#. .N1"| (lBp .p/ ."逐"| AHP/< )NO .Ѐ"Ё"| TPA# J . .N1"| 'B1BHxA/< .N1XO"| ( AHPN1POJm|. .N1"| (lBp .p/ ."逐"| AHP/< .NLO pd./< .   N1XO"| '/1/< .N1XO"| ( AHPN16PO. .N1"| ( A./< XN1XO. 3/< XN1XO. X/< .N1XO"| ( AHPN1XOJlF`. XN1 "| XB1.N1. .N1"| ( A.N1`>. 6/< XN1XO. X/< 8N1XOJmB/< ;N1XO-@oB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. O/< XN1XO.Hx/< XN1PO-@obpd./< .N1XO"| '/1/< XN16PO./< V/.N1,PO-@o2./g`.N1B.N1BB/< CN1XO-@rgB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. Z/< XN1XO.Hx/< XN1PO-@opd./< .N1XO"| '/1/< XN16PO./< V/.N1,PO-@o./< V/.N1POg`.N1B.N1BB/< {N1XO-@rgB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. /< XN1XO.Hx/< XN1PO-@onpd./< .N1XO"| '/1/< XN16PO.< V/.N1POg.N1B.N1B` .N1B.N1B`B` ."| XB1Rp0n. .N1"| ( A./< XN1XO. Y/< XN1XO.Hx/< XN1PO-@oNpd./< .N1XO"| '/1/< XN16POp6./< /.N1PO.N1BB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. c/< XN1XO.Hx/< XN1PO-@o8pd./< .N1XO"| '/1/< XN16PO.N1BB` ."| XB1Rp0n. .N1"| ( A./< V/.N1,PO-@o./< V/.N1POg`.NN L  9 XذfR XR XR ``. `Hn9N1tXOJf. .N1"| 'A.Hn/< xHnN1O -y n nA(-Hp .p0//HnNVO B` .R"y xB1p nB/<0/< NzPO-@ g g g y x  gp.HRN1(XO .` fJg./< N1XO`N`NVH$nJf%rg4B` ."| XB1Rp0n. .N1"| ( A./< XN1XO. /< XN1XO.Hx/< XN1PO-@opd./< .N1XO"| '/1/< XN16PO./< V/.N1,PO-@o./< V/.N1POg`(.N1B.N1BB/<  N1XO-@rgB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. #/< XN1XO.Hx/< XN1PO-@opd./< .N1XO"| '/1/< XN16PO./< V/.N1,PO-@o./< V/.N1POjrvB*B* B* p.HRN1.XO-@Jm0Jg4././.B/*^N1O-@`N1` LN^Nu*g*p.HRN1.XOB* B* p.HRN1.XO* jv(g jv(p.HRN1.XO-@pfN1-@m .^g`Jl$. /< /< p/N14O ` gL g@ g4 g( fJg./< N1XO`J g. n N-@ g g gp fp.HRN1.XO .`JfN`NV.4Zp/N1nXON^NuNVp# `.Hx/< N1PO-   @o~p./< X/.N1,POrfNp./< .N1XO"| 'AHP/< XN1POJfp.p//.N1PO# `p `fBp//.N1PO-@@.p//.N1PO. XN1. .N1"| (z# Xp./< .N1XO"| 'AHP/< XN1PO. .N1"| '# X. .N1"| (j XB X. .N1"| (j Xp./< X/.N1PO.N1BN^NuNVB` ."| XB1Rp0n. .N1"| ( A./< XN1XO. /< XN1XO. )/< XN1RXO @-XOJf` >   4 4if [ "$SHFLAG" != "1" ] then exec /usr/bin/ua fi EXPERT= Name = Office of .........Name = Filecabinet of .........Default = Open Open = EXEC -w /bin/su - .........Open = FM /u/......../Filecabinet Help = EXEC -   d /usr/bin/uahelp -h /usr/lib/ua/ua.hlp -t "Other Users"  TP TP    , R R = I   W Xtall DELETE USER ERROR : user install cannot be deleted DELETE USER ERROR : user %s is still logged in and cannot be deleted admin.hlpDelete Userdelete user : %.10s %.13sDelete UserNONE/u/%s/Filecabinet/%s/%s exists in %s's Filecabinet./u/%s/Filecabinet/%smkdir %s >/dev/null 2>&1 Error, unable to create folder, error : %d, System error : %d //u/%s/Filecabinet/cd /u;find %s -print |cpio -pdlm %s >/dev/null 2>&1find %s -exec chown %s {} \;rm -r /u/%s >/dev/null 2>&1rm -r /u/%s >/dev/ ADD DELETE CHANGE COMPUTE USER USER USER SPACE ADD DELETE CHANGE SPACE No YesMove Delete Nothing Select action to be taken on users files :Move Select Move/Delete/NothingEnter new folder name : ERROR - Folder Enter folder nameLogin Name :null 2>&1uaupd -r "Office of %s" Others >/dev/null 2>&1uaupd -r "Filecabinet of %s" Others >/dev/null 2>&1-deleted- NONEChange UserNONE ERROR: user %.8s is a deleted user, with active filesNONE ERROR: %s is already assigned /u/%s/u/%s%.12suaupd -r "Office of %s" Others >/dev/null 2>&1uaupd -r "Filecabinet of %s" Others >/dev/null 2>&1YESNo admin.hlpCompute SpaceCalculating user disk space takes 1-2 minutes %ldkUser Login Interface Total space allocated to unknown users :  Enter Login NameUser Name : Enter User Name Expert ? :YesSelect Yes or NoLogin Name : Enter Logon IDUser Name : Enter User Name Login Name : Enter Login NameUser Name : Enter User Name Expert ? :YesSelect Yes or NoDelete UserDelete UserDelete UserSelect a UserEnter name of user to move files to : Enter Login NameDelete UserADD USERChan%ldkadmin.hlpSystem errorsUnable to display formadmin.hlpadmin.hlpSystem errorsUnable to display menuadmin.hlp/etc/pwcntl/Environmentr+ ERROR : Unable to update Environment file /usr/lib/ua/Others/usr/tmp/pwdw+/etc/passwd/etc/passwd/etc/passwd...whor@(#) adminbin:adminbin.sl 1.137 0707070000020263511007550000020000020000031623330000017757000002500000005223usr/bin/Uninstall.sh#sccs "@(#)adminbin:Uninstall.sh 1.4" # Unge Login InformationUser Login InterfaceUSER ID NAME EXPERT SPACE LAST_LOGINAddDeleteChangeSpaceUser Login CommandsSelect a commandDelete UserSelect a Usernope/etc/pwcntlrNONE YesNo %*5dk NEVER User LoginsNEVER Expert user: %c Password ? : %c Create date: %s Last login : %s Disk usage : %ldK User Information Login Name : %.10s User name : %.24s User dir : %.48s User shell : %.48s User ID : %.3d Group ID : %.3d %sAdd User ERROR: Reqinstall.sh # PURPOSE: Delete installed software # CALLED BY: /usr/lib/ua/Software # REQUIRED FILES: Uninstall.menu # MODIFIED FILES: /usr/installed/CONTENTS and the uninstall script. # ------------------------------------------------------------------------ ERROR1="An error has been encountered in the menu file Uninstall.menu\n Please notify AT&T User Support. Thank you." ERROR2="The command provided was not recognized.\nPlease use Enter, Cancel, or a defined function key." ERROR3="A reference file coulduested User Name is invalidNONE WARNING: user %.8s is a deleted userNONE ERROR: %s is already assigned %ldk/u/%s YESNo NEW /../u/u/install/.profile/.profile/.profile/.phdir/Environment/Filecabinet/./Filecabinet./Filecabinet/Profiles/./Filecabinet/Profiles/Filecabinet./usr/lib/ua/1200bps:Am/Filecabinet/Profiles/1200bps:Am/usr/lib/ua/300bps:Am/Filecabinet/Profiles/300bps:Am/usr/lib/ua/9600bps:A2/Filecabinet/Profiles/9600bps:A2/usr/lib/ua/.kshrc/.kshrcins not be found for this tool. It must be removed using UNIX System tools from the UNIX Shell." ERROR4="No uninstall program could be found for this tool. It must be removed using UNIX System tools from the UNIX Shell." ERROR5="There are currently no software applications installed." TERMCAP= export TERMCAP umask 022 CONTENTS=/usr/installed/CONTENTS INDIR=/usr/installed # Trap the delete key trap "" 2 if [ \( ! -r $CONTENTS \) -o \( ! -s $CONTENTS \) ] then clear message -u $ERROR5 exit fi # Execute    the menu while true do RET=`shform -u $UA/Uninstall.menu` if [ "$?" != "0" ] then message $ERROR5 exit fi set $RET # The shell variable $1 contains the string describing the action key # The remaining variables contain the name of the package to be deleted case $1 in # Executable code for the "enter" option follows here \'Enter\') shift eval NAME=$* eval ` grep "^[0-9]* $NAME$" $CONTENTS | awk ' { print "KEY="$1 } ' ` if [ ! "$KEY" ] then message $ERROR3 exit fi export KEY NAME UNFILE=${INDIRtories # /usr/lib and /lib to system V.2 archives (flexname compatible). # TMPLIBDIR=/tmp/convlibs if [ ! "$1" ] then find /lib /usr/lib -name "*.a" -print > /tmp/archives else echo $1 > /tmp/archives fi file -f /tmp/archives | grep "5.0 archive" | cut -f1 -d':' > /tmp/oldlibs if [ ! -d $TMPLIBDIR ] then mkdir $TMPLIBDIR fi while read LIBRARY do if convert $LIBRARY $TMPLIBDIR/newlib.a > /dev/null 2>&1 then mv $LIBRARY $LIBRARY-old mv $TMPLIBDIR/newlib.a $LIBRARY echo "$LIBRARY updated to sy}/${KEY}.un if [ -r "$UNFILE" ] then # THIS LINE ADDED BY FAH BECAUSE SOME Remove files were not executable chmod +x $UNFILE clear newwind clear $UNFILE if [ "$?" != "64" ] then grep -v "^[0-9]* $NAME$" $CONTENTS > /tmp/$$ mv /tmp/$$ $CONTENTS grep -v "^Name=$NAME$" $UA/Uninstall.menu > /tmp/Un$$ grep -v "^Name=$NAME$" $UA/Showsoft.menu > /tmp/Sh$$ mv /tmp/Un$$ $UA/Uninstall.menu mv /tmp/Sh$$ $UA/Showsoft.menu chmod +x $UNFILE rm $UNFILE clear message -iu "The $NAME package is now removedstem V.2 compatiblity." fi done < /tmp/oldlibs rm -rf $TMPLIBDIR rm -f /tmp/archives /tmp/oldlibs 0707070000020215411007550000020000020000031610630000017757000001400000004230usr/bin/asaR   .text .data @.bss .lib  .\n\n Please press Enter to continue\n" I=`ps -e | grep ua | cut -c1-6` for i in $I do kill -16 $i done fi exit else clear message -u $ERROR4 clear fi ;; # This is the Exit code if command is cancelled \'Cancel\') exit ;; # This is the Help code \'Help\') /usr/bin/uahelp -h $UA/admin.hlp -t "Remove Software" ;; # Unrecognizable return from action key *) clear message -u "$ERROR2" clear ;; # End of main case based on the action key esac clear done # ======================================================================== 0707070000020263521007550000020000020000031623450000017757000002100000000535usr/bin/Users.sh#sccs "@(#)adminbin:Users.sh 1.1" # Users.sh # PURPOSE: add, change, delete users from /etc/passwd # CALLED BY: Admin-kit # MODIFIED FILES: /etc/passwd /u/$user/Environment # ------------------------------------------------------------------------- umask 022 Ulogin I=`ps -e | grep ua | cut -c1-6` for i in $I do kill -16 $i done 070707000002026353100755000/< N1X OQ./HJf/H#0N`.Nr.BHx?`p.`BBHx@`./*Hx;`B/*HxB`B/*HxC`B/*HxD`./*/*`./*/*/*`. k/9 k//*N_O `. .data fx@.bss f f2.lib N^`p# k. +N8T`. k//*` ./*/*Hx!`./*Hx#N`PO`\BHx&`B`.Hx'`BHx(`BHx)N`vXO`../*/*/*`./*/9 k/*Hx$NaO# f`n./*/*Hx%`&SrxbR@0; NJy4FBRFBR`lF`lFBBBBFBB 8lvF",6@JVBbpBB~RBBBBBFFFBBPFZ^j~bFFBBR&B>L\Bpx|FRPJm  kf&-lp`Jgj# k$K/< N1X OQ./HJf/H#0N%/N1x0<N@NVH<# f k|#  "| !D(1f 列# f "| \&1 则 "|  1ДR$ l& "| $1 "| #, 1"Dg "|  1"| $1` 列# f "| \&1 则 "|  1ДR$ l$ "| $1 "| #, 1"Dg "|  1"| $1# k# k# k| 9 k`NV 9 I @\r .N1SJgrf# @ Ip}N^NuN(Jgp`R +0` <.` <` <`p` </` <0`# f`*# f` # f <:`# f <9`x# f`i kB kB kB kB kp# k&y k|(y k$9 kX k|e. *N8T`(X& f` 9 krb@0; NJr. *N8Tp# k`J "|  1&m. l& "|  1"| #, f `YLYK i$d`J kf pL<N^Nup# k "| &1 o|J klN # klB kֹ kmV m`L "| &1 "| #, 1 kf(p# k# f f$J koS k` "| &&1pfBJ klN # klB k*| `Ppf -f`J Yf4./*/*Hx# f`# f`# f`# f`#I f <I`(#J f <J`# f` # f <-`# f`# f`# f`# f`. mN1VJfB/< k/< JN-$PO`. mN1V.N8# f <K`v <L`lp# m. kp//9 +8/9 +4B`z. mN1-@-A. kp ///.B/< mN,4O# f <1`# @ IR +0` # @ Ip;` <#` <$` <!` <"` <&` <'` <(` <)`# f <`|# f <*N_O @# Z`p# k. *`# f`# k f`./*Hx.` ./*Hx/N``.Hx0`zBB/< k/< *N-$O /NaBXO./Hx `p`(.HxL`># f`t.N.`B`p./`R./*Hx3`|BHx8N`J`p.B/< k/< *N-$O /NaBXO./`,p.B/< k/< *N-$O /NaBXO./*Hx4` ./*`./*`./*/*`. k/*/*Hx5` ./*/*`. k/*/*Hx N``H./*Hx7`./*Hx `./*Hx`./*Hx`r./*Hx`d./*Hx`h# f <`T# f < `@ <5`6 <7`, <%`" <8`p`p# f <4`p`p`p`. kp//9 +@/9 +` <?`. K0` 9 m R m "| lt m m m./<Nu n./< KHxN8PO`NVH $n-Jt`V0(HH` mNR R"| yA"HHmRJ` mNv R"| yA"HHJgp-fJo | yJ0(gJg` "| yB1Jg .N1HB. yN0d @ L N^NuNV. KHxN8XON^NuNVH $n * ?g\n& gJ ;g =g@ >g8` @g, Ag Bg Cg Df. `B t` "| zBR o.NHn * S//< uNO Jg&. N& * "| u#L N^Nu ."| u&q * # KKN8TXO# @ IN-@mZ .rZb@0; NJ[,<<gR @gJ Ag Bg~ Cgn Dgj./< KHxN8POpLN^Nu * "| z g * #R >fP jJfHp`. `. N `. NJf(.N Jg`.N$. NJgJgp`nNV n gF n-h n ( AgBn g` ;g$ Bg Cg Dg N^Nu.N.N` n"n f I.N^Jf`.Nn` 9 "| z g 9  JfE (R 2fJf-jg n 2gN-@"nRB-L 2o ."L`l 2l < 2"| 2A-H(H .I Ib "ЀЁ"| @\Ag< ."| I1HH"nI IbL "ЀЁ"| @\Af4 ,"ЀЁA @\g0 ,"ЀЁ"| @\E&`$j g (R 2fp` KYK nc" nSBJg S# qg y qJo# q "| JvJ1gd`8YK nHH# llp llf J y JR J lo y q D. S/(NXOrg nb nHH# #R `NVH. $n JgfpLN^Nup`NVH t`^ "n-q n  f>v` pѮ n "| z fR m n pL N^NuR op`NVH .R.N1B @-H-HfN n t`" "| z f pѮ n R o n LN^NuNV H t`" "| zBpC(C(R ot`A.r(A(R mB B* y u# q$H-Rt`X-R C# .C ."| ~-q n (=rb@@0; NJ@J# q  mR# ld"| mB1 y qX q LN^Nu nHH# llp llfS J y JR J lo`J9 mf# m Jp`N mHH# JJo8 y +,Sm y +,"hR J`. +,p9 J/N1XO-| m` NVJfpN^Nu nJgX  fp`NVNN^NuNV y +,Sm y +,"hR. N^Nu. +,p. /N1XO`NV# llp llfS J y JR J loN^NuNqNV.BBBHx=N`O /HxBN`O /HxAN`PO-@B/HxN`PO-@B .N@ 9 "| ~#p#  n&(A 08gA8 .*R*C.A"`v lpg*A 08gA8 .*R*C.A"R` n-h`F g< nHHC 1g&HHC .*R*C.A"nR nJf`Tv`Fpg> n./N(XOJf*A 08gA8 .*R*C.A"R mRmp-n*&BB`BBB"| q q ( . q  f p-@`6-n-n&* ."| q$q-Rt`X-R .C 1g.C 1g" .C .RC# ."| ~-q nz.NN-@.N n N^NuNV n ( ?gjn& gH ;g =gL >gD` @g8 AgZ Bg Cg Dfx n. N n h `X n!y 9 R "| ~#N^Nu n. NN n.NB n h !n n h!n` n./< KtHxN8PO`NV n ( ?g^n& gJ ;g =gB >g:` @g. Agh Bg Cg Df~ n. `V n ( "| uJg ( "| u.N1H n ( "| uB` n. NB n.N6Jg .N1HBN^ (=rbr@0; NJJ n&(AJ08fHA.J08ff n..HH/NXOJf( ?f n..HH/NXOJfd C 1"| u$q-Rv`O Jgb mN. N(R ."| q#R .CA.HH R .C#`6Jg4R .CA.HH R .C#RR .ް*m .R.N1B @-HfN .C#Jg nr ` n nB$@ gJ g . N1HB `tp.N1B$@ f./< QZHxN8PO.N$%n  .".N1%@%n .N,$ "n%q "n# J LN^NuNVH$nt`pԀJfp2. N1LN^NuNVH $n.N"n &q`2.HRN1XOJfJg . f K L N^Nu&k fʑ`NVH$n.Nb f. QvHxN8XOp *g JfB ( . ".N1%@N1LN^NuNVH$n.N f. QHxN8XOp *g JfB (*fJg .N1HBtpѮ`2 ЀSC 1"n" ЀC q"n#HRPoR .ְot`t "| qJg .N1H "| qB C-q n!nv` "H 1C&q "H#R noRo-n n-Pm* .ѮJg nrf h L N^Nu n`SQ`NVH $n&n g\pfPj.fRK$j$lpL N^NuJf`( ` HHgSQJJf$j$mJfp`NVpf. LHxN8XON(`l y P `\ y P"n "Q`H n P -gB +( n # n"n p . N @%H LN^NuNVH$n (fJ (fN7D.NT*f:.N9RJg$.N1N1%@*f`%y P *N1LN^NuNVH$n (fJ (fN7D.N*f*fJg .N1HB *N1-@-A *N1N1./.N1XOJf *N1-@-A.//< Q` *N1-@-A./ y /HnN1O HnNXO%@p  j LN^NuNVH$n*g./< QHxN8POp f6 *N1-@-A. ///*/HR/< QHxN` n ./< L y QSm y Q"hR@H` . QN1$p gpf (c. (/< ZHxNfPOBJ mgNZpf (c~ y rè y PxN1XON^Nu Ml ."| LD./< P`./< PN1XO`NV o Mm-| ."| LD q N^NuNqNV. kp//9 P/9 P/< PNfXO//< PN(O. kp//9 P/9 P/< QN4XO//< PNO. kp//9 P/9 P/< (/< QNO# . kp//9 P/9 P/< QNXO//< QNOX# . kp//9 P/9 P/< QNXO//< QNZOX# . kp//9 P/9 P/< QN^XO//< QN OX# . kp//9 P/9 P/< Q$N$XO//< Q NO y A&H K N1. Y/9 YN1XON1"K" y rè y pL N^Nu ` 0 Qg . QN1FB QS X J o(J Qfb y .p=/NhXOJg`p`NV-n`R n =f nRB. kp//9 Y/9 Y/.N0dXO//.N,4O-@./N-XON^NuNVH $| (&| 0B y P  fB`RJ`JgRpdn. (/< ZEHxNPO ."Ё"| R1fD ."Ё"| RJg ."Ё.N1H ."Ё"| RB ."Ё"|X# . kp//9 P/9 P/< Q+NXO//< Q&NOX# . kp//9 P/9 PB/< Q0N~OX# . kp//9 P/9 PB/< Q9NPO# $ @A# . kp//9 P/9 PB/< Q nJg .N1H np`Dp-@ n (lg@ n,|l n,dpѮ, n,B` n (lfp`p-@`p`BJf*Hn0/< \3/.N1O .N1 Ѯ`J f.(/< \6HxN8PO. NC""2 n -h pg.$N.tN1-@pf, .N1-@-A./Hn0/.N1O `Xpgpf .N1.`(pf0 n$Jf | \Y` .$N. @.Hn0/.N1POA".?(NhTO.N1 ѮR` nB n N^Nu nJg %fD n (%f nR%pѮ`A0-H,` n am zn n lfR n,R,"nfB nrè nN+8"n#@ n.p//9 [/9 [/< [N0dXO//.N,4O-@B.|A"| "2 | N^NuNV n.NC"2 n(g n-h`.N.-@A.?(NTO. n/(N%rXO-@  fpg  fJf | [` | [ "| "2 | N^NuNV n.NlC"2 .f .fp`p-@A.?(NhTO . .g< /g 0fJgr`vJf `l. /< [HxN8POJfF n.NC"2 .f .fp`p-@A.?(N n,B n,Ce.(/< \HxN8PO nHHrcrb@0; NJNV n P-h n.NC"2./.N.XO/NXO-@A.?(NTONHC"2 n!n nr!A A"| "2 | N^NuNV n.NC"2.N.tN1-@A.?(NTO  g: n.NXC"2.N.tN1-@A.?(NZTONC"2 .  rb@0; NJ"Px. /< \ZHxN8PO .N1-@-A .N1./.N1`h .   N1-@-A .N1./.`: .N1-@-A .N1./.N1` .N1. [4/9 [0N1XOJf. \yHxN8XO .N1-@-A .N1./.N1` .N1. ['?A B@;1Az^qx<=7wl/tMLfKFighYjX2 W$^8 %&b7y!#53"_` %&!"7 %&!#"7^7-.Vb^_`cdeZ[\]7*b!# %&7!#" %&77!#53"!#" %&*7 %&7!#"r^"ks-. %&_`cdeZ[\] nopmb!#"7" %&q %&_`cdeZ[\]b!#7" %&_`cde %&7!#" %&7y7!#!#"" %& %&77Z[\]^Tb!#7y" %&_`cdeZ[\]7^!# "bU %&!#"_` %&!#!#r"!#s" %& %&J!#!#"qr"s %& %&!#"!#"    %&q %&!#" %&!#!#"" %& %&!#JJMCA#h85""rt5OC(MJ34/z)!#"" %& %&nopm!#"6 %&66PQ6nopm6666666'! JJJ~B//sF9(}|{8C6z-4&y1xv   64NO66S666666646{|}~4a6664:H66664           4644u4v444466444HH44444444     {{/(0845 7-+IJ1<2KL;{./{,:9(+-*/%IJ-($IHFE 9/z)(((([}&'(){!#$}@=>?^$())))),,(((}}{/;BCD)),,,]"}9|(02)2./   ));%},),)));2;)))))BuC<uDEFGP7 !"JgA`auug8 GFE56%HI1234tg9999999999'9)9999(99998999J99*999199,9/999$999949-99099939.9+9=9gmuJJfhg g>@RSTUVW^+_,-./09#ijlnoqrgceg=uQYZ[\$KLMg;psNOgX]k:bd; ;?' O=>a9: O P'k4}4~6SS;V4}6=;69SS OXZ !QU"#=W$9)*  vgg;&(;g;gygxwyacc stack overflowsyntax errorbailing out$zero&null$record$record$record$recordillegal statement00>># >:>;>>>>>>>>>>>>>>9>9>9>9>9>>9] O[Yb c#g%$h&\\\\\\\\\\%i'&j?@g<()h*+,,q-67.</)m0?@1!d!e(l2+p/v0w2{3453|R*n8>9>9>9>9>9>9>9>9>9>9>>!> >>#;>UPOUUYXYWYNMINFNGNCNBNENLNAN?NNHNDN=<  K-r.t*o-s Aj.u??\`lm A B !1x1yn#p1z$?qot8u?s%o&v88 Cw\`< D E F G's H I Ay()x*"99999999999&92999999999 QTRSV@KK999999979%999699599+,z-x{./ J0 AS128 C345 D E F G H IS8 K L M< JTTTTTTTTTT<L   < NLLk K L^ M__________TTTTTTTTTTTTTTTTTTTT` NL"f"f"f"f"f"f"f"f"f"fL .$ 2 ., 2 .4 2 .< 2 .D 2 .L 2 .T 2 .\ 4 A .d 2 .l < .t 2 A .| = 2 . 2 . 2 . 2 . 2 . 2 A . 2 A . 3 A . 2 A . 4< A . 2 . 3 A . 3t A . 3 A . 4 A . 3 A / 3 A / 2 A / 4l A / 3 A /( 4D A /0 3 A /8 4 A /@ 4 A /H 4 A /P 5T A /X 54 A /` 2 /h 2 B 2 /p 2`"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f B 2 B 2 /x 2 / 2 / 2 / 2 / 2 / 2 / 2 / = / >$ 2 F / 6D A / 2 A / 6 A / 5 A / 54 A / 5 A / 5T A / 2 A 0 2 A 0 5 A 0 6 A 0$ 2 A 0, 6$ A 08 2 A 0@ 5 A 0L 6 A 0T 6T A 0\ 6\ A 0d 6 A 0l 6$ A 0t 6d A 0| > 7\ A 0 7 A 0 6 A 0 6 A 0 2 A 0 2 A 0 7 A 0 6 A 0^^^^^^^^^^^^^^^^^^^^``^```````````^` 6 A 0 2 A 0 6 A 0 6 A 0 7, A 0 2 A 0 7 A 1 7 A 1 2 1 2 A 1 9 A 1( 2 A 10 8 A 1< 8 A 1D 2 A 1L 8T A 1X 8l A 1` 2 A 1l 8 A 1x 8 A 1 2 A 1 9 A 1 8$ A 1 8 A 1 2 A 1 2 A 1 8 A 1 2 A 1 2 A 1 8 A 1 2 A 1 2 A 1 2 A 2 @L @h  0000000000AAAAAAAAAAAAAAAAAAAAAAAAAAA 2 2 2 / @ 1 1 @ 1 1d @ 2 2 - ,L @ 1 2 @ 2 +P 2 +X 2 +d 2, +l 2 +x 2 + 8l + 24 + 2, + 2T + 2 + 2| + 3$ + 2l + 9T + 24 + 2 + 2 + 3 , :| , 2\ A , 2$ A ,$ 2 A ,0 2t A ,< 2\ ,H 2< A ,P 2 A ,\AAAAAAAAAAAAAAAAAAAAAAAAAA m $record%onewline in regular expressionnewline in stringstring too longnewline in character classstring too longbad switch yylook %d%Wunknown type %d in penter unknown type %d in freetrregular expression too long unknown type %d in cfollunknown type %d in first %WUsage: awk [-f source | 'cmds'] [files]rcan't open %s-d%W N N 2 A ,h 2d A ,t 24 A , 34 A , 3D A , 2 A , 2\ A , 3 A , 2 A , 24 , 2| , 2 , 2 , 2 - , - 2 - 2 - 2 -( 6 -4 2 -< 2 -D 3 -L 2 -T 2 -` 2 -h 2 -p 2 -| 2 - 2 - 2 - 2 - 2 - 2 - 3l - ) - 2 - 2 - 2 - 2 . 2 . 2 . 2 . 9 N N N N N N N N N N N N N N O O O  O O O O& O, O2 O7 O> OC OF OL OS O[ Oa! Od" Oi# Oo$ Os% Ov& O{' O( O) O* O+ O, O- O. O/ O0 O1 O2 O3 O4 O5 O6 O7 O8 O9 O: O; O< P= P> P ? P@ PA PB     PC P$D P*E P3F P;G PDH PLI PQJ PVK P\L PeMFIRSTTOKENFINALFATALLTLEGTGEEQNEMATCHNOTMATCHAPPENDADDMINUSMULTDIVIDEMODUMINUSASSIGNADDEQSUBEQMULTEQDIVEQMODEQJUMPXBEGINXENDNLPRINTPRINTFSPRINTFSPLITIFELSEWHILEFORINNEXTEXITBREAKCONTINUEPROGRAMPASTATPASTAT2ASGNOPBORANDNOTNUMBERVARARRAYFNCNSUBSTRLSUBSTRINDEXGETLINERELOPMATCHOPORSTRINGDOTCCLNCCLCHARCATSTARPLUSQUESTPOSTINCRPREINCRPOSTDECRPREDECRINCRDEC?$recordrcan't open %srecord `%.20s...' too longrecord `%.20s...' has too many fieldsrecord `%.20s..RFIELDINDIRECTLASTTOKENlex: %c lex:? %o lex: %s lex:? %o %W00$zero&null$recordFS RS OFS ORS OFMT%.6gFILENAMENFNRout of space in makesymtabsymbol table overflow at %scan't set $0can't set $0%.20gillegal reference to array %sfunny variable %o: %s %s %g %oout of space in tostring on %s%W Y (.' has too many fieldsNFfield %d: |%s| built giant record `%.20s...'trying to access field %dawk: %s near line %d awk: record number %g %Willegal statement %ounexpected break, continue or nextunexpected break, continue or nextunknown boolean operator %dunknown relational operator %dout of temporaries in gettempformat item %.20s... too long%snot enough arguments in printf(%s)illegal arithmetic operator %ddivision by zerodivision by zerodivision by zerodivision by zeroillegal assignment operator %d%s%d%d%s is not an arrayillegal jump type %dillegal function type %dstring %.20s ... too long to print%stoo many output files %dwawcan't open file %s%s%Wout of space in ALLOC$record\\\@@@@@@>>\IVIVIVIVIVIVMTMTMTMTMTMT\\\\[SHSV2\VWXYYYYCz\E=h\\\\\\\\P\\\LLLL\\\C ` ` ` ` ` ` ` ` `" `' `+ `0 `1 `5 `9 `= `A `E `H `L `Q `V `[ `` `e `f `g `h `i `o `v ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` a a a < <= > >= == != ~ !~ + - * / % - = += -= *= /= %= printprintfsprintf splitif(while(for(instatnextexitbreakcontinue || && !fncnsubstrsindexgetline ++++----$(@(#) awk:awk.sl 1.4 DV)@0bJ P?AՀKg@s&~ w??栞f;?+\a ?0?{&loglog: DOMAIN error loglog: SING error loglog10log10: DOMAIN error log10log10: SING error log10!   ??sqrtsqrt: DOMAIN error sqrt?D*?K*?>3c U?D \(?(Q?T'o@.B9G>P??Ge+?0+\a expexpexp fhG flG fp ft fyGB`XB`D ."n1HH". g"pU. .N1$ ."n  RpnRpnpLN^NuNVHB`6B`$pU. .N1$ ."n  RpTnRpnLN^NuNVHB`pU. .N1"nB1TpS-@`FpU. .N1"nA9 f(pU. .N1$ ."nB1SJlpU. .N1"nA./< N1XORpndLN^Nu f~G f f fG f f f ww">IH> I>qRt%G$8EB9   "">exppowlogsqrtsinhcoshsincostanacosasinfmodFPA hardware failure occurred 0707070000020215421007550000020000020000031610670000017757000001700000005740usr/bin/bannerR  T .text .data @.bss  T.lib 4 4> @"AAA"(>>A>@@>A>A>@BBB@@~A>>A@~AA>B>AA>AA>>AA?A> >>>A>A]]^@>"AAA~AA~AA~>A@@@A>~AAAAA~@@|@@@@|@@@>A@OAA>AAAAAAAA>BDHpHDB@@@@@@AcUIAAAAaQIECAAAAAA~AA~@@@>AAAEB=~AA~DBA>A@>A>AAAAAA>AAAA"AIIIII6A""AA" > >@ >>" !?!!>!>!!>! !>!!!!>? > ?? > ! '!!!?!!!!!"<$"! ?!3-!!!!1)%#!!!!!>!!> !!%">!!>"! !!!!!!!!!! !!!-3!! ! ?? ` 0I #@Usage: banner "up to 10 char arg string" . . . %s @(#) fndcmd:fndcmd.sl 1.68 0707070000020262111007550000020000020000031551420000017757000001300000037474usr/bin/bcR | <<; .text< .data < @.bss < <;.lib Z Z/< 4N1X OQ./HJf/H#0N.Hx p=`p!.Hx `N# |r*fp# |Nr*fN# |r/fp# |Nv-@p# |`Nd-@p gp gp\gpzm*pan N.# |pa |npz |mpifpf |f -|`tpwfph |f -| `Vpffpo |f -| `8psfpq |f -|`prfpe |f -|`pbfpr |f -|`pdfpe |f -|`psfpc |f -|`pbf pa |gpifpb |f -|`rpofpb |f -| Z$9 ZX Ze. N&`(X& '$` 9 Zrb @0; NJp. Np# Z`J "| 1&m. l& "|  1"|  f ` YLYK Xpd`J Zf pL<N^Nup# Z "| &1 ozJ ZlN@# ZlB Zֹ ZmV m`L "| &1 "|  1 Zf(p# Z# ' '$$J ZoS Z` "| &1pf |J ZlN# ZlB Z*| \`Ppf -f` *.N`:.  9 "| @/1/< /9 '/*/9 'p/NO./9`Tpdfpi |f -|`6pafpu |f -|`plf#  ' `* y R  ' e. NNnNN-@r"f y R B <`NVN$# |g .N^Nup# | . `NV`x"9 '(TmN#0 S,S2+)'(S*  Z$K "| <(1f 列# '$ "| X&1 则 "|  1ДR$ l& "| $1 "|  1"Dg "|  1"| $1`l 列# '$ "| X&1 则 "|  1ДR$ l$ "| $1 "|  1"Dg "|  1"| $1# Z# Z# Z 9 Z` 2S -  >, S.:   O QRPO C?QRPs QRPO QRP01345678<=s 345678QRP+01)'(*345678/;@D01345678 @ #(00 ( + . 1 4 7 : = @ C F J N R V  Z \ ^ ` b d ,<=345678345678345678EFAB345678345678EFAB345678345678N_+)'(*fghijklmnrtvwxyz"   +{|)'+(*)'(*,+)'(*+)'(*+)'(,*,,r,+,)'(*{ ~-(? _ ;+-*/%^=[((=(==~(((),[)),2) l'l&%lllllllllWClllllll$l"l}(=([====[[){]]),[))(;<>   ));=])]]]))=},rT efgpppll jt\MlllllllllllllA:2/llllllll^ll ll4OS\lmn()sw9< !"#ACEGIK&%^3Tefg:BFJ;DHLRPo124567 NhjT0q^Q[b a_] [U@ZT RC   tx8MZ'UV_`abcdY]$=?ik*+,-./8>@ %u%WXv 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14abcdefghijklmnopqrstuvwxyz.string space exceededrcannot open input filebundle %d elements at %o bundling space exceededroutput(%o) [           ]s%s teletypec[%s on line %d, %s]pc SLs.0SLs.rcannot open input filequnrecognizable argument /usr/lib/lib.b/bin/dcdc-/usr/bin/dcdc-yacc stack overflowsyntax error0Qps.[]Ps:ls;:QQ0Q0QkKkiIioOofYc s.s. S+-*/%%^=><!=!>!< 0!=+- 0-*/%%^;ld1+sl1+dsl1-dsld1-s;d1+:;1+d:;d1-:;1-d:Kd1+kK1+dkKd1-kK1-dkId1+iI1+diId1-iI1-diOd1+oO1+doOd1-oO1-dolxlx . . .l.ldsldsd:;d:ZX?vLdkKdkdiI#   didoOdoKIOlprogram too big@(#) bc:bc.sl 1.5 0707070000020045101067550001070000010000031557500000017757000001700000017564usr/bin/cancelR ן \t .text\ .data t@.bss t t.lib D Dg.p/N1nXO.p/N1nXO @g.p/N1nXO# # . N1*rfp./< NXON^NuNV.p/N1nXO.p/N1nXO.p/N1nXO.p/N1nXONhp.N1xN^NuNV.p/N1nXO.p/N1nXO.p/N1nXO.p/N1nXOp# N^NuNVN NN4N^NuNqNV.p/N1nXON^NuNVBp./< N8XOJfJ f0Np.N1. /< N1RXO# BN1J g\p.N1. . HH//<  /9 N1O -@BN1Jg. N1L`B `B J gpN^Nup`NV nJg.N1 ropN^Nu.N1 S"n 1Rf(.N1 U"n 1_f.N1 U"nB1./< ?/< 1/< (HnN1Op.HnN8XOrgp`~p`xNqNVp-./.N1&XO @-Hg8g2 .rn$ nA.N1V"n"o n 'mpN^Nu .././. N1PO ."n B1. N`NVJ Hg. HN1FB HJ Lg. LN1FB LJ Tg. XN"B TN^NuNVN.Nh-@rg. /.N1XOJf .N^NuNV/< DN1X OQ./HJf/H#0N(HHrr.f" nJ(g(HHrr/fpN^Nu nJ(gp`NV.NJgpN^Nup.N1N1-@rgJgHnN1XO .`N1-@N1.N1JB/./< W/< LN1TO .N1Jp.N1x`/< N1X OQ./HJf/H#0N. 4pT/p/pt/p//< t/9 N1O. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. 4/< /9 N1PO. /9 N1XOt`4 "| <-qg .paЂ//< /9 N1O Rpm.  /9 N1XO. 4pU/p/pu/p//< "/9 N1O. J/9 N1XOp./< \/9 N1PO. q/9 N1XO. u/9 N1 gZ,`RJ  g  g.HRNXO$@`RJ  g  gA.HRNXO$y `RJ  g  g. HRN'XO-@l .N.HRHkN1PO .CB1 .R`RJ  g  gA.HRN'XO$@`RJ  g  gA.HRN'XO$@  g .Npd`NqNVH$n -f\ 9HnN1XO @ gHnN)TXO./< N&XOJgA# Hn n NXOR `. HRN1tXOJlpf`p09 Jgp09  @f| 8# . HRN1RXO @-HgJHn/.N1POBn.p/p/HnN1dXO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XO. /9 N1XOJ9 f\. 4/< /9 N1PO. 4/< /9 N1POJ f. 4/< /9 N1PO`. 4/< /9 N1PO. /9 N1XO. 4/< /9 N1PO. ./9 N1XO` y n "瀐Jf2 "瀐Jf" "瀐Jf "瀐J g 9 R "y A"R `NV 9 R "yO .p/p/HnN1dO ` LN^Nu# . n NR `.p/p/HnN1dO rfdJngHnHR/< HnN1OHnN)TXO./< N&XOJgA# Hn n NXOR `~.N1F`PNVH$n `HnHRNPO$@ -f8RHnHRNxPO$@JfJf Jf .ܰmf .మl . N+\p-@-@-n .̰nf .`p-@`"Hn/.HH//.N OR.HnNXO-@fR` .ܰf .మf .䰮f .谮l . N+\ .nr.HnN #N^NuNVHn . "瀐"nA-HHPNDPO.Hn/< >/.N1O J g8.Hn/< ]/.N1O .Hn/< t/.N1O n N^NuNV ."n -qSgJ ."n -q .`Jg" .g ."瀐"n-q` .f .N^NuNVN%N^NuNVN^NuNVN^NuNqNVH$n nJf"JfJfJfJf JfJ g . N+\LN^NuNqNVH$nB ^B. N1Hn/< N",PO. HnNXO. HRNTXOHnHRNPOrdf J ^f 9 l . NXO-@gZHn/.HH//.N OR`.HnNXO-@gHn/.HH//.N O ,fRJftLN^NuNVH$n&n (J.HTNXO$@gJf . N+\Jf"'|'JfJ g6. N+\`(JgJ f'|' `J g . N+\ J LN^NuNqNVH $n&n f* *f *f * f pL N^Nup`NqNVH $np-@N-@N1./< \HnN1PO`PBBp /HSN'POJ* jf*./.N1XOJg.HnN1XOJf| j.N) .N$&@ g fJg+\ 9 -@ 3oJ*.g. /<0N1XO .R"瀐-@.N$ @%H ^./N,XO .RЀ"Ё-@.N$ @%HJ./N,XO j ^!n .DfJgr.HnNXOJg\BHn/< N*POp./.N,XOp-@# p# B IV`RLJg DfJg`p# -@#  * ll .` * l%@ l ."瀐"j ^G&'n'n'n 'n'n.N$ @-Hg* *Vf"*WHH @ggtnV @cg @eg`XJg *Vf.N$ @ f.N *Vf *sWg j ^ LN^Nu @ig| j g +Ug.NL N^NuNVH t` "| HnHRN'PO$@R .gfR.$   /< /< 4N1POJg . 4N+\L N^NuNVN1-@.N1-@N1Jf N^Nu n P`NqNVN1(# ND-@rfpc-@pFnpcmN-@rfp -@pnp mN-@rf./.NXO-@pn./.NlXO".nlN-@rfp-@JmPpmFN-@rfp;-@Jm*p;m"Nj-@rfp;-@Jmp;lpN^NuBl-|`. j DD`g <m` <nѮR .䰮mSg./.NXOѮ` .SѮ ."ЀЁ-@$n..N)T&@HHJ@g( @gg" @lf2BHS/< N*POl `6BHk/< N*PO` BHR/< N*PO "|  | L N^NuNqNVH .N1$@&n * 0p . *N10/ *R 0 *Rr .N10/ * 0p . * N10 * 0p . *N10: * 0p . *N10:  0p . N10B n L N^NuNVHB/.HnN*PO. HnN*XO/N1tXOJlpf4` p09 Jf&Hn/< /< N1O .Ѯ ."逐-@ .Ѯ ."逐-@ .Ѯ 90ѮHnN1XO @J g n p`NVp f6 .j DD`g <m` <n nfpN^Nu . S"|  1`NVH$y ` 0m 9oRJJfJg*HHr0Ѐ"Ё$JgHHr0Ԁ`t`t#  LN^NuNqNVH $n&n .HRN'XO$@ .fRJA.HRN'XO$@ .fRJA.HRN'XO$@ .fRJA .HRN'XO$@ J L N^NuNVH $n&n .//<  HSN1O JfSJg . /*/< &HSN1O JfS K  . N+\.N1. /.N1HXO$m LN^Nu. 5/.N#XO`NqNVH 90rg0r g/< N1PO. N+\`./< T`. x/.N#XO$ LN^NuNqNVH$nI &T gJfSJXL` n LN^NuNqNVH.N1 R$ nA(E` /fB`SJb n /g. nB( n LN^NuNqNVR 9 gp./< p/N1POJ gJp./< /N%   1PO. N1 ./9 p/N1POp./< p/N1POp./< /N1PO.N1 ./.p/N1POp./< p/N1PO9 gBN 9 g . y Np? Jg*rgrf$. N1p.N,.N1x 9 N^NuNV .N^NuNVH$n$. -J`BSl n LN^NuNqNVH$n`0RJ  g n LN^Nueof (co5)corrupted file (co6)fputs could not write to file (ut13)%.05u%.05u%.05u%5u%c%c%s %c%c %s/%s/%s directory `%s' nonexistent (ut1)xcreatno file (ut3)`%s' nonexistent (ut4)directory `%s' unwritable (ut2)no space! (ut10)write error (ut8)errno = %d, function = `%s' (ut11)OUT OF SPACE (ut9)OUT OF SPACE (ut9)OUT OF SPACE (ut9)ffree: Pointer not pointing to allocated area           SIGNAL: (ut12) Illegal instructionTrace/BPT trapIOT trapEMT trapFloating exceptionKilledBus errorMemory faultBad system callBroken pipeAlarm clockdump.core`%s' unreadable (ut5)`%s' unwritable (ut6)`%s' unreadable or unwritable (ut7)xopenERROR []: 0707070000020217111007550000020000020000031610730000017757000001500000006150usr/bin/commR & $h  .text$ .data h @.bss h h .lib unknown key letter (cm1)value after %c arg (cm7)key letter twice (cm2)missing file arg (cm3)can't have both -p and -c (cb2) %s: p-file exists (cb1)sid doesn't exist (cb3)nothing to do (cb4)admin -iCOMB$$ -r%s -fv%s -m '-yThis was COMBined' s.COMB$$ rm -f COMB$$ get -s -r%d -g -e -t s.COMB$$ get -s -a%d -r%d -g -e s.COMB$$ delta -s -m"$b" -y"$a" s.COMB$$ sed -n '/^%c%c$/,/^%c%c$/p' %s >comb$$ ed  - comb$$ <<\! 1d $c *** DELTA TABLE PRIOR TO COMBINE *** . w q ! prs -e %s >>comb$$ admin -tcomb$$ s.COMB$$\ -f%c%s\ sed -n '/^%c%c$/,/^%c%c$/p' %s >comb$$ ed - comb$$ <<\! v/^%c/s/.*/ -a& \\/ 1c admin s.COMB$$\ . $c . w q ! . comb$$ rm comb$$ rm -f %s mv s.COMB$$ %s admin -dv %s set `ls -st s.COMB$$ %s` c=`expr 100 - 100 '*' $1 / $3` echo '%s ' ${c}'%% ' $1/$3 rm -f s.COMB$$ get -s -k -r%s -p %s > COMB$$ a=`prs -r%s -d:C: %s` b=`prs -r%s -d:MR: %s` @(#) sccs:sccs.sl /< N1X OQ./HJf/H#0N %u (ceiling) (co16)release `%d' locked against editing (co23)%u.%u.%u.%utoo long (co7)s.not an SCCS file (co1)more than one link (co3)format error at line %u (co4)premature `p# p`XJ hfNp# h .S"y |B1p"y x`(J lf p# l .S"y |B1`N n rӨ hJfjX SpoN n .NR# n .N@# `Hn/9 NPOJlBN1xp.Hn/9 NPOHn/9 NPOJlp.Hn/9 `HnHnNPOJgrg@rfp.HnNXO`p.HnNXOHn/9 NJPOJl`Tp.HnNXOHn/9 N"POJlp.Hn/9 NPO`nNVH v$`2 n " n  g o n BpL N^NuRR nSm n"hR@H` .%   N1&pfp`NV . rgrgrfJ pgN^NuJ hg `J lf. . S"| t/1/< N1PO`NV./. NXO. /.NXOJlBN1xN^NuNVH p$n &n RRfJfpL N^Nulp`p`NV n -fJ(f -|0`<. /.N1RXO @-Hf"./< /<0N1POp.N1x n N^NuNV. $/<0N1XOp.N1xN^NuNq/< N1X OQ./HJf/H#0N \/N1x0<N@NVH $n pѮ&n&.-KBHH´gp f8p fp# JfJ f. @/< N XO L N^NuA-Hp# # -@# p^fR `Se. @/< 8N .XOHHp*gp\f {g-J촃f` r*gVn|r g"r$f@HHg  f.`J fp# `:. @/< XN XOJg n g g n`. n /NXOB`@p-@p# T` p-@B T n .N`p-@p# T n .NpѮ n Jfxp# TBNN^NuNVH$n n BtHH @ gV @ gN @+g( @-f$R` n Ѐ"ЁHHЁr0"H"RJJg 0m 9opLN^NuRJ`Jg n "H"D p`NVJ Lf>J Tg6p.B/9 HN1PO. HN1.xx @%s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression %s: Illegal Regular Expression Prefix %s too long il/< L/<0N1POJ Tg . HN1FN^NuNVH. /./<0N1POJ PfTJ HgX. HN1F$| `RJJfU.N1V$Jm../< QHRN1PO. N1S`J HgNp.N1xLN^NuNVH$nB. DN1-@p \fJ gBN`Sp# BNn @ gBR./< NXOJgB/./9 DN1PO 9 \ЮЮ LN^NuB/./9 DN1PO 9 \ЮЮ T`NVJ Tg. H/< N1XON^NuNVJ TgJ f# `R  y Jfpc l. @/< WN:XO 9 R legal option string: %s Usage: csplit [-s] [-k] [-f prefix] file args ... rCannot open %s %ld %.02d100 file limit reached at arg %s %.02dw%.02dCannot create %s %s: bad line number %s: Repeat count too large %s: missing '}' Illegal repeat count: %s No operation for %s %s: missing delimiter %s: illegal offset Interrupt - program aborted at arg '%s' %s - out of range %s - out of range %s - out of range @(#) fndcmd:fndcmd.sl 1.68 0707070000020253141007550000020000020000031611170000017757./< y/9 N1PO. /< N1RXO @-Hf@. HnN1XO 9 U./< /9 N1POHn/< NPO n N^Nu`NVJgR \. DHx/< N1PO-@ @ N^NuNVHn/.NtPOrf./< NRXO.NN^NuNVH $nGR`4Af. @/< NXOJf. @/< NXORJ }fBHnHnNPOrgJl. @/< NXOp f0 9 \# X-@JoZ 9 XѮ.N S`p f&`. X/< NXO.NSJn`. @/< NPXOL N^NuNVH n$H` 000001300000105740usr/bin/cuR ˥" i .texti .data p@.bss  \fRJf. @/<  NXORfR. XHRNXOrf./< !NXOHH./< @/< /.NO . X/< NPXO.N8LN^NuNV.zp/N1nXO. @/< 5N|XON^NuNVN# HJgP 9 \o. @/< ^NFXO 9 \lFp.N @ f. @/< qNXONl`p.N` @ f. @/< NXONN^NuN>p.N4 @ f`Nq OQ./HJf/H# N,/Nd 0<N@NVHB3%   #  B "B &B *B .B 2`rlgnr?gzrdgBregbrhg@rmgrog\rsgvrtfp# y `p# `|y y  B `b9 gR`P9 gR`3 y `.. "HN,# &# "`# "H *`p# 2. /. /.N-TPO-@rf 9 $lrJol"n -q. /.N7LXO$.Nbf # .`>. /.N6XOJfJ *f R&   `3 R` J *fRJg* n .09 H"| /1NJXOp.Nd . HxTBN]POp9 Jg@H`p 8p9 Jg@H`p :p9 Jg@H`p p9 Jg@H`p B9 gp `p  @p9 Jg@H`p Dp09 r# Fp09 r # J.p/N8XO.p/N8XO.p/N8XO | ./(/( /(/(/(NtO# NlZp Ng p Nf. " 9 ND"| /1` 9 ND"| ./9 JNXOp.Npn .CB1p.Np.N4H`$.Nb-@Ѯ-n`9 8g n9 :g 9 Bf6 nHH./9 zN XO nA./.N=XOp#  ../. nHhN6@PO-@ n|\ nA-HHn/.N6PO @-HfX .Ѯ mp.N4H-n.Nb././9 NNcPOJl. NLp# `.RJ f".HxA-HHPN1dPO @ fp.N(.NVp f0B . rN. *NR./9 fNXO`././9 jNPO. ,Np.N4H`. ./.N6d p.N . NvN r# RJfD.p/N8XO.p/N8XO.p/N8XON nLN^NuJ RoJ.p/N8XO.p/N8XO.p/N8XON*# .N`. NNNp.Nd `NVHp f . `E`9 69 @g9 BfBHnNXOrfpLN^Nu9 69 8g"9 >g9 69 :g J g*Jf&9 69 >f J Jg~. N `p9 69 J Fg. N `(p.N h`p.N \A" l  6`. ~`~JXOJg. 0/.N6XOJfBHxT/9 NN]PO`. 6/.N6XOJfl. HxT/9 NN]POJ f  `y . HxT/9 NN]POJ fp`p# p.N`$./< =NXO`NVH tp f . SNv`8 .~f .>fJl .:g .>fB* .>fp`p-@CEJg$p.HRN=XO&op.B/N=PO`.HRN2tXO&Jl(./9 ZNXO. eN

f B `BN rfAf 9~ 6f `p$Af 9~ 6gp`pĀJg`NVBHxTp/N]POBHxT/9 NN]POp.HxT/N]POp.HxT/N]POJ g$. rN p.N4H. N B N^NuNV. N p f./< N XO nHH @%gpn| @!g @$f" .Hn/NcPOA" ӮRE. NNrfZJf.NJfp.NJ9 6g 9 6g 9 6g 6 9 6gtA" lb`p.NL N^NuNVp f./< kNXOJf . `. HxTBN]POpfjy?   y y J f y ` J g   B9 pf  . HxTBN]PON^NuNVH vRplN8$m L N^Nup f . {N<. vN`NVp./< 6/.N=PO-@l2p f nJ(f.. `.N nHH./< 4N XXO`.N nHH./< :N 4XO`bpѮ.N`P @.g @lg. @tf4B`*J .f n (.g . .N pN^Nu. NN ` . ^N p`NVp f./< @N XON-@Jm^BN.p/N8XO-@.p/N8XO-@Jfp.N\p.B n $f 9 N`N^Nup/N2PO. NN\Bp/N8XOBp/N8XOBp/N8XOBp/N8XOpѮ nJfBBB/< Y/< Q`B/./< e/< b/< ZN8TO. VNBNd BNcȰp fB9 6N^Nup f . Ndpgp`NV`p f. N>p.N*p./< 6/.NcPO-@l p gpgpN^NuNV././././. /./< N2ON^NuNVH$n.Nb-@.HR/9 NNcPOg . RNLN^NuNV.p/N8XO.p/N8XOp# N^NuNVp f./< NTJl. /< N2XO. "LN hN^NuNV.N5TB/< N>hXO. p/N8XON^NuNV. N\N^NuNVp# . dp/N8XON^NuNV./< /< N2PON^NuNV(Bp-@A-HBN5T.*p/N8XO-@ n #  #  . /< Nd$XOrf. /< `p .N5Tp./.N=XO-@-y BN5TJl(#  9 "| ././< #`Z-| 0Hn/.NhPPO @-Hg-| 3Hn/.NhPPO-@-| 6Hn/.NhPPO-@-| 9Hn/.`N|`F|`> g `g g %fB| `| `| `| ./< XN=XO-@l. X`p`X nJf A-H` n-P nh nr2(p0fh0 nJfJf n` nh nJgDp/./< nN=XXO @-HgRp./< &/.N>POJg n nh n.Hh.HxT/.N]PO-@l. *N<`f nJg. :/(HnN=PO/N=XO.Nb-@A-Hp -@`JHH @:gn @+g& @,f&T`$p Ѯ` @=g @wg @~fZ`RR NhPPO-@-| POJfp./< nN=XO-@l. nN<`p2e ..N5T.Hn/.NcPO-@-y BN5T .ΰgN# pf. @N<`. X/< M/< N2POp fp`p`.N\`p./< d n/( N>POJf$./.NXO-@l.N\`p f | `.Hn/< X/. n/(NdO-@g./< l/< N2`p .N5Tp./< XN=XO-@-y BN5TJl# p fp`p-@`2.N\Bp//.N2POr.p//./< k`p./< {/.N>POJfAo-HHn/.NhPPO @-Hg"./.N=XO.NbѮ-n-n`Jg wg n =f nR"n`Jg n -f nR"n`ZJg n %f./.N=XO.`(Jg n ^f./.N=XO.NbѮR nJfVJg nR"n nBJg,HnoNXO./< ~/< N5PO. nNp.N5THnoNbXO.Hno/.NcPO-@-y BN5THnoNbXO".貀gh# pf2 9 "| ./< /< ` nR"n`.N2POp fp-@Jg .N^Nu .`NVTB^BZ n Jf. {`Bp./<  n /( N>POJgp./<  n /( N>POJf. HnN=XO` n J g. `p-@^.pd/HnN1dPO @ gr.HH./< N5XO @ f. HnN6XO-@.HnN6XOJg$J^gp./< /.N>POJg|. BN6XO./< /< XN=PO/N=XO n J g. X/( N6XOJg. ] n /( N6XOJfp/. n /( N5XO @ f6. /< N=XO n . /< N=XO n !|  . B./< /< N5POp fp` n wfLHn/NhPPO @-HgP nP-HJg0.HH.N4./< /< N5PO. nNA/-Hp.N5T`PJg2 nHH.N./< /< N5PO. nN n.g( nJgRp././.N=PO-@n-y BN5TJg .  nNJn># pf 9 "| ././< `./< ` nB` n cfHn/NhPPO @-HgJgV.N./< /< N5PO. nNHn/NpXO./< /< N5PO. nN6XO @-H 0f$p./< HnN>POJfB9 n`>p./< HnN>POJgb./< /< nN=PO/N=XO. BN6XO.N,-@f n Jg (ff n J fp^fXp./< /< XN>POJgxO $ nPOpLN^Nu./< /< N2POp`p.N4H Rrm. /< N2XO`NV`R nJf nA-H./< /< "lN5PO. "lN7N^NuNV y o<`R nJf nA-H./< /< "lN5PO. "lN7N^Nu0<N@ NuNqNVH $nt&HH @ gR @ gJ @+g$ @-g` Ѐ"ЁHHЁr0$`RRJ 0m 9oJg DL N^NuRJ` `NqNVHp (ff 9 $l*"n q -f 9 $ qJ(f`R $pLN^Nu. , 9 $"n /1N6XOJg 9 $"n q B LN^NuNq o"/g JfB @Nu NuNq o"ofBNuJgg H!HAHNuHHDNu o"o / o2SWg g `BQg g` / @NuNVHJf y " ` n$H g. HRN7LXOGJf LN^Nu. HSN6XO(@ fB " ` BR# " K`NVCp?BQC n "g.g @` n"ggAJ1g SN^NuB @N^NuNqNVCp?BQC n g @` npgAJ1WfRDN^NuNVH N8-@f,B/./< s/< p/< hN8TOp.N8.p/N(HH# "p:g./.N5XO$@ fJ gJ.  n /N/XO. /< /N/XO. /N/XO. p /N/XOR ( 9 $"n q (JfR $`R :f 9 $"n q"9 (RAJg( 9 $R $ q"9 (RA# "H`R $ 9 $mbJ gJ.  n /N/XO. /< DN/XO. /N/XO. p /N/XOp# (p?`T 9 $R $"n # "Hp# (`4R ( 9 $"n q (Jfp# (ѹ $B "H `NqNVH$n Sm jR. pHLN^Nu.p8XO$@.p/N8XO&@HnNcXO-@찮gpf.p/N8XO.p/N8XOpf .L N^Nu .`NV. Hn /.N8tPON^NuNq0<;N@Nc0<N@NrNq0<N@dNcJAgBNuNqNVH$. Smp op#  | LN^Nu "| "-q  gJ f". /NpXO-@ "| "# `2 "| "#  Ѐ"ЀЁ"|9A./N,XO-@ g JgJl-n n`^0<0N@dNcNuNqN$NNNN NNNNN N N N N NN. /NWjXO`NVH< $n t* HHrrf"Jg jf Jf* HHrD€f.NYJf`pg pL< N^Nu * l* HH"| `* HHr"| X q(H&j &n.NXrf `.B/.HSN2O @-Hg S&ת * l* HH"| `* HHr"| X q*HJlp` " l.N\:ԃJg$* HHrD€g.NXrg\ `׮`40<N@ NuNqNVH $. $n-n* f* gS` L N^NuJoJn".N3rf ng`SRl ` &.p //*/.NNNNNNNNNNNNN|NvNpNjNd N^!NX"NR#NL$NF%N@&N:'N4(N.)N(*N"+N,N-N.N /N0H o<0H/ | " PNXLXDNuNqNVN<0./. /.N@PO @ N^NuNVH$n.NV./. /.NPO @ LN^NuNVH$n gJg nJg n (+fp`p$ n HH @ag @rg, @wfJgp`p@`Jgp`p@@` Jgp`p&.//.N=PO(mJB @ Jg <` n N2O @-Hg &׮ת * l* HH"| `* HHr"| X q&HJlp` " l.N\:Jf`< nB n`"Nq0<N@dNcNuNq0<>N@dNcNuNVHA-H.//. N>xPO$ n( g pLN^Nu `Nq /o*"/ o"oSѲWg f B @Nu Nu`NVH $nJf.NZ* f* g * HHrD€g$&| `+ g.NWG e&|  `+ g.NWG Te%j* gp`8 * l* HH"| `* HHr"| X q rfp`p@ n af&Jf"p.B/N=POJl LN^Nu%H%H J`NVH-| -| F$| `e$|  `E* HH@f  f.$|  `e LN^NuE* HH@f J`NVH$| x 9 䰹 l "| $q.Nb$g&./.p/NcPOp./< /NcPO.Nb.HRp/NcPOp./< p/NcPOLN^NuNq0<!N@dNcNuNqNVH $n.f&JJf K L N^NuNq0<N@dNcNuNq0<N@dNcNuNq0<N@dNcNuNq o"oJWfSWf /